| Basic Information | |
|---|---|
| Family ID | F045311 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRRTAKELAEAIGARLEGDGTAELGGVAAPERAGAHDLIYVESA |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.56 % |
| % of genes near scaffold ends (potentially truncated) | 86.93 % |
| % of genes from short scaffolds (< 2000 bps) | 81.05 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.235 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.797 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.719 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.327 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.28% β-sheet: 5.56% Coil/Unstructured: 79.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF03279 | Lip_A_acyltrans | 92.81 |
| PF13231 | PMT_2 | 4.58 |
| PF02366 | PMT | 1.31 |
| PF13249 | SQHop_cyclase_N | 0.65 |
| PF04613 | LpxD | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 92.81 |
| COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 92.81 |
| COG1044 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.24 % |
| Unclassified | root | N/A | 11.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104987429 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300001174|JGI12679J13547_1008773 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101011629 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300002557|JGI25381J37097_1076095 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300002908|JGI25382J43887_10217360 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300002917|JGI25616J43925_10243361 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300004091|Ga0062387_100842448 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300004092|Ga0062389_103762824 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005174|Ga0066680_10423535 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300005176|Ga0066679_10671749 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005177|Ga0066690_10016340 | All Organisms → cellular organisms → Bacteria | 4003 | Open in IMG/M |
| 3300005179|Ga0066684_10214918 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300005332|Ga0066388_102177078 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300005437|Ga0070710_10269672 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300005450|Ga0066682_10807840 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005541|Ga0070733_10993844 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300005552|Ga0066701_10278427 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300005553|Ga0066695_10084173 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
| 3300005712|Ga0070764_10888615 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005718|Ga0068866_10096255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1623 | Open in IMG/M |
| 3300005921|Ga0070766_10286862 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300005921|Ga0070766_10918463 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005993|Ga0080027_10271087 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300006031|Ga0066651_10784316 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006032|Ga0066696_10311715 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300006052|Ga0075029_101178351 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300006162|Ga0075030_100857134 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300006173|Ga0070716_100550146 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300006174|Ga0075014_100079551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1484 | Open in IMG/M |
| 3300006174|Ga0075014_100946706 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006791|Ga0066653_10677666 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006893|Ga0073928_10018462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7315 | Open in IMG/M |
| 3300007265|Ga0099794_10661707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300007788|Ga0099795_10192428 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300009012|Ga0066710_102491825 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300009038|Ga0099829_10079966 | All Organisms → cellular organisms → Bacteria | 2500 | Open in IMG/M |
| 3300009038|Ga0099829_11217451 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300009444|Ga0114945_10082170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1791 | Open in IMG/M |
| 3300009698|Ga0116216_10809083 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010159|Ga0099796_10356552 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300010326|Ga0134065_10058837 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300010336|Ga0134071_10465288 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300010358|Ga0126370_11709135 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300010359|Ga0126376_10019575 | All Organisms → cellular organisms → Bacteria | 4403 | Open in IMG/M |
| 3300010359|Ga0126376_10421038 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300010360|Ga0126372_13138687 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010361|Ga0126378_10273271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1788 | Open in IMG/M |
| 3300010396|Ga0134126_10134633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3008 | Open in IMG/M |
| 3300010937|Ga0137776_1603624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1407 | Open in IMG/M |
| 3300011269|Ga0137392_10145631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1908 | Open in IMG/M |
| 3300011269|Ga0137392_10885370 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300011271|Ga0137393_11424361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300012189|Ga0137388_10233266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1670 | Open in IMG/M |
| 3300012203|Ga0137399_11756126 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012205|Ga0137362_11242140 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300012357|Ga0137384_10409296 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300012362|Ga0137361_10844612 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300012582|Ga0137358_10518417 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012683|Ga0137398_11159990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300012918|Ga0137396_10168566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1601 | Open in IMG/M |
| 3300012918|Ga0137396_10429105 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300012923|Ga0137359_11333714 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012924|Ga0137413_10286252 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300012931|Ga0153915_10430907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1498 | Open in IMG/M |
| 3300012931|Ga0153915_12314019 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300012944|Ga0137410_10880308 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300014150|Ga0134081_10353213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300014166|Ga0134079_10213770 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300015053|Ga0137405_1333353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2301 | Open in IMG/M |
| 3300015242|Ga0137412_10063041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 3016 | Open in IMG/M |
| 3300015359|Ga0134085_10484697 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300016750|Ga0181505_10975667 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300017823|Ga0187818_10369961 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300017930|Ga0187825_10444554 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300017933|Ga0187801_10056314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1437 | Open in IMG/M |
| 3300017961|Ga0187778_10672634 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300017972|Ga0187781_10059877 | All Organisms → cellular organisms → Bacteria | 2621 | Open in IMG/M |
| 3300017995|Ga0187816_10044805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1834 | Open in IMG/M |
| 3300019890|Ga0193728_1169262 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300020170|Ga0179594_10005256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3285 | Open in IMG/M |
| 3300020580|Ga0210403_10809740 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300020581|Ga0210399_10887999 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300020581|Ga0210399_11564444 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300021046|Ga0215015_10999360 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300021086|Ga0179596_10445419 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300021168|Ga0210406_10114383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2284 | Open in IMG/M |
| 3300021168|Ga0210406_10489672 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300021168|Ga0210406_11200482 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300021171|Ga0210405_11114632 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300021178|Ga0210408_10025239 | All Organisms → cellular organisms → Bacteria | 4720 | Open in IMG/M |
| 3300021178|Ga0210408_11322861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300021181|Ga0210388_10854578 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300021401|Ga0210393_11398369 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300021405|Ga0210387_10817330 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300021406|Ga0210386_10321755 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300021406|Ga0210386_11704801 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300021420|Ga0210394_10953721 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300021433|Ga0210391_10885048 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300021433|Ga0210391_11135419 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300021478|Ga0210402_10808419 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300022557|Ga0212123_10396877 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300024179|Ga0247695_1064524 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300024246|Ga0247680_1062227 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300024330|Ga0137417_1048340 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300025933|Ga0207706_11496190 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300026305|Ga0209688_1053043 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300026325|Ga0209152_10063534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1322 | Open in IMG/M |
| 3300026326|Ga0209801_1344213 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300026331|Ga0209267_1060070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1688 | Open in IMG/M |
| 3300026335|Ga0209804_1068021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1696 | Open in IMG/M |
| 3300026342|Ga0209057_1180098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300026482|Ga0257172_1080620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300026550|Ga0209474_10349048 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300027643|Ga0209076_1204946 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300027660|Ga0209736_1191712 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300027684|Ga0209626_1178303 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300027846|Ga0209180_10634218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300028047|Ga0209526_10761804 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300028146|Ga0247682_1106340 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300028536|Ga0137415_10413945 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300028536|Ga0137415_10647444 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300031545|Ga0318541_10517387 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300031546|Ga0318538_10203654 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300031753|Ga0307477_10256053 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300031962|Ga0307479_10380358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1396 | Open in IMG/M |
| 3300031962|Ga0307479_11305299 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300031962|Ga0307479_11641512 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300032180|Ga0307471_100440072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1441 | Open in IMG/M |
| 3300032180|Ga0307471_100766601 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300032180|Ga0307471_101812848 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300032783|Ga0335079_11046897 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300032783|Ga0335079_11246790 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300032893|Ga0335069_11419178 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300032955|Ga0335076_10801146 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300033158|Ga0335077_11399916 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.31% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.31% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.65% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.65% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.65% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.65% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1049874291 | 3300000364 | Soil | MTRTAKELAEILGAVLEGDGSAELHNVAAPERAGARDLV |
| JGI12679J13547_10087732 | 3300001174 | Forest Soil | MAKTAGELAAAIRAELRGDRDFVVRGVAAPERAGAHDLIYVES |
| JGIcombinedJ26739_1010116292 | 3300002245 | Forest Soil | MKWTAGELAKAIEARLEGDGTLEIAGVAAPERAGT |
| JGI25381J37097_10760951 | 3300002557 | Grasslands Soil | MRRTAKEVAEAIGAKLEGDGATELGGVAAPERAGTRDLIYVESAKHA |
| JGI25382J43887_102173602 | 3300002908 | Grasslands Soil | MRRTAAELAEQAGAKLEGDGTLEIGGVAGPERAGARDLIY |
| JGI25388J43891_10165991 | 3300002909 | Grasslands Soil | MRRTAAELAEQAGAKLEGDGTLEIGGVAGPERAGARDLIYVETAKYAGRAVAS |
| JGI25616J43925_102433611 | 3300002917 | Grasslands Soil | MRRTAKELAEAIGARLEGDGAFELSGIAAPERAGARDLIY |
| Ga0062387_1008424482 | 3300004091 | Bog Forest Soil | MRLTAKAVAEAIGARLDGDGGLEIIGVGAPERAGTKDLIYVEA |
| Ga0062389_1037628241 | 3300004092 | Bog Forest Soil | MPVLQKAVSMSRTAQEVALSIGAQLDGDGSLELKSVAAPERAGAHDLI |
| Ga0066677_106261752 | 3300005171 | Soil | MRRTAQELGEAIGARVEGDGTAELGGVAAPGRAGERDLIYVESAKHTQRASASAAICVIAAEGIA |
| Ga0066680_104235352 | 3300005174 | Soil | MRRTAKELADAIGARLEGDGTVEIGGVAAPEHAGAGDLIY |
| Ga0066679_106717492 | 3300005176 | Soil | MRRTAAELAEQAGAKLEGDGTLEIGGVAGPERAGARDLIYVETAKFAGRA |
| Ga0066690_100163401 | 3300005177 | Soil | MRRTAQELGEAIGARVEGDGTAELGGVAAPGRAGERDLIYVESAKH |
| Ga0066684_102149182 | 3300005179 | Soil | MRRTAAELAEQAGAKLEGDGTLEIGGVAGPERAGARDLIYVETAKYAG |
| Ga0066388_1021770781 | 3300005332 | Tropical Forest Soil | MKRTARELADSIGAILEGEGSVEISGVAAPERAASRDLIYVESAKHVERA |
| Ga0070710_102696722 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTAQELADQIGARLEGDGSIELSAVAAPEAAGQHDLIYV |
| Ga0066682_108078402 | 3300005450 | Soil | MRRTAKEVAEAIGAKLEGDGAAELGGVAAPERAGARDLIY |
| Ga0070733_109938442 | 3300005541 | Surface Soil | MKKTVQELANQIGARVEGDTSFELSGIAAPERAGESDL |
| Ga0066701_102784271 | 3300005552 | Soil | MKRTAKELAEAVSAKLEGDGTLEVGGVAAPERAGAR |
| Ga0066695_100841733 | 3300005553 | Soil | MRRTARELAVAVSATLEGDAEVEIGGVAAPERAGTRDLIYVE |
| Ga0070764_108886152 | 3300005712 | Soil | MMQTAKSLAEAVGAKLEGDGGIELRGVAAPERAGAHDLIYVEK |
| Ga0068866_100962551 | 3300005718 | Miscanthus Rhizosphere | MKRTAAEIAEVVGAKVEGDGSVELRGVAAPERAGPHDLIYL |
| Ga0070766_102868621 | 3300005921 | Soil | MRTAKEIAGMVGARVEGDGAVELISVAAPERAGAHDLIYVEAGKH |
| Ga0070766_109184631 | 3300005921 | Soil | MMQTAKSLAEAVGAKLEGDGAVELRGVAAPERAGAHDLIYVE |
| Ga0080027_102710872 | 3300005993 | Prmafrost Soil | MKYTAEELARVIEARVDGDGRLELIGVAAPERAGSRDLIYVESA |
| Ga0066651_107843162 | 3300006031 | Soil | MRRTAAELAEQAGAKLEGDGTLEIGGVAGPERAGARDLIYVETAKYAGRAV |
| Ga0066696_103117152 | 3300006032 | Soil | MRRTAAELAEQAGAKLEGDGTLEIGGVAGPERAGARDLIYVETAKYAGR |
| Ga0075029_1011783511 | 3300006052 | Watersheds | MKYSVADLAKAIDARVEGDATLEVTGVAAPERAGSRDLIYVE |
| Ga0075030_1008571342 | 3300006162 | Watersheds | MTKTAGELAAAIGAELEGDRGFEVRGVAAPERAGTHDLIY |
| Ga0070716_1005501462 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRTAAEIAEVVGAKVEGDGSVELRGVAAPERAGPHDLIYLEAAKH |
| Ga0075014_1000795511 | 3300006174 | Watersheds | MTRTANELAEAIGATLEGEANLEIRGVAAPERAGPHDLIYVEA |
| Ga0075014_1009467062 | 3300006174 | Watersheds | MNVTAKELAERIGARVDGDGWLELTGVAAPERAGVKDLI |
| Ga0066653_106776661 | 3300006791 | Soil | MRRTARELAAAIDAVLEGDGALEVTGVAAPEGATSRDLIYV |
| Ga0073928_100184628 | 3300006893 | Iron-Sulfur Acid Spring | MTKTAGELAAAIGAKLYGDRSLEVRGVAAPERAGAHDLIYVE |
| Ga0099791_102568881 | 3300007255 | Vadose Zone Soil | MMRRTAKELAEAIGARLEGDGTAELGGVAAPERAGAHDLIYVESMKHAQRAVGSA |
| Ga0099794_106617071 | 3300007265 | Vadose Zone Soil | MMRQTAKEVAEAIGARLEGDGAAELVGVAAPERAGAHDLIY |
| Ga0099795_101924282 | 3300007788 | Vadose Zone Soil | MMTMTAGELAAAIGAELNGDKDFEVRGVAAPERAGEHDLIYIEAA |
| Ga0066710_1024918251 | 3300009012 | Grasslands Soil | MTRTAKELAELLGVELEGDGGGELQNVAAPERAGA |
| Ga0099829_100799661 | 3300009038 | Vadose Zone Soil | MRRTAKELAEAIGARLEGDGTAELGGVAAPERAGAHDLIYVESA |
| Ga0099829_112174512 | 3300009038 | Vadose Zone Soil | MRRTAKELAEAIGARLEGDGAFELAGIAAPERAGT |
| Ga0099828_103416381 | 3300009089 | Vadose Zone Soil | MTKVAGELAAAIGAELNGDGDFEVRGVAAPERAGAHDLIYVEAAKHAGRAAQSA |
| Ga0114945_100821703 | 3300009444 | Thermal Springs | MTRTAREIAEFVGAKLEGDAAVTVSGIAAPEAAGPEDLIYL |
| Ga0116216_108090832 | 3300009698 | Peatlands Soil | MKSTARDVAQAVGAQLEGDGLMELTGAAAPERAGSHDLIYVETAKHAE |
| Ga0099796_103565522 | 3300010159 | Vadose Zone Soil | MTKTAGELAAAIGADLEGDKTVVLRGVAAPERAGPHDLIY |
| Ga0134065_100588373 | 3300010326 | Grasslands Soil | MRRTAAELAEQAGAKLEGDGTLEIGGVAGPERAGARDLIYV |
| Ga0134071_104652881 | 3300010336 | Grasslands Soil | MRRTAAELAEQAGAKLEGDGTLEIGGVAGPERAGARDLIYVETAK |
| Ga0134062_105230832 | 3300010337 | Grasslands Soil | VAEAIGAKLEGDGATELGGVAAPERAGARDLIYVESAKHAQRAAASAAI |
| Ga0126370_117091352 | 3300010358 | Tropical Forest Soil | MTRTAKELADLLGVELEGDGTAELQNVAAPERAGAKDLIYV |
| Ga0126376_100195755 | 3300010359 | Tropical Forest Soil | MKWTAGELAKAIDARVEGDASLEITGVAAPERAGT |
| Ga0126376_104210382 | 3300010359 | Tropical Forest Soil | MMKTARELAEAVGARMEGDGALEIRGVAAPERSGIHDLIYV* |
| Ga0126372_131386871 | 3300010360 | Tropical Forest Soil | MTLTAGELGDAIGARVEGSATLELRGVAAPERAGPYDLIY |
| Ga0126378_102732711 | 3300010361 | Tropical Forest Soil | MKWTAGELAKAIGAHVEGDPAQEITGVAAPERAGAKELIYVEG |
| Ga0134126_101346334 | 3300010396 | Terrestrial Soil | MIQTAKSLAEALGAILEGDGGVELRGVAAPERAGPHDLIYVEKA |
| Ga0137776_16036241 | 3300010937 | Sediment | MNRTAKELAELIGATLEGDGAAEVQGVAAPERAGVRDLI |
| Ga0137392_101456311 | 3300011269 | Vadose Zone Soil | MRQTAKELAEAIGARLEGDGTAELGGVAAPERAGAR |
| Ga0137392_108853701 | 3300011269 | Vadose Zone Soil | MKRTARELAEAIGLKLEGDGAVEIAGVAAPERAGARDLIYVESARHA |
| Ga0137392_111505771 | 3300011269 | Vadose Zone Soil | MMKRTAKELAEAIGARLEGDGAMEIASVAAPERAGARDLIYVEAAKHAERVAASA |
| Ga0137393_114243612 | 3300011271 | Vadose Zone Soil | MMRQTAKELAEAIGARLEGDGAAELVGVAAPERAGARDLIYVE |
| Ga0137388_102332663 | 3300012189 | Vadose Zone Soil | MKRTARELAEAIGLKLEGDGGAEIAGVAAPERAGARDLIYVESARHA |
| Ga0137399_117561261 | 3300012203 | Vadose Zone Soil | MMKRTAKELAESLGATLEGDGRAEVAGVAAPERAGASDLIYVE |
| Ga0137362_112421401 | 3300012205 | Vadose Zone Soil | MKRTAKELAESLGATLEGDGSLEVAGVASPERAGAR |
| Ga0137384_104092961 | 3300012357 | Vadose Zone Soil | MRRTARELADAIDATLEGEGSLEITGVAAPERAASRDLIYADSA |
| Ga0137361_108446122 | 3300012362 | Vadose Zone Soil | MMKRTAKELAEAIGARLEGDGTMEIAGVAAPERAGARDLIYVEAA |
| Ga0137358_105184172 | 3300012582 | Vadose Zone Soil | MDMTRTAKELAEAIGARLEGDAAAEIRSVAAPERAGPHDLIYVEAAKHADRATASA |
| Ga0137398_103349481 | 3300012683 | Vadose Zone Soil | MMRRTAKELAEAIGAKLEGDEAAELSGVAAPERAGARDLIYVESAKHAQRAAT |
| Ga0137398_111599901 | 3300012683 | Vadose Zone Soil | MMRRTAKELAEAIGAKLEGDDAAEISGVAAPERAGARDLIYVESAKHAQRAAT |
| Ga0137396_101685663 | 3300012918 | Vadose Zone Soil | MTKTAGELAAALGAKLEGDRHVEVRGVAAPERAGAHDLIYVEAAKHADRAT |
| Ga0137396_104291051 | 3300012918 | Vadose Zone Soil | MAMTRTAKELAEAVGANVEGDATVEVRGVAAPERAGLHDLIYVEAVKHAE |
| Ga0137359_113337142 | 3300012923 | Vadose Zone Soil | MTMTAGELAAAIGAELNGNKDFEVRGVAAPERAGEHDLIYIEAAKHSERAAT |
| Ga0137413_102862521 | 3300012924 | Vadose Zone Soil | MMTMTAGELAAAIGAELNGDKDFEVRGVAAPERAGEHDLIYIE |
| Ga0137419_119842522 | 3300012925 | Vadose Zone Soil | MTKTAKELSEAIGATLEGDGSLELRAVAAPERAGAHDLIYFEWLLHAARAT |
| Ga0153915_104309071 | 3300012931 | Freshwater Wetlands | MGKTARELAEALGLQLEGDGNVLLRGVAAPERAGPHELIYLDA |
| Ga0153915_123140191 | 3300012931 | Freshwater Wetlands | MGKTARELAEALGLKLEGDENVLLRGVAAPERAGPHDLIYLDAVKYA |
| Ga0137410_108803081 | 3300012944 | Vadose Zone Soil | MRWTVGELAKAIEARVEGDGTLEITGVAAPERAGAKQLIYVEA |
| Ga0134081_103532132 | 3300014150 | Grasslands Soil | MKRTAKELADAIGATFEGDSTLEISGVAAPERAASRDLIYVD |
| Ga0134079_102137702 | 3300014166 | Grasslands Soil | MRRTAAELAEQAGAKLEGDGTLEIGGVAGPERAGARDL |
| Ga0137414_10302202 | 3300015051 | Vadose Zone Soil | MMRRTAKELAEAIGAKLEGDEAAELSGVAAPERAGARDLIYVESAKHAQRAATSAAIC |
| Ga0137411_13736604 | 3300015052 | Vadose Zone Soil | MTKTAGELAAAIGAELNGDEKSELSGVAAPERAGAHDLIYIEAARHASARQLRRQDA* |
| Ga0137405_13333535 | 3300015053 | Vadose Zone Soil | MIRTAQELAEILGVALEGDGSVELQSVAAPERAGHAI* |
| Ga0137420_12642753 | 3300015054 | Vadose Zone Soil | MMRRTAKELAEAIGARLEGDSTAELDGVAAPERAGAHDLIYVESAKHAQRAVASAAIC |
| Ga0137418_100651494 | 3300015241 | Vadose Zone Soil | MRRTAQELAEAIGADLEGDGTVEIGGVAAPERAGARDLIYVESAKHAQRGAASAAICVIGAEGL |
| Ga0137418_103851992 | 3300015241 | Vadose Zone Soil | MMRRTAKEVAEAIGTKLEGDGANELGGVAAPERAGARDLIYVESAKHAQRAVAS |
| Ga0137412_100630411 | 3300015242 | Vadose Zone Soil | MRWTATELAKAIEVRLEGDGTLEITGVAAPERAGAKQ |
| Ga0137412_107272503 | 3300015242 | Vadose Zone Soil | MKKTANELAAALRATIEGNGGAELSGAASPERAGARDLIYVESAKHAAR |
| Ga0134085_104846972 | 3300015359 | Grasslands Soil | MTRTAKELAELLGVELEGDGGVELQNVAAPERAGARDLIYVESAKHA |
| Ga0181505_109756671 | 3300016750 | Peatland | MNLTAREVAEKIGAKLEGDGALELAGVAAPERAGSKQLIYVEA |
| Ga0187818_103699612 | 3300017823 | Freshwater Sediment | MQTAKAIAEAVGAKLEGDGDIELRGVAAPERAGPHDLI |
| Ga0187825_104445542 | 3300017930 | Freshwater Sediment | MQTAMSLAEAVGAKLEGDGAIELRGVAAPERAGPHDLIYLEKA |
| Ga0187801_100563141 | 3300017933 | Freshwater Sediment | MKKTTGELAESIGARVEGDRDFEVSGVAAPEKAGSHDLIYVEAAKHAARANAS |
| Ga0187778_106726342 | 3300017961 | Tropical Peatland | MNLTAKELAEKIGARIEGDGWLELAGVAAPERAGVNDLIYVES |
| Ga0187781_100598771 | 3300017972 | Tropical Peatland | NQAMKSTAKDVAQAVGAKLEGDGSLELTGVAAPERAGSHDLI |
| Ga0187816_100448053 | 3300017995 | Freshwater Sediment | MKFTTKELATKIDAKLEGNGELELEGVAAPERAGS |
| Ga0193728_11692622 | 3300019890 | Soil | VAMKKTAKELAEAIGAEVEGDGELDLCGVASPERAG |
| Ga0179594_100052561 | 3300020170 | Vadose Zone Soil | MRKTAQELAEEIGAAVEGDGAVELRGVAAPERAGPHDLI |
| Ga0210403_108097402 | 3300020580 | Soil | MKRTAKELAEAIGAKLEGEGAAEVGGVAAPERAGARDLIYVES |
| Ga0210399_108879991 | 3300020581 | Soil | MKWTAGELAKAIEARVEGDAGLEITGVAAPERAGAKQLIYVEAAKHAE |
| Ga0210399_115644441 | 3300020581 | Soil | MKWTAAELAKAIDAQLDGDGTLEITGVAAPERAGAKQLI |
| Ga0215015_109993601 | 3300021046 | Soil | MTMAGELAAAIGAGLEGDKSFELRGVAAPERAGPHDLIYVEAAK |
| Ga0179596_103068612 | 3300021086 | Vadose Zone Soil | MRRTAKEVAEAIGTKLEGDGAAELGGVAAPERAGARDLIYVESAKHAQRAVASAAICVIA |
| Ga0179596_104454191 | 3300021086 | Vadose Zone Soil | MTKVAGELAAAIGAELNGDGDFEVRGVAAPERAGAHDLIYVEA |
| Ga0210406_101143833 | 3300021168 | Soil | MQTASAIAAAVGAKLEGDGSIELRGVAAPERAGPHDLIY |
| Ga0210406_104896721 | 3300021168 | Soil | MRTAKEIAGMVGARLEGDGAVELISVAAPERAGAHDLIYVEAGKHAE |
| Ga0210406_112004821 | 3300021168 | Soil | MIQTAKSLAEAVGAKLEGDGAIELRGVAAPERAGPHDL |
| Ga0210405_111146321 | 3300021171 | Soil | MKWTAGELAKAIEARLEGNGALEITGVAAPERAGAKQLIYVEAAKHAER |
| Ga0210408_100252395 | 3300021178 | Soil | MKTVAELAAAVGVRVEGDGEMELRGVAAPERAGAHDLI |
| Ga0210408_113228612 | 3300021178 | Soil | MRRTAKELAEAIGARLEGDGTAELGGVAAPERAGAHDLIYVESAKHAP |
| Ga0210388_108545782 | 3300021181 | Soil | MSRTAQQLVAEIGVRIEGDGAVELRGVAAPERAGPHD |
| Ga0210393_113983692 | 3300021401 | Soil | MKRTVEEIARHVGARVEGDGSFELNGIAAPERAGAHDLVYVDS |
| Ga0210387_108173301 | 3300021405 | Soil | MKMTASELAAVIGAAVEGDGTAEVRGVAAPERAGAHDLIYVEKTKA |
| Ga0210386_103217551 | 3300021406 | Soil | MTKTAGELAVAIGAELEGDRDFEVRGVAAPERAGTHDL |
| Ga0210386_117048011 | 3300021406 | Soil | MKWTAGELAKAIEARLEGDGTLEITGVAAPERAGAKELIYVES |
| Ga0210394_109537211 | 3300021420 | Soil | MKWTAGELAKAIEARLEGDETLEITGVAAPERAGVKQ |
| Ga0210391_108850481 | 3300021433 | Soil | MKVTAGELGLAVGARVEGEAMAEIVGVAAPERAGAEDLIYVDGLK |
| Ga0210391_111354192 | 3300021433 | Soil | MMQTAKSLAEAVGAKLEGDGGIELRGVAAPERASP |
| Ga0210402_108084191 | 3300021478 | Soil | MKTVAELAAAVGARVDGDGEMELRGVAAPERAGAHDLIYVETAKHADRAVA |
| Ga0212123_103968772 | 3300022557 | Iron-Sulfur Acid Spring | MTKTAGELAAAIGAKLYGDRSLEVRGVAAPERAGAHDL |
| Ga0247695_10645242 | 3300024179 | Soil | MTRTAKDLAELLGVELEGDGGVELQNVAAPERAGARDLIYVESAK |
| Ga0247680_10622271 | 3300024246 | Soil | MTRTAKELAELLGVALEGDGGVELQNVAAPERAGARDLIYVESAKHAER |
| Ga0137417_10483402 | 3300024330 | Vadose Zone Soil | MRRTAKELAEAIGARLEGDGTAELGGVAAPERAGAHDLIYVESMKHA |
| Ga0207706_114961901 | 3300025933 | Corn Rhizosphere | MKRTAAEIAEVVGAKVEGDGSVELRGVAAPERAGPHD |
| Ga0209688_10530431 | 3300026305 | Soil | MRRTARELAVAISARLEGDAEVEIGGVAAPERAGTRDLIYVQSAK |
| Ga0209152_100635341 | 3300026325 | Soil | MRRTAKEVAEAIGAKLEGDGATELGGVAAPERAGTRDLIYVESAKHAQ |
| Ga0209801_13442132 | 3300026326 | Soil | MTRTAKELAELLGVELEGDGGVELQNVAAPERAGA |
| Ga0209267_10600701 | 3300026331 | Soil | MRRTAAELAEQAGAKLEGDGTLEIGGVAGPERAGA |
| Ga0209804_10680213 | 3300026335 | Soil | MRRTARELAVAVSATLEGDAEVEIGGVAAPERAGTRDLIYV |
| Ga0209057_11800981 | 3300026342 | Soil | MRRTARELAVAVSATLEGDAEVEIGGVAAPERAGTRDLIYVESAKHA |
| Ga0257146_10339492 | 3300026374 | Soil | MRRTAKELAEAIGARLEGDGTAELGGLAAPERAGAHDLIYVESAKHAPRAVAS |
| Ga0257172_10806201 | 3300026482 | Soil | MTRTAKELAEAVGANVEGDPTVEVRGVAAPERAGLHDL |
| Ga0209806_10087766 | 3300026529 | Soil | MRRTARELAVAVSATLEGDAEVEIGGVAAPERAGTRDLIYVESAKHAQRAAASASIIAI |
| Ga0209474_103490481 | 3300026550 | Soil | MRRTAAELAEQAGAKLEGDGTLEIGGVAGPERAGARD |
| Ga0209076_12049462 | 3300027643 | Vadose Zone Soil | MTKVAGELAAAIGAELNGDGDFEVRGVAAPERAGAHDLIYVEAAKHAGRAA |
| Ga0209736_11917121 | 3300027660 | Forest Soil | MNRTVREIAEAIGANVEGDATIELASVAAPERAGAKD |
| Ga0209626_11783032 | 3300027684 | Forest Soil | MRRTAKELAEAIGAKLEGDAAAEISGVAAPERAGARDLIYVESAKH |
| Ga0209180_106342182 | 3300027846 | Vadose Zone Soil | MRRNAKELAEAIGARLEGDGAAELGGVAAPERAGARDLIYVEAAKH |
| Ga0209526_107618041 | 3300028047 | Forest Soil | MTKTAGELAAAIGADLKGDKTLELRGVAAPERAGP |
| Ga0247682_11063401 | 3300028146 | Soil | MKWTAGELAKAIEARVEGDGAQEITGVAAPERAGA |
| Ga0137415_104139451 | 3300028536 | Vadose Zone Soil | MRRTAAELAEQAGAKLEGDGTLEIGGVAGPERSGARDLIY |
| Ga0137415_106474442 | 3300028536 | Vadose Zone Soil | MRRTAKELAEAIGARLEGDGTAELGGVAAPERAGAHDLI |
| Ga0318541_105173871 | 3300031545 | Soil | MKLTAKQLAEKIGARLEGDGALELLGVASPERASSK |
| Ga0318538_102036541 | 3300031546 | Soil | MKQTAAEVAVVVGAKVEGDGSLELVGVAAPERAGAR |
| Ga0307477_102560531 | 3300031753 | Hardwood Forest Soil | MKRTARELAEAIGALLEGDGATEISGVAAPERAGTRDLIYVES |
| Ga0307479_103803581 | 3300031962 | Hardwood Forest Soil | MMRRTAKELAEAIGATVEGDGAAELSGVAAPERAGARDLIYVESAKHA |
| Ga0307479_113052991 | 3300031962 | Hardwood Forest Soil | MMWTAGELAKAIEARLEGNGALEITGVAAPERAGAKQLIYVEAAKHTE |
| Ga0307479_116415121 | 3300031962 | Hardwood Forest Soil | VRLMMRQTAKDLAEAIGAKLEGDGTLEIGGVAAPERAG |
| Ga0307471_1004400723 | 3300032180 | Hardwood Forest Soil | MKRTAKELAEAIGGTLEGDGAAEVRGVAAPERAGPLDLIYVETAKHA |
| Ga0307471_1007666012 | 3300032180 | Hardwood Forest Soil | MKRTAKELSELIGTTVEGDGSVEVAGVAGPERAGARDLIYVESAKHAVRAAA |
| Ga0307471_1018128481 | 3300032180 | Hardwood Forest Soil | MNRTAQELAEMLGVALEGDGSAELQNVAAPERAGA |
| Ga0335079_110468971 | 3300032783 | Soil | MKWTSGDLANAIGARVEGDPTQEITGVAAPERAGAKELIYVEAAKHA |
| Ga0335079_112467902 | 3300032783 | Soil | MTHTAKELAEAVGATLEGDASFELRGVAAPERAGAHDLIYV |
| Ga0335069_114191781 | 3300032893 | Soil | MKVTAAELAEKIGARMEGDESAELTGIAAPERAGVKDLIY |
| Ga0335083_111479482 | 3300032954 | Soil | MNRTAKEIAELIGAAVEGDGSAELQGVAAPERAGARYLIYIDAAKNVERAAQSAARVAIAPTGISL |
| Ga0335076_108011462 | 3300032955 | Soil | MRITAKDLADTIGARLEGFPDAELTGVAAPERAGTRDLIYVETAKHLD |
| Ga0335077_113999161 | 3300033158 | Soil | MKWTSGDLAKAIGAQVEGDPTQEITGVAAPERAGAKELIYVEAA |
| ⦗Top⦘ |