| Basic Information | |
|---|---|
| Family ID | F045288 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MIQIKDVTKLYPAKEAGNGAGKDNGAIHALDHISLHVTPGEW |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.69 % |
| % of genes near scaffold ends (potentially truncated) | 95.42 % |
| % of genes from short scaffolds (< 2000 bps) | 83.01 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.693 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.497 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.529 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.209 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF02687 | FtsX | 88.24 |
| PF10080 | FtrD-like | 3.92 |
| PF12704 | MacB_PCD | 2.61 |
| PF00005 | ABC_tran | 1.31 |
| PF05649 | Peptidase_M13_N | 0.65 |
| PF01229 | Glyco_hydro_39 | 0.65 |
| PF01177 | Asp_Glu_race | 0.65 |
| PF12680 | SnoaL_2 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.69 % |
| Unclassified | root | N/A | 1.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000579|AP72_2010_repI_A01DRAFT_1007242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1908 | Open in IMG/M |
| 3300000955|JGI1027J12803_101665088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1454 | Open in IMG/M |
| 3300001356|JGI12269J14319_10199560 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300001867|JGI12627J18819_10226045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 754 | Open in IMG/M |
| 3300004092|Ga0062389_100242107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1820 | Open in IMG/M |
| 3300004153|Ga0063455_100385184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300004633|Ga0066395_10831767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300005434|Ga0070709_10316399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1144 | Open in IMG/M |
| 3300005434|Ga0070709_11064353 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005437|Ga0070710_10374647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 948 | Open in IMG/M |
| 3300005542|Ga0070732_10439269 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300005542|Ga0070732_10865066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300005591|Ga0070761_11096278 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005598|Ga0066706_10075459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2374 | Open in IMG/M |
| 3300005610|Ga0070763_10281122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
| 3300005712|Ga0070764_11046624 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006028|Ga0070717_10115741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2292 | Open in IMG/M |
| 3300006086|Ga0075019_10468254 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300006174|Ga0075014_100128011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1217 | Open in IMG/M |
| 3300006796|Ga0066665_10088296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2247 | Open in IMG/M |
| 3300006804|Ga0079221_10908233 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300009029|Ga0066793_10732697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300009090|Ga0099827_11865266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300009174|Ga0105241_11552449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300009523|Ga0116221_1395696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300009618|Ga0116127_1175589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300009764|Ga0116134_1156216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300009839|Ga0116223_10044256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2940 | Open in IMG/M |
| 3300010366|Ga0126379_11127765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300010379|Ga0136449_100110575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5580 | Open in IMG/M |
| 3300010876|Ga0126361_11057340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300010877|Ga0126356_10735999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300012357|Ga0137384_10074342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2825 | Open in IMG/M |
| 3300012362|Ga0137361_11740916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300012683|Ga0137398_10633545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300012922|Ga0137394_11298101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300012925|Ga0137419_10805918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300012961|Ga0164302_11936721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300012971|Ga0126369_10075513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2971 | Open in IMG/M |
| 3300012977|Ga0134087_10607232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300012986|Ga0164304_11479342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300012987|Ga0164307_11096789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300014498|Ga0182019_10125031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1603 | Open in IMG/M |
| 3300016422|Ga0182039_11337985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300016445|Ga0182038_11946206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300017822|Ga0187802_10344835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300017933|Ga0187801_10476350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300017940|Ga0187853_10430538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300017942|Ga0187808_10294514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300017946|Ga0187879_10545965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300017972|Ga0187781_10886671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300017972|Ga0187781_11316199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300017974|Ga0187777_10830577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300018006|Ga0187804_10220794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300018046|Ga0187851_10737069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300018085|Ga0187772_10096972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1894 | Open in IMG/M |
| 3300018086|Ga0187769_10962604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300018088|Ga0187771_11524367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300019787|Ga0182031_1366426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2468 | Open in IMG/M |
| 3300020170|Ga0179594_10403594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300020580|Ga0210403_10046212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3482 | Open in IMG/M |
| 3300020580|Ga0210403_10706736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300020581|Ga0210399_10762591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300021170|Ga0210400_10284289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1356 | Open in IMG/M |
| 3300021171|Ga0210405_10703009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300021178|Ga0210408_10461456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
| 3300021404|Ga0210389_10655165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300021433|Ga0210391_11356238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300021474|Ga0210390_10442546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300021474|Ga0210390_10833343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300021477|Ga0210398_10772325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300021560|Ga0126371_12893982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300021860|Ga0213851_1629422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2186 | Open in IMG/M |
| 3300021861|Ga0213853_10095612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300021861|Ga0213853_10737859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2168 | Open in IMG/M |
| 3300022732|Ga0224569_102699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1421 | Open in IMG/M |
| 3300022734|Ga0224571_100329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2489 | Open in IMG/M |
| 3300024295|Ga0224556_1143480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300025412|Ga0208194_1001153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5524 | Open in IMG/M |
| 3300025911|Ga0207654_10990920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300026557|Ga0179587_10448848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300027066|Ga0208236_1014800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300027537|Ga0209419_1077598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300027545|Ga0209008_1006845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2705 | Open in IMG/M |
| 3300027583|Ga0209527_1004261 | All Organisms → cellular organisms → Bacteria | 2911 | Open in IMG/M |
| 3300027667|Ga0209009_1123838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 657 | Open in IMG/M |
| 3300027696|Ga0208696_1236086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300027737|Ga0209038_10245702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300027826|Ga0209060_10277809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300027853|Ga0209274_10731994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300027854|Ga0209517_10060816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2758 | Open in IMG/M |
| 3300027884|Ga0209275_10156556 | Not Available | 1211 | Open in IMG/M |
| 3300027889|Ga0209380_10084131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1828 | Open in IMG/M |
| 3300027889|Ga0209380_10480669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300027895|Ga0209624_10054521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2562 | Open in IMG/M |
| 3300027898|Ga0209067_10447560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300027908|Ga0209006_10302477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1364 | Open in IMG/M |
| 3300028047|Ga0209526_10898269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300028536|Ga0137415_11301020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300028775|Ga0302231_10487409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300028800|Ga0265338_10018431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7470 | Open in IMG/M |
| 3300028806|Ga0302221_10110034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1220 | Open in IMG/M |
| 3300028860|Ga0302199_1088734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
| 3300028866|Ga0302278_10177053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
| 3300028906|Ga0308309_10797937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300029882|Ga0311368_10686540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300029907|Ga0311329_10235580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1373 | Open in IMG/M |
| 3300029917|Ga0311326_10318274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300029945|Ga0311330_10863221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300029986|Ga0302188_10425530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300029999|Ga0311339_11272402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300030043|Ga0302306_10088515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1203 | Open in IMG/M |
| 3300030056|Ga0302181_10371554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300030056|Ga0302181_10417178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300030520|Ga0311372_11850464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300030580|Ga0311355_10224017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1948 | Open in IMG/M |
| 3300030617|Ga0311356_10519093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300030659|Ga0316363_10028435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2892 | Open in IMG/M |
| 3300030741|Ga0265459_12974867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300030741|Ga0265459_14230806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300030759|Ga0265745_1009470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300030814|Ga0265741_103732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
| 3300030879|Ga0265765_1070534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300031170|Ga0307498_10344875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300031198|Ga0307500_10008753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2070 | Open in IMG/M |
| 3300031233|Ga0302307_10130884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1306 | Open in IMG/M |
| 3300031247|Ga0265340_10466362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300031708|Ga0310686_105315339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300031708|Ga0310686_116558759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300031715|Ga0307476_10379415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
| 3300031715|Ga0307476_10735761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300031719|Ga0306917_11244532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300031754|Ga0307475_10247784 | Not Available | 1427 | Open in IMG/M |
| 3300031754|Ga0307475_10823843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300031754|Ga0307475_11527633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300031823|Ga0307478_10246267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1451 | Open in IMG/M |
| 3300031837|Ga0302315_10506577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300031954|Ga0306926_10066510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4352 | Open in IMG/M |
| 3300031962|Ga0307479_11991593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 530 | Open in IMG/M |
| 3300032076|Ga0306924_10205528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2261 | Open in IMG/M |
| 3300032160|Ga0311301_10069944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7432 | Open in IMG/M |
| 3300032174|Ga0307470_10611618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300032515|Ga0348332_14370164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300032770|Ga0335085_10135995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3109 | Open in IMG/M |
| 3300032805|Ga0335078_10066531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5282 | Open in IMG/M |
| 3300032805|Ga0335078_10387776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1839 | Open in IMG/M |
| 3300032828|Ga0335080_11054403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300032892|Ga0335081_10179589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2967 | Open in IMG/M |
| 3300032893|Ga0335069_12001759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300033004|Ga0335084_12110656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300033412|Ga0310810_10998440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300033547|Ga0316212_1023516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300033807|Ga0314866_026429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.19% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.23% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.23% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.58% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.92% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.61% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.31% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.31% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.31% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.65% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.65% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.65% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.65% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.65% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.65% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027066 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF005 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030759 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030814 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A01DRAFT_10072423 | 3300000579 | Forest Soil | MIQIKDVTKLYPAKQVGNGSGKEAGNGAIHALDHISLHVTPGEWL |
| JGI1027J12803_1016650881 | 3300000955 | Soil | MIQIKDVTKLYPAKEAGNGAGKDNANGAIHALDHISLHVAAGEWLSIMGP |
| JGI12269J14319_101995602 | 3300001356 | Peatlands Soil | MIQIKNVTKLYPAKAAGNENANAKGDQNGAGVIRALDHISLLVAQGEWLSIMGPS |
| JGI12627J18819_102260452 | 3300001867 | Forest Soil | MIQIKDVTKLYPAKEAGNGSAKDAGNGAIHALDHISLHVTPGEWLSIM |
| Ga0062389_1002421071 | 3300004092 | Bog Forest Soil | MIEIKNVTKLYPAKAAGNENANGNGGRDGAIHALDDISLHVAQGEWLSIMGP |
| Ga0063455_1003851841 | 3300004153 | Soil | MIQIKDVTKLYPAKAAGNGSGKDNGAGSIHALDHISLHVAAGEWLS |
| Ga0066395_108317672 | 3300004633 | Tropical Forest Soil | MIQIKDVTKLYPAKEAGNGTGKDAVNGTANIHALDHISLH |
| Ga0070709_103163991 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIHIKDVTKLYPAKEAGNGLGKDNGNGAIHALDHISLHVTPGEWLSIM |
| Ga0070709_110643531 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQIKDVTKLYPAKESGDRENSSIHALDHISLHVTAGEWLSIMGPSGS |
| Ga0070710_103746471 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQIKNVTKLYPAKEAGNGSGKDNGAIHALDHISLHVTPGEWLSIMGPSGS |
| Ga0070732_104392691 | 3300005542 | Surface Soil | MIQIKNVTKLYPAKESGKGVGKEEGSIHALDHISLHVQLGEWLS |
| Ga0070732_108650661 | 3300005542 | Surface Soil | MIQIKNVTKLYPAKESGDGAGKDSANGAIHALDHISLH |
| Ga0070761_110962782 | 3300005591 | Soil | MIQINNVTKLYPAKEAGNGSGNPKDGPGKDASIHALDHISLHVAAGEWLSIMGPSGSG |
| Ga0066706_100754593 | 3300005598 | Soil | MIEIKDVTKLYPAKEAGNGSASAAGNGKESGSIHALDHISLHV |
| Ga0070763_102811222 | 3300005610 | Soil | MIQINDVTKLYPTKEAAVLSGGKDNASIHALDHISL |
| Ga0070764_110466241 | 3300005712 | Soil | MIQIKDVTKLYPAKAAGDENANPKGEQNGAIHALDHISLNVARGEWLSIMGPS |
| Ga0070717_101157411 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQIKDVTKLYPAKEAGNESANGDGKIDGKASGKERESGAIHALDHISLHVGAGEW |
| Ga0075019_104682541 | 3300006086 | Watersheds | MIEIKDVTKLYPAKEAGNGTGKDNGAGSIHALDHISLHVAQGE |
| Ga0075014_1001280112 | 3300006174 | Watersheds | MIQIKDVIKLYPAKEAGNGAGGSGSDNGSIHALDHISLHVAQGEWLSIM |
| Ga0066665_100882961 | 3300006796 | Soil | MIQIKNVTKLYPAKAAEIGSGNGNATSSSGVIRALDDISLRVVPGEW |
| Ga0079221_109082331 | 3300006804 | Agricultural Soil | MIQIKDVTKLYPAKEAGNGSGKDNGDGAIHALDHISLHVTPGEWLSIM |
| Ga0066793_107326973 | 3300009029 | Prmafrost Soil | MIQIKDVTKLYPAKEAGNGNGSGKDNGSGSIHALDHISLHVTQGEWLSIMGPSGSG |
| Ga0099827_118652661 | 3300009090 | Vadose Zone Soil | MIQIKNVTKLYPAKASGETANGKGDQSGAIHALDHISLHVA |
| Ga0105241_115524491 | 3300009174 | Corn Rhizosphere | MIQIKDVTKLYPAKEAGNGAGKDSSSIHALDHISLHVAAGEWLSIMGPSGS |
| Ga0116221_13956961 | 3300009523 | Peatlands Soil | MIQIKDVTKLYPAKEAGNGNGSGKDNGSSSIHALDHISLHVAPGEWLSIMGPSG |
| Ga0116127_11755891 | 3300009618 | Peatland | MIEIKDVTKLYPAKAAGNENGNGKENQNGAIHALDHISLHVAQGEWLSIMGP |
| Ga0116134_11562161 | 3300009764 | Peatland | MIQIKDVTKLYPAKAAGNEKGSGNGGRNSKDKENGAIHALDHISLHVSQ |
| Ga0116223_100442561 | 3300009839 | Peatlands Soil | MIQIKNVTKLYPAKEAGNGSGNGGGKENGSIHALDHIALQVTPGEWLSIMG |
| Ga0126379_111277652 | 3300010366 | Tropical Forest Soil | MIQIKDVSKRYPAKKARSGMGKDSGNGAIHGLDHIS |
| Ga0136449_1001105757 | 3300010379 | Peatlands Soil | MIEIKDVTKLYPAKAAGNENGNGKENQNGAIHALDHISLHVAQGEWLSIMGPSG |
| Ga0126361_110573402 | 3300010876 | Boreal Forest Soil | MIQINDVTKLYPSQGAGQDGASGNESKGDAIHALDHISLQV |
| Ga0126356_107359992 | 3300010877 | Boreal Forest Soil | MIQIKDVTKLYPAKAAGNENGNESQSSAIHALDHISLHVAQD |
| Ga0137384_100743424 | 3300012357 | Vadose Zone Soil | MIQIKDVTKLYPAKEAGNGSGKDASSGSIHALDHISL |
| Ga0137361_117409161 | 3300012362 | Vadose Zone Soil | MIEIRDVTKLYPAKEAGDGSASAAGNGRDSGSIHALDHISLHVAAGE |
| Ga0137398_106335452 | 3300012683 | Vadose Zone Soil | MIQIKDVTKLYPAKAAGNENGKESQSSAIHALDHISLHVAQGEWLSIMGPSGSGK* |
| Ga0137394_112981012 | 3300012922 | Vadose Zone Soil | MIEIKDVTKLYPAKESGNGSVSAADNGRESSSIHALDHISLHVAAG* |
| Ga0137419_108059183 | 3300012925 | Vadose Zone Soil | MIEIKDVTKLYPAKESGDAGASVAGNGKESGSIHALDHIS |
| Ga0164302_119367212 | 3300012961 | Soil | MIQIKNVTKLYPAKEAGNGSGKDDGSIHALDHINLHV |
| Ga0126369_100755131 | 3300012971 | Tropical Forest Soil | MIQIKDVIKLYPAKEAGSGMGKDSGNGAIHALDHISLHVAKGEWLS |
| Ga0134087_106072321 | 3300012977 | Grasslands Soil | MIQIKDVTKLYPAKEAGNGTGKDNAAIHALDHISLHVAA |
| Ga0164304_114793421 | 3300012986 | Soil | MIQIKDVTKLYPAKEAGNGAGKDNGAIHALDHISLHVTPGEW |
| Ga0164307_110967891 | 3300012987 | Soil | MIQIKDVTKLYPAKEAGNGGARDPGAIHALDHISLHVASG |
| Ga0182019_101250314 | 3300014498 | Fen | MIQIKDVIRLYPAKESNNGSGKDKDKDSSIHALDHISLHVAQGEWLSIMGPS |
| Ga0182039_113379851 | 3300016422 | Soil | MIQIKNVTKLYPAKESGNGAKDNNGNGAIHALDHINLHVVPGEW |
| Ga0182038_119462061 | 3300016445 | Soil | MIQIKDVTKLYPAKEAGSAKENGSSAIHALDHISLHVTPGE |
| Ga0187802_103448351 | 3300017822 | Freshwater Sediment | MIQIKDVTKLYPAKEAANGGNGSAKESASIHALDHISLHVTKGEWLSIMGPS |
| Ga0187801_104763501 | 3300017933 | Freshwater Sediment | MIQIKDVTKLYPAKEAGNGSGKENGLIHALDHISLHVEAGEWLSIMGPSG |
| Ga0187853_104305381 | 3300017940 | Peatland | MIQIKDVTKLYPAKAAGNENGNGKENQNGAIHALDHISLHV |
| Ga0187808_102945142 | 3300017942 | Freshwater Sediment | MIQIKDVTKLYPAKAAGNENGSGKENGNGAIHALDHISL |
| Ga0187879_105459651 | 3300017946 | Peatland | MIQIKDVTKLYPAKEAGNGKGSGKDDASGFISALD |
| Ga0187781_108866711 | 3300017972 | Tropical Peatland | MIQIKNVTKLYPAKEEGNGNGAGRGNGAIHALDHISLHVTKGEW |
| Ga0187781_113161991 | 3300017972 | Tropical Peatland | VTKLYPANEAAGAEAAGKVKESSAIHALDHISLHVTPGEWLSIMGPSGSG |
| Ga0187777_108305772 | 3300017974 | Tropical Peatland | MIQINNVTKLYPAKEAGDASGKDNGAIHALDHISLHVVSGEWLSIMG |
| Ga0187804_102207941 | 3300018006 | Freshwater Sediment | MIQIKDVTKLYPAKEAGNGSGKENGSIHALDHISLQVEAGEWLSIMGPSGS |
| Ga0187851_107370691 | 3300018046 | Peatland | MIQINDVTKLYPAKEAGNGSGKDNGASSIHALDHISLH |
| Ga0187772_100969723 | 3300018085 | Tropical Peatland | MIQIKDVTKLYPAKAAGNESANGNGGGNGKDNGAIR |
| Ga0187769_109626041 | 3300018086 | Tropical Peatland | MIQIKNVTKLYPAKEVGNGNGSGKDNGMIHALDHISLHVT |
| Ga0187771_115243671 | 3300018088 | Tropical Peatland | MIEIKNVTKLYPAKEAGNGNGSGKDNGSIHALDHIS |
| Ga0182031_13664261 | 3300019787 | Bog | MIQIKNVTKLYPAKAAGNEKDNAKGNQNSAIHALDHISLHVAQGEWLSIMGPSGRVNRRW |
| Ga0179594_104035942 | 3300020170 | Vadose Zone Soil | MIEITNVAKLYPAKELGNERGNGAGKESGSIHALDHISLHVAPG |
| Ga0210403_100462121 | 3300020580 | Soil | MIQIKDVTKLYPAKESAAAGGGKDNASIHALDHISLHVAAGE |
| Ga0210403_107067361 | 3300020580 | Soil | MIQIKDVTKLYPAKQSGDGPAKDVASSIHALDHISLHV |
| Ga0210399_107625911 | 3300020581 | Soil | MIRIKDVTKLYSAKGAGNEDSNVKESQSGAIHALDRISLDVA |
| Ga0210400_102842891 | 3300021170 | Soil | MIQIKNVTKLYPAKEAGGVNGAAGSSSIHALEQISLHVAAGEWLSIMG |
| Ga0210405_107030091 | 3300021171 | Soil | MIQIKDVTKLYPAKEAGTGKGSGKDERSAKDEDSGFIRALDHISLHVTQGEWLSIMGPSGSGK |
| Ga0210408_104614561 | 3300021178 | Soil | MIQIKDVTKIYPAKETGNGSGKDNIHALDHISLHVAQGEWLSIM |
| Ga0210389_106551652 | 3300021404 | Soil | MIQIKGVTKLYPAKAAGDENANPKGEQNGVIHALDHISLNVARGEWLSIMGPS |
| Ga0210391_113562381 | 3300021433 | Soil | MIQIKDVTKLYPAKEAGDGKDGGSGFISALDHISLHVTQGEWLSIMGPSGS |
| Ga0210390_104425462 | 3300021474 | Soil | MIQIKNVTKLYPAKAAGNGTGKDNGASSIHALDHISLHVRPGE |
| Ga0210390_108333431 | 3300021474 | Soil | MIQIKDVTKLYPAQESGNGTGKDNSASSIHALDHISLHVAQGEWLSIM |
| Ga0210398_107723251 | 3300021477 | Soil | MIQIKDVTKLYPAKAAGNEAANGGRNGKESGAIHALDHISLHVS |
| Ga0126371_128939822 | 3300021560 | Tropical Forest Soil | MIQIKDVTKLYPAKEAADGGSQPGSGKDNGVIHALDHISLHVTVGEWLSI |
| Ga0213851_16294221 | 3300021860 | Watersheds | MIQIKDVIKLYPAKEAGSGAGGSGSDNGSIHALDHISLHVAQGEWLSIMGPSGS |
| Ga0213853_100956121 | 3300021861 | Watersheds | MIEIKDVTKLYPAKESGNGSGTNKDNGSIHALDHISLHV |
| Ga0213853_107378591 | 3300021861 | Watersheds | MIQIKDVTKLYPAKEAGSGNGSGKDNSSIHALDHISLHVTAGEWLS |
| Ga0224569_1026992 | 3300022732 | Rhizosphere | MIQINNVTKLYPSQGAGQENASGKESPKGAIHALDHISLHVAQGEWLSIMGPSGSG |
| Ga0224571_1003293 | 3300022734 | Rhizosphere | MIQINNVTKLYPSQGAGQENASGKESPKGAIHALDHISLHVAQG |
| Ga0224556_11434802 | 3300024295 | Soil | MIQIKNVTKLYPAKAAGNENENGKGNQNGAINALD |
| Ga0208194_10011531 | 3300025412 | Peatland | MIQIKDVTKLYPAKAAGNPTSPGQNGAIHALDHISLHVAQGEWLSIMGPSGS |
| Ga0207654_109909202 | 3300025911 | Corn Rhizosphere | MIQIKDVTKLYPAKEAGNGTGKDNAAIHALDHISLHVAAGEWLSIM |
| Ga0179587_104488481 | 3300026557 | Vadose Zone Soil | MIQIKDVTKLYPAKAAGNENSKESQSSAIHALDHISLHVAQGEWLSIMGP |
| Ga0208236_10148002 | 3300027066 | Forest Soil | MIEIKNATKLYPAKESRAAKDLAASIHALDHISLNVAP |
| Ga0209419_10775982 | 3300027537 | Forest Soil | MIQIKDVTKLYPAKEAGNGAGKDASSSSIHALDHISLHVTQGEW |
| Ga0209008_10068454 | 3300027545 | Forest Soil | MIEIKDVTKLYPSQGAGQESANGKEHQSAAIHALDHISLRVLAGEWLS |
| Ga0209527_10042616 | 3300027583 | Forest Soil | MIQIKNVTKLYPAKAADIGSGNGNASSSSGVIRALDDISLHVEPGEWLSIMGPSGS |
| Ga0209009_11238382 | 3300027667 | Forest Soil | MIQIKDVTKLYPAKEAGNGTGKDSSVHALDHISLH |
| Ga0208696_12360862 | 3300027696 | Peatlands Soil | MIQIKNVTKLYPAKESGNGNGAGKDNGSIHALDHISLHVTQGEWLSIMGP |
| Ga0209038_102457021 | 3300027737 | Bog Forest Soil | MIQIKDVTKLYPAKAAGNEKGNDSSIHALDHISLHVAKGEWLSIMGPSG |
| Ga0209060_102778091 | 3300027826 | Surface Soil | MIQIKDVTKLYPAKESGNGTGKDSGAIHALDHISLH |
| Ga0209274_107319942 | 3300027853 | Soil | MIQINNVTKLYPAKEAGNGSGNPKDGPGKDASIHALDHISLHVAAGEWLSIMGPSGSGK |
| Ga0209517_100608164 | 3300027854 | Peatlands Soil | MIQIKNVTKLYPAKEAGNGNGSGKDNGAIHALDHISLHVTKGEWLSIMGP |
| Ga0209275_101565561 | 3300027884 | Soil | MIQIKDVTKLYPAKEAGDGKDGGSGFISALDHISLHVTQ |
| Ga0209380_100841313 | 3300027889 | Soil | MIEIKNVTKLYPAQAAGNEPAKGEQSGTIHALDDISLH |
| Ga0209380_104806692 | 3300027889 | Soil | MIQIKNVTKLYPAKAAGNGTGKDNGASSIHALDHISLH |
| Ga0209624_100545213 | 3300027895 | Forest Soil | MIQIKDVTKLYPSQGAGQESANGKENQSPAIHALDHISL |
| Ga0209067_104475602 | 3300027898 | Watersheds | MIQIKDVTKLYPAKESGNGTGKDNSASSIHALDHISLN |
| Ga0209006_103024771 | 3300027908 | Forest Soil | MIQIKDVTKLYPAKESGNGPGKDKDKDGASIHALDHISLHV |
| Ga0209526_108982692 | 3300028047 | Forest Soil | MIQIKDVTKLYPAKESGNENAGGKEKESGAIHALDHISLDVAPGEWLSIMG |
| Ga0137415_113010201 | 3300028536 | Vadose Zone Soil | MIQIKDVTKLYPAKESGKESAKGGGKENAKESGAIHALDH |
| Ga0302231_104874092 | 3300028775 | Palsa | MIQINNVTKLYPSQGAGQESANGKESQNDAIHALDRISLHVAQGEWLSIMGPSGSGK |
| Ga0265338_100184312 | 3300028800 | Rhizosphere | MIQIKDVTKLYPAKETGNGSGKDNIHALDHISLHVTQGEWLSIMGP |
| Ga0302221_101100342 | 3300028806 | Palsa | MIQIKNVTKLYPSKAAGNETAAGKENQNSSIHALDH |
| Ga0302199_10887342 | 3300028860 | Bog | MIQIKDVTKLYPAKGAGKEPAGENPGKENGSIHALDHISLHVAKGE |
| Ga0302278_101770531 | 3300028866 | Bog | MIQIKDVTKLYPAKAAGNGNGKAEQNSSIHALDHISLHVAQGEWLSIMGPSGSG |
| Ga0308309_107979372 | 3300028906 | Soil | MIQIKDVTKLYPAKESGPAGGSGEDNGSGFIHALDHI |
| Ga0311368_106865401 | 3300029882 | Palsa | MIEIKNVTKLYPAKAAGNEGANGAGNQSGAIHALD |
| Ga0311329_102355803 | 3300029907 | Bog | MIQIKNVTKLYPAKAAGNEKDNGKGNQNSAIHALDHISLHVAQG |
| Ga0311326_103182741 | 3300029917 | Bog | MIQIKNVSKLYPAKAAGNENASGKESQNGAIHALDHISLHVAQGEWLSIMGPSGSG |
| Ga0311330_108632212 | 3300029945 | Bog | MIQIKNVTKLYPAKAAGNEKDNGKGNQNSAIHALDHISLHVAQGEWL |
| Ga0302188_104255302 | 3300029986 | Bog | MIQIKDVTKLYPAKGAGKEPAGENPGKENGSIHALDHISLHVAKGEWLSIMGP |
| Ga0311339_112724021 | 3300029999 | Palsa | MIQIKNVSKLYPAKAAGNENASGKESQNGAIHALDHISLHVAQGEWLSIMG |
| Ga0302306_100885152 | 3300030043 | Palsa | MIQIKDVTKLYPAKETGNGSGKDATSIHALDDISLHVAAGEWLSIMGPSGS |
| Ga0302181_103715541 | 3300030056 | Palsa | MIQINNVTKLYPSQGAGQESANGKESQNDAIHALDRISLH |
| Ga0302181_104171781 | 3300030056 | Palsa | MIQIKNVTKLYPAKAAGNENASGKENQNGAIHALDHISLHVAQ |
| Ga0311372_118504642 | 3300030520 | Palsa | MIQIKNVTKLYPAKAAGNENASGKENQNGAIHALDHISLHVAQGEWLSIMGPSGSG |
| Ga0311355_102240173 | 3300030580 | Palsa | MIQINNVTKLYPSQGAGQESANGKESQNDAIHALDRISLHVAQGEWLSIMGPSG |
| Ga0311356_105190931 | 3300030617 | Palsa | MIEIKNVTKLYPAKAAGNESATGPGNQNGAIHALDHISLHVAQGEWLSIMGPSGSG |
| Ga0316363_100284354 | 3300030659 | Peatlands Soil | MIQIKNVTKLYPAKEAGNGSGNGGGKENGSIHALDH |
| Ga0265459_129748672 | 3300030741 | Soil | VIRIEDVTKLYPAKAGGSENANAKENQSSAIHALDHISLHVAPGE |
| Ga0265459_142308061 | 3300030741 | Soil | MIEIKDATKLYPAKESRAARDSAASIHALDHISLDVAPGEWVSIMGPS |
| Ga0265745_10094701 | 3300030759 | Soil | MIQIKGVTKLYPAKAAGDENANGKGEQNGVIHALDHISLN |
| Ga0265741_1037321 | 3300030814 | Soil | MIQINDVTKLYPAKEAAIASGGKDNASIHALDHITLHV |
| Ga0265765_10705341 | 3300030879 | Soil | MIQIKDVTKLYPAKAAGNESANGKGEQNGAIHALDHISLDVARGEWLSIMGP |
| Ga0307498_103448751 | 3300031170 | Soil | MIQIKDVTKLYPAKEVGNGSGKDNASIHALDHISL |
| Ga0307500_100087531 | 3300031198 | Soil | MIQIKGVTKLYPAKEAGNGTGKDNGSGSIHALDHISLHVAQGEWLSI |
| Ga0302307_101308842 | 3300031233 | Palsa | MIQINDVTKLYPAKETASTGAKDNASIHALDHISLHVAAGEWLSIMGPS |
| Ga0265340_104663621 | 3300031247 | Rhizosphere | MIQIKDVTKLYPAKETGNGSGKDNIHALDHISLHVTQGEWLSI |
| Ga0310686_1053153391 | 3300031708 | Soil | MIEIKNVTKLYPAKAAGNEHAKGMGAQSGAIHALDDISLQVAQG |
| Ga0310686_1165587591 | 3300031708 | Soil | MIQIKEVTKLYPAKAGENENASGKEGQNGAIHALDHISLHVAQGEW |
| Ga0307476_103794152 | 3300031715 | Hardwood Forest Soil | MIQIKDVTKLYPAKAAGDENANGKGEQNGAIHALDHISLRVAQGEWLSIMGP |
| Ga0307476_107357611 | 3300031715 | Hardwood Forest Soil | MIQIKDVTKLYPAKAAGNENGKDSQSGAIHALDHISL |
| Ga0306917_112445321 | 3300031719 | Soil | MIQIKNVTKLYPAKESGNGAKDNNGNGAIHALDHINLHVV |
| Ga0307475_102477843 | 3300031754 | Hardwood Forest Soil | MIQIKDVTKLYPAKESGNGTGKDNGAGSIHALDHISLH |
| Ga0307475_108238431 | 3300031754 | Hardwood Forest Soil | MIQIKDVTKLYPAREAGNERGDGKESQNAVIHALD |
| Ga0307475_115276332 | 3300031754 | Hardwood Forest Soil | MIQIKDVTKLYPAKEVENASGNGAGKDSGSIHALDHISLHVAP |
| Ga0307478_102462672 | 3300031823 | Hardwood Forest Soil | MIEIKDITKLYPAKEAGDRADGSGRDSGSIHALDHISLHVALGEWLSIMGPSGSG |
| Ga0302315_105065772 | 3300031837 | Palsa | MIQIKNVSKLYPAKAAGNENASGKENQNGAIHALDHISLHVAQG |
| Ga0306926_100665103 | 3300031954 | Soil | MIQIKDVTKLYPAKEAGDGSAKDAGNGAIHALDHISLHVTPGEWL |
| Ga0307479_119915932 | 3300031962 | Hardwood Forest Soil | MIQIKNVTKLYPAKAAEIASGNGNAASSSGVIRALDDISLHVVPGEWLSIMGPSGSGK |
| Ga0306924_102055281 | 3300032076 | Soil | MIQIKDVTKLYPAKEAGDGSAKDAGNGAIHALDHISLHVTPGEW |
| Ga0311301_100699447 | 3300032160 | Peatlands Soil | MIQIKNVTKLYPAKAAENDSANGNGSQNGAIHALDHISLHVAQG |
| Ga0307470_106116182 | 3300032174 | Hardwood Forest Soil | MIQIKDVTKLYPAKAAGNENGKESQSSAIHALDHIS |
| Ga0348332_143701641 | 3300032515 | Plant Litter | MIRIKDVTKLYPAKGAGNENSNVKESQSGAIHALDHISLDVAP |
| Ga0335085_101359954 | 3300032770 | Soil | MIQIKNVTKLYPAKEAGYGSGKDNGNGAIHALDHINLHVTPGEWLS |
| Ga0335078_100665316 | 3300032805 | Soil | MIQIKNVTKLYPAKEAGNGAGKENNGAIHALDHISLHVTAGEWLS |
| Ga0335078_103877762 | 3300032805 | Soil | MIQIKNVTKLYPAKESGNGSGKDNGAIHALDHISLHVTPGEWLSIMGPPAQGNRRWSI |
| Ga0335080_110544032 | 3300032828 | Soil | MIQIKNVTKLYPAKEAGNGTGKDNGNGAIHALDHINLH |
| Ga0335081_101795891 | 3300032892 | Soil | MIQIKNVTKLYPAKEAGNGTGKDNGNGAIHALDHISLHVTAGEWLSIMGPSGS |
| Ga0335069_120017591 | 3300032893 | Soil | MIQIKNVTKLYPAKASGNGAGKDNGSIHALDHISLHVT |
| Ga0335084_121106562 | 3300033004 | Soil | MIQIKDVTKLYPAKASGNGSGKDNGGGSIHALDHISLHVTAGE |
| Ga0310810_109984402 | 3300033412 | Soil | MIQIKDVTKLYPAKEIDGPGKESGAIHALDHISLHVAPGEWLSIMGPSGS |
| Ga0316212_10235162 | 3300033547 | Roots | MIQIKDVTKRYPAQETGNGKDGGSGFISALDHISL |
| Ga0314866_026429_756_875 | 3300033807 | Peatland | MIQIKNVTKLYPAKEAGNGTGKDNGAIHALDHISLHVTKG |
| ⦗Top⦘ |