| Basic Information | |
|---|---|
| Family ID | F045265 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 42 residues |
| Representative Sequence | RSMKFRELTLTVTSENRTAVQLYEKLGFQTIKSFTAGVWPR |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.96 % |
| % of genes near scaffold ends (potentially truncated) | 95.42 % |
| % of genes from short scaffolds (< 2000 bps) | 88.24 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.503 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.065 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.373 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.980 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 8.70% Coil/Unstructured: 72.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 22.88 |
| PF04389 | Peptidase_M28 | 16.99 |
| PF03477 | ATP-cone | 9.15 |
| PF03544 | TonB_C | 6.54 |
| PF13620 | CarboxypepD_reg | 5.88 |
| PF07857 | TMEM144 | 3.27 |
| PF01244 | Peptidase_M19 | 3.27 |
| PF12704 | MacB_PCD | 1.96 |
| PF01799 | Fer2_2 | 1.96 |
| PF03706 | LPG_synthase_TM | 1.96 |
| PF13385 | Laminin_G_3 | 1.96 |
| PF14384 | BrnA_antitoxin | 1.96 |
| PF07238 | PilZ | 1.96 |
| PF13911 | AhpC-TSA_2 | 0.65 |
| PF01042 | Ribonuc_L-PSP | 0.65 |
| PF01593 | Amino_oxidase | 0.65 |
| PF13701 | DDE_Tnp_1_4 | 0.65 |
| PF00111 | Fer2 | 0.65 |
| PF01850 | PIN | 0.65 |
| PF00144 | Beta-lactamase | 0.65 |
| PF13671 | AAA_33 | 0.65 |
| PF13546 | DDE_5 | 0.65 |
| PF03631 | Virul_fac_BrkB | 0.65 |
| PF07721 | TPR_4 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 6.54 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 3.27 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 1.96 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.65 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.65 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.65 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.50 % |
| Unclassified | root | N/A | 8.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003350|JGI26347J50199_1007186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300003352|JGI26345J50200_1014105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 810 | Open in IMG/M |
| 3300004082|Ga0062384_100133808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1381 | Open in IMG/M |
| 3300004092|Ga0062389_100973702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1033 | Open in IMG/M |
| 3300004157|Ga0062590_101466401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 682 | Open in IMG/M |
| 3300004635|Ga0062388_101155643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300005181|Ga0066678_10647171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 704 | Open in IMG/M |
| 3300005451|Ga0066681_10500444 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005538|Ga0070731_10886369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 591 | Open in IMG/M |
| 3300005538|Ga0070731_11071554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 533 | Open in IMG/M |
| 3300005546|Ga0070696_100123375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1877 | Open in IMG/M |
| 3300005569|Ga0066705_10466454 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300005574|Ga0066694_10063637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1692 | Open in IMG/M |
| 3300005602|Ga0070762_10018372 | All Organisms → cellular organisms → Bacteria | 3617 | Open in IMG/M |
| 3300005952|Ga0080026_10099167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 810 | Open in IMG/M |
| 3300005993|Ga0080027_10042148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1642 | Open in IMG/M |
| 3300006050|Ga0075028_100665529 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300006059|Ga0075017_101055588 | Not Available | 634 | Open in IMG/M |
| 3300006102|Ga0075015_100053577 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300006162|Ga0075030_100405353 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300006175|Ga0070712_100133079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1887 | Open in IMG/M |
| 3300006176|Ga0070765_101116395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 745 | Open in IMG/M |
| 3300006603|Ga0074064_11367249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300006804|Ga0079221_10168649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1166 | Open in IMG/M |
| 3300007258|Ga0099793_10100480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1338 | Open in IMG/M |
| 3300007258|Ga0099793_10388403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300007258|Ga0099793_10577783 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300009012|Ga0066710_100103557 | All Organisms → cellular organisms → Bacteria | 3816 | Open in IMG/M |
| 3300009038|Ga0099829_10603483 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300009088|Ga0099830_10513975 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300009089|Ga0099828_10008483 | All Organisms → cellular organisms → Bacteria | 7537 | Open in IMG/M |
| 3300009089|Ga0099828_11785416 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300009137|Ga0066709_100814531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1354 | Open in IMG/M |
| 3300009700|Ga0116217_10994582 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009764|Ga0116134_1098395 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300010048|Ga0126373_12369502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300010359|Ga0126376_11315205 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300010359|Ga0126376_12124768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300010360|Ga0126372_10861668 | Not Available | 904 | Open in IMG/M |
| 3300010361|Ga0126378_10128565 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300010361|Ga0126378_13136668 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010362|Ga0126377_10668137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300010376|Ga0126381_101584845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 946 | Open in IMG/M |
| 3300010379|Ga0136449_100617859 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300010868|Ga0124844_1094919 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300011270|Ga0137391_11231948 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012096|Ga0137389_10126716 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
| 3300012096|Ga0137389_10195420 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
| 3300012189|Ga0137388_10331379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1400 | Open in IMG/M |
| 3300012189|Ga0137388_11937743 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
| 3300012202|Ga0137363_10170499 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300012202|Ga0137363_10303067 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300012202|Ga0137363_10336642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1246 | Open in IMG/M |
| 3300012202|Ga0137363_10869226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300012203|Ga0137399_10177519 | Not Available | 1717 | Open in IMG/M |
| 3300012203|Ga0137399_10345719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1235 | Open in IMG/M |
| 3300012203|Ga0137399_11750707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300012211|Ga0137377_10323636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1477 | Open in IMG/M |
| 3300012362|Ga0137361_11717111 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012363|Ga0137390_10044621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4285 | Open in IMG/M |
| 3300012363|Ga0137390_11165697 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 718 | Open in IMG/M |
| 3300012582|Ga0137358_10701565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 677 | Open in IMG/M |
| 3300012685|Ga0137397_10642648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300012918|Ga0137396_10207111 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300012925|Ga0137419_10129988 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300012927|Ga0137416_10577366 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300012927|Ga0137416_10678009 | Not Available | 904 | Open in IMG/M |
| 3300012927|Ga0137416_11226577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300012929|Ga0137404_11138756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 716 | Open in IMG/M |
| 3300012930|Ga0137407_10685998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 964 | Open in IMG/M |
| 3300012944|Ga0137410_10963091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 725 | Open in IMG/M |
| 3300014150|Ga0134081_10213129 | Not Available | 661 | Open in IMG/M |
| 3300014154|Ga0134075_10025609 | Not Available | 2373 | Open in IMG/M |
| 3300014839|Ga0182027_10002155 | All Organisms → cellular organisms → Bacteria | 32115 | Open in IMG/M |
| 3300015051|Ga0137414_1128618 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300015053|Ga0137405_1338242 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300015241|Ga0137418_10375701 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300015242|Ga0137412_10013349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6648 | Open in IMG/M |
| 3300015245|Ga0137409_11298464 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 570 | Open in IMG/M |
| 3300015264|Ga0137403_10667167 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300018088|Ga0187771_11917447 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300020060|Ga0193717_1108918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 865 | Open in IMG/M |
| 3300020199|Ga0179592_10023218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2771 | Open in IMG/M |
| 3300020199|Ga0179592_10174928 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300020199|Ga0179592_10197433 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300020580|Ga0210403_10688087 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300020580|Ga0210403_11481604 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300020581|Ga0210399_10144204 | All Organisms → cellular organisms → Bacteria | 1967 | Open in IMG/M |
| 3300020581|Ga0210399_10811802 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300020583|Ga0210401_10819408 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300020583|Ga0210401_11563768 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300021168|Ga0210406_10780253 | Not Available | 729 | Open in IMG/M |
| 3300021404|Ga0210389_11285607 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021407|Ga0210383_10395611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1192 | Open in IMG/M |
| 3300021407|Ga0210383_10968074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 723 | Open in IMG/M |
| 3300021432|Ga0210384_10082035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2899 | Open in IMG/M |
| 3300021433|Ga0210391_11482684 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300021474|Ga0210390_10024720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4893 | Open in IMG/M |
| 3300021478|Ga0210402_10086095 | All Organisms → cellular organisms → Bacteria | 2803 | Open in IMG/M |
| 3300021478|Ga0210402_10264131 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300021478|Ga0210402_11800612 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300021559|Ga0210409_10447584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1152 | Open in IMG/M |
| 3300024187|Ga0247672_1071914 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300024251|Ga0247679_1077448 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300024330|Ga0137417_1207847 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300024330|Ga0137417_1469448 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
| 3300026281|Ga0209863_10027851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1718 | Open in IMG/M |
| 3300026304|Ga0209240_1235108 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300026307|Ga0209469_1002910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8028 | Open in IMG/M |
| 3300026333|Ga0209158_1336643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300026467|Ga0257154_1086016 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300026524|Ga0209690_1162494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300026530|Ga0209807_1112066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
| 3300026551|Ga0209648_10438999 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300027090|Ga0208604_1031081 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300027575|Ga0209525_1093179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 715 | Open in IMG/M |
| 3300027674|Ga0209118_1053187 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300027846|Ga0209180_10145076 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300027846|Ga0209180_10159129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1302 | Open in IMG/M |
| 3300027855|Ga0209693_10376756 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300027857|Ga0209166_10241160 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300027857|Ga0209166_10580532 | Not Available | 571 | Open in IMG/M |
| 3300027867|Ga0209167_10805547 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300027874|Ga0209465_10241877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 902 | Open in IMG/M |
| 3300027884|Ga0209275_10318093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300027895|Ga0209624_10923208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300028047|Ga0209526_10297339 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300028146|Ga0247682_1042559 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300028906|Ga0308309_10091509 | All Organisms → cellular organisms → Bacteria | 2329 | Open in IMG/M |
| 3300028906|Ga0308309_10934986 | Not Available | 752 | Open in IMG/M |
| 3300031057|Ga0170834_100037374 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300031231|Ga0170824_107530136 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300031231|Ga0170824_127309383 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300031421|Ga0308194_10152265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300031446|Ga0170820_16548696 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300031544|Ga0318534_10332185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 876 | Open in IMG/M |
| 3300031546|Ga0318538_10179804 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300031715|Ga0307476_11313642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 528 | Open in IMG/M |
| 3300031718|Ga0307474_10492572 | Not Available | 961 | Open in IMG/M |
| 3300031718|Ga0307474_10805635 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 743 | Open in IMG/M |
| 3300031719|Ga0306917_10962109 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300031720|Ga0307469_12171545 | Not Available | 540 | Open in IMG/M |
| 3300031753|Ga0307477_10652547 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300031754|Ga0307475_10545091 | Not Available | 930 | Open in IMG/M |
| 3300031879|Ga0306919_10498758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 938 | Open in IMG/M |
| 3300031946|Ga0310910_10387743 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300032054|Ga0318570_10042577 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
| 3300032059|Ga0318533_11231857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 547 | Open in IMG/M |
| 3300032180|Ga0307471_100628852 | Not Available | 1234 | Open in IMG/M |
| 3300032782|Ga0335082_10146029 | All Organisms → cellular organisms → Bacteria | 2295 | Open in IMG/M |
| 3300032954|Ga0335083_10075535 | All Organisms → cellular organisms → Bacteria | 3419 | Open in IMG/M |
| 3300033158|Ga0335077_10302763 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300033820|Ga0334817_029993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1101 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.27% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.27% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.31% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.31% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.65% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.65% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.65% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
| 3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033820 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-D | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26347J50199_10071863 | 3300003350 | Bog Forest Soil | GETLRGMKFKELTLTVTSENYGAVKLYEKLGFTTIRTFTAGVWPR* |
| JGI26345J50200_10141051 | 3300003352 | Bog Forest Soil | TLRGMKFRELTLTVTSENYGAVELYKKLGFTTIRTFTAGVWPR* |
| Ga0062384_1001338081 | 3300004082 | Bog Forest Soil | MQTSADALRSMKFRELTLTVTSENRSAVQLYESLGFTTIRTFTAGVWPR* |
| Ga0062389_1009737021 | 3300004092 | Bog Forest Soil | LRSMKFKELTLTVTSENYGAVQLYEKLGFTTIRTFTAGVWPR* |
| Ga0062590_1014664012 | 3300004157 | Soil | MKFKELTLTVTSENYGAVQLYEKLGFTTIRTFTAGVWPR* |
| Ga0062388_1011556433 | 3300004635 | Bog Forest Soil | QTSGETLRGMKFKELTLTVTSENYGAVKLYEKLGFTTIRTFTAGVWPR* |
| Ga0066678_106471711 | 3300005181 | Soil | EALRSMKFRELTLTVTSENRAAVQLYEKLGFHTIKSFTAGVWPR* |
| Ga0066681_105004442 | 3300005451 | Soil | LRAMKFRELTLTVTSENRSAVQLYEKLGFTTIRTFTAGVWPR* |
| Ga0070731_108863691 | 3300005538 | Surface Soil | RVQRFNELTLTVTTENRTAVHLYEQLGFSAIKSFTAGVWPR* |
| Ga0070731_110715541 | 3300005538 | Surface Soil | RMLMQTSGETLRGMKFKELTLTVTSENYGAVQLYEKLGFKKIRTFTAGVWPR* |
| Ga0070696_1001233753 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFRELTLTVTSENRSAVQLYEKLGFTTIRAFTAGVWPK* |
| Ga0066705_104664542 | 3300005569 | Soil | AKFRELTLTVTSENHSAVQLYEKLGFTTIRTFTAGVWPK* |
| Ga0066694_100636373 | 3300005574 | Soil | ALRSMKFGELTLTVTSDNRTAVKLYEKLGFHTIKSFTAGVWPH* |
| Ga0070762_100183721 | 3300005602 | Soil | ETLRGMKFKELTLTVTSENYGAVQLYEKLGFKTIRTFTAGVWPR* |
| Ga0080026_100991671 | 3300005952 | Permafrost Soil | ALRGLKFKELTLTVTSENRTAVQLYDRLGFHTIKSFTAGVWPR* |
| Ga0080027_100421482 | 3300005993 | Prmafrost Soil | MKFREFTLTVTTENRSAVQLYESIGFTTIRTFTAGVWPR* |
| Ga0075028_1006655292 | 3300006050 | Watersheds | ALRSMKFRELTLTVTSDNHTAVQLYEKLGFHTIKCFTAGVWPR* |
| Ga0075017_1010555881 | 3300006059 | Watersheds | NELTLTVTSENRTAVHLYERLGISTINYFTGGVWPR* |
| Ga0075015_1000535773 | 3300006102 | Watersheds | VMNYNELTLTVTSENRTAVHLYERLGFSTIKSFTAGVWPR* |
| Ga0075030_1004053533 | 3300006162 | Watersheds | RSMKFRELTLTVTSDNRTAVQLYEKLGFHTIKCFTAGVWPR* |
| Ga0070712_1001330792 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RELTLTVTSENRSAVQLYESLGFSTIRTFTAGVWPR* |
| Ga0070765_1011163951 | 3300006176 | Soil | AETLRAQKFSELTLTVTSENRTAVHLYERLGFSKVRTFTAGVWPK* |
| Ga0074064_113672491 | 3300006603 | Soil | SGETLRSMKFKELTLTVTSENYGAVQLYEKLGFTTIRTFTAGVWPR* |
| Ga0079221_101686491 | 3300006804 | Agricultural Soil | GMKFKELTLTVTTENYGAVQLYEKLGFTKIRMFTAGVWPR* |
| Ga0099793_101004801 | 3300007258 | Vadose Zone Soil | KFRELTLTVTSDNRTAVQLYEKLGFHTIKSFTAGVWPR* |
| Ga0099793_103884031 | 3300007258 | Vadose Zone Soil | TSAEALRSIKFVDLTLTGTSHTSTAVKLYEKLGCHTIMSFTAGVWPH* |
| Ga0099793_105777832 | 3300007258 | Vadose Zone Soil | ETLRAQKFTELTLTVTTENRTAVHLYERLGFSKVRSFTAGVWPK* |
| Ga0066710_1001035571 | 3300009012 | Grasslands Soil | FRELTLTVTSDNRAAVQLYEKLGFHTIKTFTAGVWPR |
| Ga0099829_106034832 | 3300009038 | Vadose Zone Soil | LRSMKFRELTLTVTSENRGAVQLYEKLGFQTIKSFTAGVWPR* |
| Ga0099830_105139752 | 3300009088 | Vadose Zone Soil | SAEALRSMKFRELTLTVTSENRSAVQLYERLGFHTIKSFTAGVWPR* |
| Ga0099828_1000848311 | 3300009089 | Vadose Zone Soil | ELTLTVTSENHVAVQLYEKLGFTTIRTFTAGVWPR* |
| Ga0099828_117854161 | 3300009089 | Vadose Zone Soil | LRSMKFGELTLTVTSDNRTAVKLYEKLRFHTIKSFTAGVWPH* |
| Ga0066709_1008145311 | 3300009137 | Grasslands Soil | LTLTVTSDNRAAVLLYEKLGFHTIKTFTAGVWPR* |
| Ga0116217_109945821 | 3300009700 | Peatlands Soil | DALRSLQFKELSLTVTAENHTAVHLYERLGFNTIKSFTAGVWPR* |
| Ga0116134_10983952 | 3300009764 | Peatland | KFKELTLTVTSENRTAVHLYERLGFSTVKSFTAGVWPR* |
| Ga0126373_123695022 | 3300010048 | Tropical Forest Soil | LRAMKFRELTLTVTSENQTAVTLYEKLGFQTTKSFTAGVWPR* |
| Ga0126376_113152052 | 3300010359 | Tropical Forest Soil | MLPAADALRSLKFQEMTLTVTTENLTAVHLYEQLGFKTLKTFTAGVWPR* |
| Ga0126376_121247681 | 3300010359 | Tropical Forest Soil | MKFRELTLTVTSQNASAVKLYEKLGFVTIRTFTAGVWPR* |
| Ga0126372_108616681 | 3300010360 | Tropical Forest Soil | DALRGLKFQELTLTVTTENLTAVHLYDQLGFKTLKTFTAGVWPR* |
| Ga0126378_101285651 | 3300010361 | Tropical Forest Soil | TSAEALRSMKFRELTLTVTSENHTAVQLYEKLGFQTTKSFTAGVWPR* |
| Ga0126378_131366681 | 3300010361 | Tropical Forest Soil | EALRSMKFRELTLTVTSDNRTAVQLYEKLGFQIIKAFTAGVWPR* |
| Ga0126377_106681373 | 3300010362 | Tropical Forest Soil | TAADALRGLKFQELTLTVTTENRTAVHLYERLGFKTLKSFTAGVWPR* |
| Ga0126381_1015848452 | 3300010376 | Tropical Forest Soil | LKFTELTLTVTSENRTAVHLYERLGFSKVKTFTAGVWPK* |
| Ga0136449_1006178591 | 3300010379 | Peatlands Soil | VKFTELTLTVTSENRTAVHLYERLGFSTVKSFTAGVWPR* |
| Ga0124844_10949191 | 3300010868 | Tropical Forest Soil | LTAADALRSLKFQELTLTVTTENLTAVHLYEQLGFKTLKTFTAGVWPR* |
| Ga0137391_112319482 | 3300011270 | Vadose Zone Soil | LTLTVTSDNRTAVQLYEKLGFHTIKSFTAGVWPG* |
| Ga0137389_101267161 | 3300012096 | Vadose Zone Soil | ETLRAQKFSELTLTVTTENRTAVHLYERLGFSKVRTFTAGVCPK* |
| Ga0137389_101954203 | 3300012096 | Vadose Zone Soil | AEALREAKFQELTLTVTSENRGAVHLYERLGFSTIKSFTAGVWPRQ* |
| Ga0137388_103313795 | 3300012189 | Vadose Zone Soil | SMKFRELTLTVTSDNRTAVQLYERLGFNTIKCFTAGVWPR* |
| Ga0137388_119377431 | 3300012189 | Vadose Zone Soil | KFRELTLTVTAQNRSAVQLYEKLHFATIRSFTAGVWPR* |
| Ga0137363_101704991 | 3300012202 | Vadose Zone Soil | NFRELTLTVTSENHVAVQLYEKLGFTTVRTFMAGVWPR* |
| Ga0137363_103030672 | 3300012202 | Vadose Zone Soil | FRELTLTVTSDNHTAVQLYERLGFTTIKCFTAGVWPR* |
| Ga0137363_103366421 | 3300012202 | Vadose Zone Soil | ILMMTAAETLRAQKFSELTLTVTTENRTAVHLYERLAFSKVRSFTAGVWPK* |
| Ga0137363_108692262 | 3300012202 | Vadose Zone Soil | ALRSMKFRELTLTVTSDNHTAVQLYEKLGFHTIKSFTAGVWPP* |
| Ga0137399_101775191 | 3300012203 | Vadose Zone Soil | KFSELTLTVTTENRTAVHLYERLAFSKVRSFTAGVWPK* |
| Ga0137399_103457191 | 3300012203 | Vadose Zone Soil | MKFRELTLTVTSDNRTAVQLYEKLGFHTIKSFTAGVWPR* |
| Ga0137399_117507071 | 3300012203 | Vadose Zone Soil | MKFRELTLTVTSDNHTAVQLYEKLGFHTIKTFTAGVWPR* |
| Ga0137377_103236361 | 3300012211 | Vadose Zone Soil | SMKFRELTLTVTSDNHTAVQLYEKLGFHTIKSFTAGVWPR* |
| Ga0137361_117171111 | 3300012362 | Vadose Zone Soil | DALRVRGIEELSLTVTAANETAVRLYRKLGFTTIKTFTAGVWLPGHFD* |
| Ga0137390_100446211 | 3300012363 | Vadose Zone Soil | RSMKFRELTLTVTSENRGAVQVYERLGFHTIKSFTAGVWPG* |
| Ga0137390_111656973 | 3300012363 | Vadose Zone Soil | RELTLTVTAQNRSAVRLYEKLNFTTIHTFTAGVWPR* |
| Ga0137358_107015651 | 3300012582 | Vadose Zone Soil | MKFRELTLTVTSENHAAVQLYEKLGFHTIKSFTAGVWPR* |
| Ga0137397_106426482 | 3300012685 | Vadose Zone Soil | SMKFRELTLTVTSDNRTAVQLYERLGFHTIKSFTAGVWPR* |
| Ga0137396_102071111 | 3300012918 | Vadose Zone Soil | MLMQTSAEALRSMKFRELTLTVTSENRTAVQLYERLSFRTIKSFTAGVWPR* |
| Ga0137419_101299881 | 3300012925 | Vadose Zone Soil | SELTLTVTSENRTAVHLYERLGFSKVRTFTAGVWPK* |
| Ga0137416_105773661 | 3300012927 | Vadose Zone Soil | TAAETLRAQKFSELTLTVTTENRTAVHLYERLAFSKVRSFTAGVWPK* |
| Ga0137416_106780091 | 3300012927 | Vadose Zone Soil | AAETLRAQKFSELTLTVTTENRTAVHLYERLAFSKVRSFTAGVWPK* |
| Ga0137416_112265772 | 3300012927 | Vadose Zone Soil | AEALRSMKFGELTLTVTSDNRTAVKLYEKLRFHTIKSFTAGVWPH* |
| Ga0137404_111387562 | 3300012929 | Vadose Zone Soil | LTLTVTSENHAAVQLYEKLGFHTIKSFTAGVWPR* |
| Ga0137407_106859981 | 3300012930 | Vadose Zone Soil | SMKFRELTLTVTSENHAAVQLYEKLGFHTIKSFTAGVWPR* |
| Ga0137410_109630912 | 3300012944 | Vadose Zone Soil | FRELTLTVTSENHAAVQLYEKLGFHTIKSFTAGVWPR* |
| Ga0134081_102131292 | 3300014150 | Grasslands Soil | RSMKFRELTLTVTSENRTAVQLYEKLGFQTIKSFTAGVWPR* |
| Ga0134075_100256095 | 3300014154 | Grasslands Soil | QTSAEALRSMKFRELTLTVTSDNRAAVLLYEKLGFHTIKTFTAGVWPR* |
| Ga0182027_1000215525 | 3300014839 | Fen | MLTAAEALRALKFTELTLTVTSENRTAVHLYERLGFSTVKSFTAGVWPR* |
| Ga0137414_11286181 | 3300015051 | Vadose Zone Soil | LTLTVTSDNHAAVQLYERIGFTTIKCFTAGVWPR* |
| Ga0137405_13382422 | 3300015053 | Vadose Zone Soil | MLTSAEALRSMKFRELTLTVTSDNRTAVQLYNRLGFHTIKSFTAAVWPR* |
| Ga0137418_103757012 | 3300015241 | Vadose Zone Soil | MLTLTVTSDNHTAVQLYEKLGFHTIKSFTAGVWPP* |
| Ga0137412_100133499 | 3300015242 | Vadose Zone Soil | RSMKFRELTLTVTSDNHTAVQLYEKLGFHTIKSFTAGVWPP* |
| Ga0137409_112984642 | 3300015245 | Vadose Zone Soil | ALRAMKFRELTLTVTAQNRSAVLLYEKLHFTTIRSFTAGVWPR* |
| Ga0137403_106671671 | 3300015264 | Vadose Zone Soil | MMTAAETLRAQKFSELTLTVTTENRTAVHLYERLAFSKVRSFTAGVWPK* |
| Ga0187771_119174471 | 3300018088 | Tropical Peatland | NTAADALRSMRFRELSLTVTAENRTAVHLYERLGFTTIKSFTAGVWPR |
| Ga0193717_11089181 | 3300020060 | Soil | LIQTSAEALRALKYHELTLTVTSENRTAVELYDHLGFQTVRTFTAAVWPR |
| Ga0179592_100232182 | 3300020199 | Vadose Zone Soil | MKCRELTLTVTSDNHTAVQLYERLGFTTIKCFTAGVWPR |
| Ga0179592_101749283 | 3300020199 | Vadose Zone Soil | MTAAETLRAQKFSELTLTVTTENRTAVHLYERLAFSKVRSFTAGVWPK |
| Ga0179592_101974331 | 3300020199 | Vadose Zone Soil | ETLRAQKFSELTLTVTTENRTAVHLYERLAFSKVRSFTAGVWPK |
| Ga0210403_106880872 | 3300020580 | Soil | KFRELTLTVTTENRSAVQLYESLGFTTIRTFTAGVWPR |
| Ga0210403_114816042 | 3300020580 | Soil | ELTLTVTSENRTAVSLYEKLGFTTIKSFTAGVWPR |
| Ga0210399_101442042 | 3300020581 | Soil | VLKYNELTLTVTSENHTAVHLYERLGFLTIKSFTAGVWPR |
| Ga0210399_108118021 | 3300020581 | Soil | KELTLTVTSENKAAVHLYERLGFSTIKSFTAGVWPR |
| Ga0210401_108194083 | 3300020583 | Soil | FKELTLTVTSENYGAVQLYEKLGFTKIRTFTAGVWPR |
| Ga0210401_115637681 | 3300020583 | Soil | MQTSAEALRGMKFRELTLTVTSENHTAVKLYEKLGFQTIKIFTAGVWPR |
| Ga0210406_107802533 | 3300021168 | Soil | ELTLTVTSQNRSAVQLYENLHFTTIRSFTAGVWPR |
| Ga0210389_112856071 | 3300021404 | Soil | LRALKYNELTLTVTSENHTAVHLYERLGFSTIKSFTAGVWPR |
| Ga0210383_103956113 | 3300021407 | Soil | TSGETLRSMKFKELTLTVTSENYGAVQLYEKLGFTTIRTFTAGVWPR |
| Ga0210383_109680741 | 3300021407 | Soil | EALRLQKFNELTLTVTSENRTAVQLYEKLGFTTIKSFTAGVWPR |
| Ga0210384_100820355 | 3300021432 | Soil | TLRGMKFKELTLTVTSENYGAVQLYEKLGFTKIRTFTAGVWPR |
| Ga0210391_114826842 | 3300021433 | Soil | LRGMKFKELTLTVTSENYGAVQLYEKLGFTTIRTFTAGVWPR |
| Ga0210390_100247201 | 3300021474 | Soil | RELTLTVTTENRSAVQLYESLGFTTIRTFTAGVWPR |
| Ga0210402_100860951 | 3300021478 | Soil | SGETLRSMKFKELTLTVTSENYGAVQLYEKLGFTTIRTFTAGVWPR |
| Ga0210402_102641311 | 3300021478 | Soil | KFSELTLTVTSENHTAVHLYERLGFSKVRTFTAGVWPK |
| Ga0210402_118006122 | 3300021478 | Soil | TSAETLRSMKFKELTLTVTSENYGAVQLYEKLGFTTIRTFTAGVWPR |
| Ga0210409_104475842 | 3300021559 | Soil | RLQKFNELTLTVTSENRTAVQLYEKLGFTTIKSFTAGVWPR |
| Ga0247672_10719142 | 3300024187 | Soil | ETLRGMKFKELTLTVTSENYGAVQLYEKLGFTTIRTFTAGVWPRQ |
| Ga0247679_10774482 | 3300024251 | Soil | TLRGMKFKELTLTVTSENYGAVQLYEKLGFTTIRTFTAGVWPR |
| Ga0137417_12078471 | 3300024330 | Vadose Zone Soil | LRSMKFRELTLTVTSENHAAVQLYEKLGFHTIKSFTAGVWPR |
| Ga0137417_14694481 | 3300024330 | Vadose Zone Soil | MKFGELTLTVTSDNRTAVKLYEKLRFHTIKSFTAGVWPH |
| Ga0209863_100278511 | 3300026281 | Prmafrost Soil | FRELTLTVTTENRSAVQLYESLGFTTIRTFTAGVWPR |
| Ga0209240_12351081 | 3300026304 | Grasslands Soil | AETLRAQKFSELTLTVTTENRTAVHLYERLAFSKVRSFTAGVWPK |
| Ga0209469_100291010 | 3300026307 | Soil | RSMKFRELTLTVTSDNRAAVLLYEKLGFHTIKTFTAGVWPR |
| Ga0209158_13366432 | 3300026333 | Soil | FRELTLTVTSENRGAVQLYEKLGFQTIKSFTAGVWPR |
| Ga0257154_10860161 | 3300026467 | Soil | DALRGLKFHELTLTVTSINHGAVQLYEKLGFRTLKSFTAGVWPR |
| Ga0209690_11624941 | 3300026524 | Soil | ELTLTVTSDNRAAVLLYEKLGFHTIKSFTAGVWPH |
| Ga0209807_11120661 | 3300026530 | Soil | AEALRSMKFGELTLTVTSDNRTAVKLYEKLGFHTIKSFTAGVWPH |
| Ga0209648_104389992 | 3300026551 | Grasslands Soil | RAQKFSELTLTVTTENRTAVHLYERLAFSKVRSFTAGVWPK |
| Ga0208604_10310812 | 3300027090 | Forest Soil | MRSIQELTLTVTSENYGAVQLYEKLGFTTIRTFTAGVWPR |
| Ga0209525_10931792 | 3300027575 | Forest Soil | ESLITLTVTTENRTAVHLYERLGFSRVRSFTAGVWPK |
| Ga0209118_10531871 | 3300027674 | Forest Soil | SMKFRELTLTVTSENHAAVQLYEKLGFHTIKSFTAGVWPR |
| Ga0209180_101450762 | 3300027846 | Vadose Zone Soil | LRSMKFRELTLTVTSENRSAVQLYETLGFHTIKSFTAGVWPR |
| Ga0209180_101591291 | 3300027846 | Vadose Zone Soil | LRSMKFRELTLTVTSENRGAVQLYEKLGFQTIKSFTAGVWPR |
| Ga0209693_103767562 | 3300027855 | Soil | LRGMKFKELTLTVTSENYGAVQLYEKLGFTKIRTFTAGVWPR |
| Ga0209166_102411601 | 3300027857 | Surface Soil | ELTLTVTSENRTAVQLYEKLGFQTIKSFTAGVWPR |
| Ga0209166_105805321 | 3300027857 | Surface Soil | LRPLMLTAADSLRGLKFQELTLTVTTENRTAVHLYEQLGFKTLKTFTAGVWPR |
| Ga0209167_108055471 | 3300027867 | Surface Soil | FKELTLTVTSENKAAVHLYERLGFSTIKSFTAGVWPR |
| Ga0209465_102418771 | 3300027874 | Tropical Forest Soil | TAAETLRALKFGELTLTVTSENRTAVHLYERLGFLKVRTFTAGVWPK |
| Ga0209275_103180933 | 3300027884 | Soil | RSMKFKELTLTVTSENYGAVQLYEKLGFTKIRTFTAGVWPR |
| Ga0209624_109232081 | 3300027895 | Forest Soil | ALKFKELTLTVTSENRTAVQLYDRLGFHTIKSFTAGVWPR |
| Ga0209526_102973392 | 3300028047 | Forest Soil | TSAEALRSMKFRELTLTVTSENHTAVKLYEKLGFHTIKSFTAGVWPR |
| Ga0247682_10425591 | 3300028146 | Soil | ALMLTAADALRGLKFQELTLTVTTENRTAVRLYDQLGFKTLKTFTAGVWPR |
| Ga0308309_100915091 | 3300028906 | Soil | FRELTLTVTSENRSAVQLYESLGFTTIRTFTAGVWPR |
| Ga0308309_109349861 | 3300028906 | Soil | AETLRAQKFSELTLTVTSENRTAVHLYERLGFSKVRTFTAGVWPK |
| Ga0170834_1000373742 | 3300031057 | Forest Soil | LMQTSSDALRSMKFRELTLTVTTENRSAVQLYESLGFTTIRTFTAGVWPR |
| Ga0170824_1075301362 | 3300031231 | Forest Soil | AEALRVLKYNELTLTVTSENHTAVHLYERLGFSTIKSFTAGVWPR |
| Ga0170824_1273093831 | 3300031231 | Forest Soil | AAETLRAQKFSELTLTVTTENRTAVHLYERLSFAKVRTFTAGVWPK |
| Ga0308194_101522651 | 3300031421 | Soil | LRSMKFRELTLTVTSDNHTAVQLYEKLGFHTIKSFTAGVWPR |
| Ga0170820_165486962 | 3300031446 | Forest Soil | KYNELTLTVTSENHTAVHLYERLGFSTIKSFTAGVWPR |
| Ga0318534_103321851 | 3300031544 | Soil | MRFKELSLTVTAENRTAVHLYERLGFSTIKSFTAGVWPR |
| Ga0318538_101798042 | 3300031546 | Soil | LRAQKFTELTLTVTSENRTAVHLYERLGFSTVKSFTAGVWPR |
| Ga0307476_113136421 | 3300031715 | Hardwood Forest Soil | LMQTSAEALRLQKFNELTLTVTSETRTAVSLYEKLGFTTIKSFTAGVWPR |
| Ga0307474_104925721 | 3300031718 | Hardwood Forest Soil | RELTLTVTSQNRSAVQLYENLHFTTIRSFTAGVWPR |
| Ga0307474_108056353 | 3300031718 | Hardwood Forest Soil | RALKFRELTLTVTSQNRSAVQLYENLHFTTIRSFTAGVWPR |
| Ga0306917_109621091 | 3300031719 | Soil | LRGMHYKELSLTVTAENRGAVLLYEKLGFVTLRSFTAGVWPR |
| Ga0307469_121715451 | 3300031720 | Hardwood Forest Soil | LRALKFRELTLTVTSQNRSAVQLYENLHFTTIRSFTAGVWPR |
| Ga0307477_106525471 | 3300031753 | Hardwood Forest Soil | ALRSMKFRELTLTVTSENHTAVKLYEKLGFHTIKSFTAGVWPR |
| Ga0307475_105450912 | 3300031754 | Hardwood Forest Soil | LKFRELTLTVTSQNRSAVQLYENLHFTTIRSFTAGVWPR |
| Ga0306919_104987581 | 3300031879 | Soil | RAQHFKELSLTVTADNHTAVHLYERLGFATIRSFTAGVWPR |
| Ga0310910_103877432 | 3300031946 | Soil | AAETLRTLKFGELTLTVTSENRTAVHLYERLGFLKVRTFTAGVWPK |
| Ga0318570_100425771 | 3300032054 | Soil | KELSLTVTADNRTAVHLYERLGFNTIRSFTAGVWPR |
| Ga0318533_112318572 | 3300032059 | Soil | QTSTEALRALKYNELTLTVTSENHTAVHLYERLGFLTIKSFTAGVWPR |
| Ga0307471_1006288521 | 3300032180 | Hardwood Forest Soil | TSAETLRALKFRELTLTVTSQNRSAVQLYENLHFTTIRSFTAGVWPR |
| Ga0335082_101460293 | 3300032782 | Soil | RFKELSLTVTADNRIAVHLYERLGFTTIKSFTAGVWPR |
| Ga0335083_100755353 | 3300032954 | Soil | FKELSLTVTAENRTAVHLYERLGFTTIKSFTAGVWPR |
| Ga0335077_103027632 | 3300033158 | Soil | QTSSDALRGMHYKELSLTVTADNRAAVQLYERLGFATIKSFTAGVWPR |
| Ga0334817_029993_957_1100 | 3300033820 | Soil | TAAEALRALKFTELTLTVTSENRTAVHLYERLGFSTVKSFTAGVWPR |
| ⦗Top⦘ |