NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F045241

Metagenome Family F045241

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045241
Family Type Metagenome
Number of Sequences 153
Average Sequence Length 47 residues
Representative Sequence MDNVSVFFLAEGEQPADEVMARLTTFIRAAKQTLDFAIYDMRF
Number of Associated Samples 126
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 39.87 %
% of genes near scaffold ends (potentially truncated) 96.73 %
% of genes from short scaffolds (< 2000 bps) 95.42 %
Associated GOLD sequencing projects 124
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.732 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(25.490 % of family members)
Environment Ontology (ENVO) Unclassified
(31.373 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.556 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.30%    β-sheet: 0.00%    Coil/Unstructured: 50.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF00282Pyridoxal_deC 15.03
PF01757Acyl_transf_3 4.58
PF13177DNA_pol3_delta2 3.92
PF07617DUF1579 3.27
PF00561Abhydrolase_1 3.27
PF13091PLDc_2 2.61
PF01471PG_binding_1 1.96
PF02129Peptidase_S15 1.96
PF12681Glyoxalase_2 1.96
PF15919HicB_lk_antitox 1.31
PF05960DUF885 1.31
PF07087DUF1353 1.31
PF11127DUF2892 1.31
PF00903Glyoxalase 1.31
PF04365BrnT_toxin 1.31
PF10009DUF2252 0.65
PF12697Abhydrolase_6 0.65
PF00881Nitroreductase 0.65
PF01699Na_Ca_ex 0.65
PF09339HTH_IclR 0.65
PF02518HATPase_c 0.65
PF07731Cu-oxidase_2 0.65
PF04191PEMT 0.65
PF00271Helicase_C 0.65
PF16884ADH_N_2 0.65
PF07885Ion_trans_2 0.65
PF13602ADH_zinc_N_2 0.65
PF03167UDG 0.65
PF00534Glycos_transf_1 0.65
PF03703bPH_2 0.65
PF13730HTH_36 0.65
PF00106adh_short 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 15.03
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 1.31
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 1.31
COG0387Cation (Ca2+/Na+/K+)/H+ antiporter ChaAInorganic ion transport and metabolism [P] 0.65
COG0530Ca2+/Na+ antiporterInorganic ion transport and metabolism [P] 0.65
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.65
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.65
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.65
COG3402Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.65
COG3428Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.65
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.73 %
UnclassifiedrootN/A3.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459007|GJ61VE201AL9GKAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium522Open in IMG/M
2170459007|GJ61VE201DOYJLAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia507Open in IMG/M
2170459011|GI3SL7401ASFPNAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia509Open in IMG/M
3300000878|AL9A1W_1246832All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300000955|JGI1027J12803_106104593All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium511Open in IMG/M
3300000955|JGI1027J12803_107216784All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300000956|JGI10216J12902_105555510All Organisms → cellular organisms → Bacteria1428Open in IMG/M
3300000956|JGI10216J12902_107753516All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium541Open in IMG/M
3300002899|JGIcombinedJ43975_10016496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1183Open in IMG/M
3300004081|Ga0063454_100518284All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300004114|Ga0062593_102675133All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium568Open in IMG/M
3300004643|Ga0062591_100244240All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300005167|Ga0066672_10355238All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300005167|Ga0066672_10435222Not Available857Open in IMG/M
3300005174|Ga0066680_10961039All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005175|Ga0066673_10145395All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1315Open in IMG/M
3300005181|Ga0066678_10192934All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1297Open in IMG/M
3300005181|Ga0066678_11131323All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales503Open in IMG/M
3300005187|Ga0066675_10409460All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300005187|Ga0066675_10947177All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300005187|Ga0066675_11347167All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium525Open in IMG/M
3300005332|Ga0066388_101966125All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1047Open in IMG/M
3300005332|Ga0066388_106259237All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia601Open in IMG/M
3300005335|Ga0070666_10520744All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300005445|Ga0070708_100719452All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia939Open in IMG/M
3300005450|Ga0066682_10523407All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300005450|Ga0066682_10565865All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales718Open in IMG/M
3300005451|Ga0066681_10841585All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium552Open in IMG/M
3300005454|Ga0066687_10078392All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1618Open in IMG/M
3300005543|Ga0070672_100201548All Organisms → cellular organisms → Bacteria1664Open in IMG/M
3300005553|Ga0066695_10158589All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300005557|Ga0066704_10629405All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales685Open in IMG/M
3300005559|Ga0066700_10180639All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300005560|Ga0066670_10366007All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium880Open in IMG/M
3300005566|Ga0066693_10265300All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia682Open in IMG/M
3300005569|Ga0066705_10337721All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300005569|Ga0066705_10376200All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia892Open in IMG/M
3300005574|Ga0066694_10281631All Organisms → cellular organisms → Bacteria → Proteobacteria790Open in IMG/M
3300005576|Ga0066708_10170365All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300005587|Ga0066654_10608594All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300005598|Ga0066706_10335347All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300005718|Ga0068866_10821509All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300005764|Ga0066903_100856117All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1637Open in IMG/M
3300005764|Ga0066903_102274745All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1047Open in IMG/M
3300006031|Ga0066651_10625797All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium574Open in IMG/M
3300006046|Ga0066652_101282945All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium691Open in IMG/M
3300006046|Ga0066652_101546675All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300006175|Ga0070712_101741562All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006796|Ga0066665_10195420All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300006797|Ga0066659_10455718All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300006797|Ga0066659_11119527All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales658Open in IMG/M
3300007255|Ga0099791_10150775All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1086Open in IMG/M
3300009088|Ga0099830_10636451All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → Geothrix876Open in IMG/M
3300010322|Ga0134084_10150164All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300010333|Ga0134080_10298467All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium722Open in IMG/M
3300010337|Ga0134062_10223863All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300010366|Ga0126379_13406908All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia532Open in IMG/M
3300010366|Ga0126379_13711027All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium512Open in IMG/M
3300010373|Ga0134128_12046722All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia630Open in IMG/M
3300010376|Ga0126381_102997454All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia671Open in IMG/M
3300011120|Ga0150983_14467206All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales546Open in IMG/M
3300012198|Ga0137364_10060584All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus2555Open in IMG/M
3300012203|Ga0137399_10521200All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium997Open in IMG/M
3300012203|Ga0137399_11231036All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia630Open in IMG/M
3300012205|Ga0137362_11261104All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia624Open in IMG/M
3300012207|Ga0137381_10348652All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1291Open in IMG/M
3300012207|Ga0137381_10486812All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter1077Open in IMG/M
3300012208|Ga0137376_10519373All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1033Open in IMG/M
3300012211|Ga0137377_10291462All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300012285|Ga0137370_10323577All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia924Open in IMG/M
3300012356|Ga0137371_10457243All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia987Open in IMG/M
3300012357|Ga0137384_11015691All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia667Open in IMG/M
3300012361|Ga0137360_10923194All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales753Open in IMG/M
3300012361|Ga0137360_11611965All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia554Open in IMG/M
3300012582|Ga0137358_11120153All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012685|Ga0137397_11140308All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300012917|Ga0137395_10043728All Organisms → cellular organisms → Bacteria2782Open in IMG/M
3300012918|Ga0137396_10231840All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300012923|Ga0137359_10566906All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium998Open in IMG/M
3300012925|Ga0137419_10654668All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium848Open in IMG/M
3300012944|Ga0137410_11376923All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia612Open in IMG/M
3300012958|Ga0164299_10809446All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300012977|Ga0134087_10531864All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium597Open in IMG/M
3300012986|Ga0164304_10004981All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus5305Open in IMG/M
3300012986|Ga0164304_10107006All Organisms → cellular organisms → Bacteria1680Open in IMG/M
3300013297|Ga0157378_12282839All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium593Open in IMG/M
3300014157|Ga0134078_10595692All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300014166|Ga0134079_10148462All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300015199|Ga0167647_1071688All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300015264|Ga0137403_10150981All Organisms → cellular organisms → Bacteria2289Open in IMG/M
3300015372|Ga0132256_102765544All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300016270|Ga0182036_10196227All Organisms → cellular organisms → Bacteria1476Open in IMG/M
3300016270|Ga0182036_10405203All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1063Open in IMG/M
3300016404|Ga0182037_11246181All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300017792|Ga0163161_11628712All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300017930|Ga0187825_10291661All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300017994|Ga0187822_10026759All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1511Open in IMG/M
3300018054|Ga0184621_10309319All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales557Open in IMG/M
3300018054|Ga0184621_10331772All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300018075|Ga0184632_10164933All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus977Open in IMG/M
3300018081|Ga0184625_10164511All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300018431|Ga0066655_10501336All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300019362|Ga0173479_10803237All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium521Open in IMG/M
3300019874|Ga0193744_1047913All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300019878|Ga0193715_1045271All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium948Open in IMG/M
3300019878|Ga0193715_1062407All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300019881|Ga0193707_1123736All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales750Open in IMG/M
3300019886|Ga0193727_1084225All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300020002|Ga0193730_1050546All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300020006|Ga0193735_1052485All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1208Open in IMG/M
3300020006|Ga0193735_1148071All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia612Open in IMG/M
3300020012|Ga0193732_1020508All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300020021|Ga0193726_1029532All Organisms → cellular organisms → Bacteria2728Open in IMG/M
3300020022|Ga0193733_1108835All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium771Open in IMG/M
3300020022|Ga0193733_1143852Not Available648Open in IMG/M
3300020581|Ga0210399_11101313All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300020583|Ga0210401_11120795All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales645Open in IMG/M
3300021362|Ga0213882_10252662All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium731Open in IMG/M
3300021479|Ga0210410_11368433All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales600Open in IMG/M
3300022756|Ga0222622_10351588Not Available1027Open in IMG/M
3300025910|Ga0207684_10097595All Organisms → cellular organisms → Bacteria2509Open in IMG/M
3300025910|Ga0207684_11367085All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia581Open in IMG/M
3300025911|Ga0207654_11165988All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300025914|Ga0207671_10346591All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300025915|Ga0207693_10169888All Organisms → cellular organisms → Bacteria1717Open in IMG/M
3300025929|Ga0207664_11768395Not Available541Open in IMG/M
3300026297|Ga0209237_1204043All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia631Open in IMG/M
3300026312|Ga0209153_1097464All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1101Open in IMG/M
3300026316|Ga0209155_1299818All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium500Open in IMG/M
3300026527|Ga0209059_1151212All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium845Open in IMG/M
3300026550|Ga0209474_10276236All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales1014Open in IMG/M
3300026550|Ga0209474_10462016All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales644Open in IMG/M
3300026550|Ga0209474_10514965All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium606Open in IMG/M
3300026551|Ga0209648_10573763All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300026552|Ga0209577_10444384All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300027605|Ga0209329_1082842All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia697Open in IMG/M
3300027903|Ga0209488_10685153All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium736Open in IMG/M
3300028380|Ga0268265_11904757All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300028717|Ga0307298_10062992All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300028793|Ga0307299_10403483All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium512Open in IMG/M
3300028819|Ga0307296_10729063All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia541Open in IMG/M
3300028875|Ga0307289_10441550All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium535Open in IMG/M
3300028881|Ga0307277_10583213Not Available502Open in IMG/M
3300028906|Ga0308309_10161762All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1812Open in IMG/M
3300031231|Ga0170824_124881312All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300031720|Ga0307469_11456907All Organisms → cellular organisms → Bacteria → Proteobacteria654Open in IMG/M
3300031897|Ga0318520_10664108All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300031945|Ga0310913_10838168All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia648Open in IMG/M
3300031962|Ga0307479_10449163All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1273Open in IMG/M
3300031962|Ga0307479_11460375All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales641Open in IMG/M
3300032025|Ga0318507_10508109All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300032035|Ga0310911_10504775All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300032261|Ga0306920_100043362All Organisms → cellular organisms → Bacteria6514Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil25.49%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.58%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.27%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.31%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.31%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.65%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.65%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.65%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459007Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cmEnvironmentalOpen in IMG/M
2170459011Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cmEnvironmentalOpen in IMG/M
3300000878Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015199Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019874Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
L02_073554002170459007Grass SoilGVDNVSVFFLAEGEQPADEVMARLTTFIRAAKQTLDFCDLRHAIQ
L02_014313702170459007Grass SoilMDNVSVFFLAEGEQPADEVMARLTTFIRAAKQTLDFAIYDMR
F64_037049402170459011Grass SoilMDNVSVFFLAEGEQLADEVMARLTTFTRAAKQTLDFAIYDMRFSD
AL9A1W_124683213300000878PermafrostMDDFSVFFLAQGEQSADAVMARLTTFIRAAQQSLDLAVYDMRFSAPLRTALMSALRCLLYTSDAADERS
JGI1027J12803_10610459323300000955SoilMDDFSVFFLAQGEQSADAIMARLTTFIRAGQQSLDLAVYDMRFSAP
JGI1027J12803_10721678423300000955SoilMAGPNVDNVSVFFLAEGEQAADDVMARLTTFIRAAKQTLDFAIYDM
JGI10216J12902_10555551023300000956SoilMDTLSVFFLAEGEQAADDVMARLTTFIREAKQTLDFAIYDMRFSD
JGI10216J12902_10775351613300000956SoilMDDVSVFFLAEREQSTDEVMTRLTAFINGAKQTLDFAIYDMRFSDQLRARL
JGIcombinedJ43975_1001649633300002899SoilMDNVSVFFLAEGEQSADEVMAQLTTFIHAAKQTLDFAIYEMRFSDPLKSS
Ga0063454_10051828413300004081SoilLDNLSVFFLAEGEQTADSVMARLTAFIATAKQSLDIAVYDMRFSESLRA
Ga0062593_10267513313300004114SoilMAGVGVDNVSVFFLAEGEQPADEVMARLTNFIRAAKQTLDFAIYD
Ga0062591_10024424023300004643SoilVPDDLAVFFLAQDEQSGESVMRRLTTFIGAAQRTLDFALYDMRLSDQLKNLLSAAL
Ga0066672_1035523823300005167SoilMNNSAQDQLSVLFLAEGEQQPDAVMTRLTDFIGRARANLDFALYDMRFSDVLKNH
Ga0066672_1043522213300005167SoilLNNLSVFFLAQGEQSADAVMARLTAFIRAATQTLDFALYDM
Ga0066680_1096103913300005174SoilLHCAVDQAMGGPGVDNLSVFFLAQGEQSADAVMARLTTFIRAAKQTLDLAV
Ga0066673_1014539513300005175SoilMDNLSVFFLAEREQSADDVMARLAVFVGGAKQTLDFAIYDMRFSDSL
Ga0066678_1019293413300005181SoilMDNLSVFFLAQGEQSGDEVMARLTTFIRAARQSLDFAVYDMRFSDP
Ga0066678_1113132313300005181SoilMAGLSVDNVSVFFLAEGEQAADEVMARLTTFIRAAKQTLDFAI
Ga0066675_1040946023300005187SoilMAGPGVDNLSVFFLAQGEQTADAVMARLTTFIRAAKQTLDADAPSDF*
Ga0066675_1094717733300005187SoilVNTLSVFFLAQGEQSADSVMERLTSFIRSATQTVDFAVYDM
Ga0066675_1134716713300005187SoilMDSLSVFFLAQGEQSADAVMTRLTTFIRAAKQTLDLAVYDMRF
Ga0066388_10196612513300005332Tropical Forest SoilMSNMDNLSVVFLAEGEQSANDVLSRLTTFIRAAKQTLDFAIYDMRFSDP
Ga0066388_10625923723300005332Tropical Forest SoilMDNVSVFFLAEGEQLADEVMARLTTFIRAAKRTLDFAIYDMRFSDPLKASLSSAL
Ga0070666_1052074433300005335Switchgrass RhizosphereMDTLSVFFLAQGEQSADAVMARLTAFISAATHTLDFAVYDMRLSDHLK
Ga0070708_10071945213300005445Corn, Switchgrass And Miscanthus RhizosphereMDDFSVFFLAQGEQSADAVMARLTTFIRAAQQSLDLAVYDMRFSAPLRTALI
Ga0066682_1052340713300005450SoilVDNLSVFFLAQGEQSADAVMTRLTAFIRAAKQTLDLAVYDMRFSD
Ga0066682_1056586513300005450SoilMAGPGVDNLSVFFLAQGEQTADAVMARLTTFIRAAKQTLDLAVYDMRFSDPLRTQL
Ga0066681_1084158523300005451SoilVDNLSVFFLAEGEQTAGSVMARLTAFIRAAKQSLDIAVYDMRFGE
Ga0066687_1007839223300005454SoilMDNLSVFFLAEGEQSGDDVMTRLVTFIRAAKQTLAFAIYDMRFSGPLRAQLAAALRERA
Ga0070672_10020154843300005543Miscanthus RhizosphereMDTLSVFFLAQGEQSADAVMARLTAFISAATHTLDFAVYDMRLSDHLKTA
Ga0066695_1015858943300005553SoilVDNLSVFFLAQGEQSADAVMARLTAFIRAAKQTLDLAVY
Ga0066704_1062940513300005557SoilMGGPGVDSLSVFFLAQGEQSADAVMARLTTFIRAAKQTLDLAVYDMRFSDPLRTQ
Ga0066700_1018063913300005559SoilMAGLGVDNVSVFFLAEGEQPAGEVMARLTTFIRAAKQTLDFAI
Ga0066670_1036600713300005560SoilMDNVSVFFLAEGEQPADEVMARLTTFIRAAKQTLDFAIYDMRF
Ga0066693_1026530023300005566SoilMDNLSAFFLAEGEQSGDDVMTRLITFIRAAKQTLAFAIYDMR
Ga0066705_1033772133300005569SoilMDTLSVFFLAEGEQSADSVIERLTAFIQGATRTIDFAVYDMRFSDRLKSVLSS
Ga0066705_1037620013300005569SoilMDNLSVFFLAEREQSADDVMARLAVFVGGAKQTLDFAIYD
Ga0066694_1028163113300005574SoilMDNVSVFFLAEGEQSGDDVMTRLVTFIRAAKQTLAFAIYDMRFSDPLR
Ga0066708_1017036523300005576SoilLRYAVDRAMAGPGVDNLSVFFLAQGEQTADAVMARLTTFIRAAKQTLDADAPSDF*
Ga0066654_1060859423300005587SoilMNTLSVFFLAQGEQSADSVMEGLTLFIRSAPQTVDFAVYDMRFS
Ga0066706_1033534733300005598SoilMAGLSVDNVSVFFLAEGEQAADEVMVRLAAFIRAAKQSLDFAIYDMRFSDP
Ga0068866_1082150913300005718Miscanthus RhizosphereVPDDLAVFFLAQDEQSGESVMRRLTTFIGAAQRTLDFALYDMRLSDQLKN
Ga0066903_10085611723300005764Tropical Forest SoilVLDNLSVFFLAEGEQSGDEVMARLTTFIRAAKQSLNFAIYDMRFSDPLR
Ga0066903_10227474523300005764Tropical Forest SoilMDNVSVFFLAESEQSADDVMSRLSTFIRAAKQTLAFAIYDMRFSDPLRIQLAAALRDRAE
Ga0066651_1062579723300006031SoilMDSLSVFFLAQGEQSADAVMTRLTTFIRAAKQTLDLAVYDMRFGDTLKAALSSALRER
Ga0066652_10128294513300006046SoilVDNLSVFFLAEGEQSGDDVMTRLVTFIRAAKQTLAFAIYD
Ga0066652_10154667523300006046SoilMNTLSVFFLAEGEQTADSVMARLTDFIRAAKRTLDIAVYD
Ga0070712_10174156223300006175Corn, Switchgrass And Miscanthus RhizosphereMAGLNVDNVSVFFLAEGEQAADEVMARLTTFICAAKQTLDFAIYDM
Ga0066665_1019542033300006796SoilMADFGVDNVLVFFLAEGEQSGDEVMARLTTFIRAARQSLDFAVYDMRFSN
Ga0066659_1045571833300006797SoilMAGPGVDNLSVFFLAQGEQTADAVMARLTTFIRAAKQTLDLAVYDMRFSDPLRTQLASALRE
Ga0066659_1111952723300006797SoilMGGPGVDNLSVFFLAEGEQSSAAVMARLTTFIRTAKQTLALAVYDM
Ga0099791_1015077523300007255Vadose Zone SoilMDNLSVFFLAEGEQSGDDVMTRLVTFIRAAKQTLAFAIYDM
Ga0099830_1063645123300009088Vadose Zone SoilVDNLSVFFLAQGEQSADAVMARLGGFIRAANQTLDLAVYDMRF
Ga0134084_1015016413300010322Grasslands SoilMDNVSVFFLAEGEQSADDVMARLTTFIHAAKQSLAFAIYDMRFSDPL
Ga0134080_1029846713300010333Grasslands SoilMNTLSVFVLAEGEQTADSVMARLTDFIRAAKHTLDIAVYDMRFSESLRAQLVAALRDRA
Ga0134062_1022386313300010337Grasslands SoilVDNLSVFFLAEGEQPADSVMARLTAFIRAAKQSLDIAVYDMRFS
Ga0126379_1340690823300010366Tropical Forest SoilMDNLSVFFLAEREQSADDVMARLTAFISDAEQTLDFAIYDMRFSD
Ga0126379_1371102713300010366Tropical Forest SoilMDNLSVFFLAEGEQPADEVMARLTNFIRAATQTLDFAVYDM
Ga0134128_1204672213300010373Terrestrial SoilLDNLAVFFLAEGEQTADAVMARLISLLRAARTSLEIAVYDMRFSDSLRAQLA
Ga0126381_10299745413300010376Tropical Forest SoilMDNLSVFFLAEGEQSADDVMAWLTAFIRGAKQTLDFAIYDMR
Ga0150983_1446720623300011120Forest SoilVDNVSVLFLAEGEQPADEVMAWLTTFIRAAKQTLDF
Ga0137364_1006058413300012198Vadose Zone SoilLDTLSVFFLAQGEQSADAVMARLTTFIRAAKQTLDLA
Ga0137399_1052120013300012203Vadose Zone SoilVDNVSVFFLAQGEQSADAVMARLTAFIRAAKQTLDFAVYDM
Ga0137399_1123103623300012203Vadose Zone SoilMDDLSVFFLAEGEQSANDVMARLTTFIHAAKQTLAFAIYDMRFSGPLRAQLAAALRERA
Ga0137362_1126110423300012205Vadose Zone SoilMDNLSVFFLAEGEQSGDDVMTRLVTFIRAAKQTLAFAIYDMRLSD
Ga0137381_1034865213300012207Vadose Zone SoilMDNLSVFFLAEREQSAEEVMARLVTFIRGAKQTLDFA
Ga0137381_1048681233300012207Vadose Zone SoilMAGPGVDNLSVFFLAQGEQTADAVMARLTTFIRAANQTLDLAVYDMRFSDLLRTQLA
Ga0137376_1051937313300012208Vadose Zone SoilMDNVSVFFLAEGEQSADDVMARLTTFIRAAKQSLAFAIYDMRFSDPLRTQL
Ga0137377_1029146213300012211Vadose Zone SoilMAGLGVDNVSVFFLAEGEQPADEVMARLTTFIRAAKQTLDFAIYDMRF
Ga0137370_1032357713300012285Vadose Zone SoilVDNLSVFFLAQGEQSADAVMARLTTFIRAAKQTLDLAVYDMRFSVPLRTQLALALRERAD
Ga0137371_1045724313300012356Vadose Zone SoilVVDNLSVFILAEGEQSGDDVMARLVTFIRAAKQTLAF
Ga0137384_1101569123300012357Vadose Zone SoilMDNLSVFFLAENEQSADDVMARLTTFIRAAKQTLAFAIYDMR
Ga0137360_1092319423300012361Vadose Zone SoilMAGSGVDSLSVFFLAQGEQTADAVMARLTTFIRAAKQTLDLA
Ga0137360_1161196513300012361Vadose Zone SoilMDNVSVFFLAEGEQPADEVMALLTTFIRAAKQTLD
Ga0137358_1112015313300012582Vadose Zone SoilMAGVGVDNVSVFFLAEGEQPADEVMARLTTFIRAAKQTLDF
Ga0137397_1114030813300012685Vadose Zone SoilVDTLAVFFLSQGEQSPNSVMERLITFLRGATRTLDFAVYDMRFGDPLKNA
Ga0137395_1004372833300012917Vadose Zone SoilMDNLSVFFLAEGEQSGDDVMTRLVTFIRAAKQTLAFAIY
Ga0137396_1023184033300012918Vadose Zone SoilMGGPSVDNLSVFFLAQGEQSADAVMARLTAFIHAA
Ga0137359_1056690613300012923Vadose Zone SoilLDTLSVFLLAQGEQSADAVMARLTAFIRAARQTLDLAVYDM
Ga0137419_1065466813300012925Vadose Zone SoilLDTLSVFFLAQGEQSADAVMARLTAFIGAAKQTLDFAVYDMR
Ga0137410_1137692313300012944Vadose Zone SoilMDNLSVFFLAEREQSAEEVMARLVTFIRGAKQTLDFAIYDMRFSDS
Ga0164299_1080944613300012958SoilMDSLSVFFLAQGEQTADSVMARLTEFIRAAKHSLDIAVYDMRFSESLRAHLVAALGERAKAGVQI
Ga0134087_1053186423300012977Grasslands SoilMDNLSVFFLAEGEQSGDDVMTRLVTFIRAAKQTLAFAI
Ga0164304_1000498113300012986SoilMDNLLVFFLAEGEQSADDVMARLTTFIRLAKQTLT
Ga0164304_1010700613300012986SoilMDSLSVFFLAQGEQTADSVMARLTEFIRAAKHSLDIAVYDMRFSEALRAHLVAALGERAK
Ga0157378_1228283923300013297Miscanthus RhizosphereLSADTLSFLFLAQREQTADAVMSRLLEFVRGATQTLDFAVYDMRFTEPLKNAFRAALR
Ga0134078_1059569213300014157Grasslands SoilMNTLSVFFLAEGEQTADSVMARLTDFIRAAKHTLDIAVYDMRFSE
Ga0134079_1014846213300014166Grasslands SoilVDNLSVFFLAEGEQTADSVMARLTAFISAAKQSLDIAVYDMRFGEALRVQLVAALRERA
Ga0167647_107168813300015199Glacier Forefield SoilMDTLSVFFLAQDEQPADAVMARLTAFIRAATQTLDFALYD
Ga0137403_1015098143300015264Vadose Zone SoilMAGVGVDNVSVFFLAEGEQPADEVMTRLTTFIRAAKQTLDFAIYDMRFSDP
Ga0132256_10276554413300015372Arabidopsis RhizosphereVSNEKSDGLSVFFLAEGEQTADSVLARLTSFVSEAKQSLDFAVYDMRLDDPLKNELTRALAERAKAGVDIRI
Ga0182036_1019622733300016270SoilMDNVSVFFLAEREQSADKVMARLTAFINGATQTLDFA
Ga0182036_1040520323300016270SoilMDNFLVFFLAEREQSADDVMTRLTAFIHGARQTLDFAIY
Ga0182037_1124618113300016404SoilSSMDNVSVFFLAEREQSLDDVMGRLTAFISGAKQTLDFAVYDMRFSDALGAQLGDGIT
Ga0163161_1162871213300017792Switchgrass RhizosphereVPDDLAVFFLAQDEQSAESVMGRLTTFIGAAQQTLDFAVYDMRLSDPLKNAL
Ga0187825_1029166113300017930Freshwater SedimentMDSVSVFFLAQGEQSAASVMDRLVTFVRGATRSLDFAVYDMRLSDPLKATL
Ga0187822_1002675913300017994Freshwater SedimentMDSLSVFFLAQGEQSGDEVMARLTAFIRTARQSLDFAVYD
Ga0184621_1030931923300018054Groundwater SedimentMAGLGVDNVSVFFLAEGEQPGDEVMARLTTFIRAAK
Ga0184621_1033177213300018054Groundwater SedimentMAGLGVGNVSVFFLAEGEQPADDVMARLTTFIRAARQTLDFAIYDMR
Ga0184632_1016493333300018075Groundwater SedimentMAGLGVDNVSVFFLAEGEQPADEVMARLTTFIRAAKQ
Ga0184625_1016451123300018081Groundwater SedimentMAGVGVDNVSVFFLAEGEQSADAVMGRLTKFIRAAKQTLDLAVYDMRF
Ga0066655_1050133633300018431Grasslands SoilMAGPGVDNLSVFFLAQGEQTADAVMARLTTFIRAAKQTL
Ga0173479_1080323713300019362SoilMAGLGVDNVSVFFLAEGEQPADEVMARLTTFIRAAKQT
Ga0193744_104791313300019874SoilMDNLSVFFLAQGEQTADSVMARLTAFIRAAKQSLDIAVYDMRF
Ga0193715_104527113300019878SoilMDNVSVFFLAEGEQRADEVMARLTTFIRAAKQTLDFAIYDMRF
Ga0193715_106240723300019878SoilVDNVSVFFLAEDEQPADEVMARLTTFIRAAKQTLDFAIYDMR
Ga0193707_112373623300019881SoilMAGLGVDNVSVFFLAEGEQPADEVMARLTTFIRAAKQTLDFAIYDMR
Ga0193727_108422523300019886SoilMAGLGVDNVSVFFLAEGEQPADEVMARLTTFIRAAKQTLDFAIYDMRAIR
Ga0193730_105054613300020002SoilMAGLGVDNVSVFFLAEGEQPAEEVMARLTTFIRAAKQTLD
Ga0193735_105248513300020006SoilMAGLGVDNLSVFFLAEGEQRADEVMARLTTFIRAAKQTLD
Ga0193735_114807113300020006SoilMDNLAVFFLAEREQSADEVMARLTAFISGAKHTLDFAVYDMRLSDPL
Ga0193732_102050813300020012SoilMAGLGVDNVSVFFLAEGEQPADEVMARLTTFIRAAKQTLDFAI
Ga0193726_102953253300020021SoilMSDSLSVFFLAQDEQAADAVMARLTAFIRATQRTLDLAVYDMRFTEPLRAQL
Ga0193733_110883513300020022SoilMDNVSVFFLAEGEQRADDVMVRLTTFIHAAKQTLDFAIYDMRFSDPL
Ga0193733_114385213300020022SoilVDTLSVFFLAQGEQTADMVMARLLAFIGTAKRSLDFAVYDMRLSDRLKAALSS
Ga0210399_1110131313300020581SoilVDTLSVCFLAQGEQSADSVMERLTTFIRGATRTLDFAVYDMRFSDPLKNALD
Ga0210401_1112079523300020583SoilMGGAGVDNLSVFFLAQGEQSADAVMARLTTFIRAAKQTLD
Ga0213882_1025266223300021362Exposed RockMDSLSVFFLAQGEQSSAAVMDRLTTFIGGAEHTLDFAIYDMRFSPSLKAALTS
Ga0210410_1136843313300021479SoilMGGAGVDNLSVFFLAQGEQSADAVMIRLTTFIRAAKQTI
Ga0222622_1035158813300022756Groundwater SedimentVDTLSVFFLAQGEQTADMVMARLLAFIGTAKRSLDFAVYDMRLSDRLKAALS
Ga0207684_1009759533300025910Corn, Switchgrass And Miscanthus RhizosphereVDTLSVVFLAQGEQSADSVMERLTAFIRGATQTLDFAV
Ga0207684_1136708513300025910Corn, Switchgrass And Miscanthus RhizosphereMDNLSVLFLAEREQSAGDVMARLAAFIRGAKQTLDFAI
Ga0207654_1116598813300025911Corn RhizosphereMDTLSVFFLAQGEQSAASVMARLTNFIGAAKQSLDFAVYDMRLSDP
Ga0207671_1034659113300025914Corn RhizosphereMDTLSVFFLAQGEQSAASVMARLTNFISAAKQSLDFAVYDMRLSDPL
Ga0207693_1016988813300025915Corn, Switchgrass And Miscanthus RhizosphereMAGLGVDNVSVFFLAEGEQPADEVMARLTTFIRAAKQTLDFA
Ga0207664_1176839513300025929Agricultural SoilVDTLSVFFLAQGEQSADSVMERLTTFLRGATRALDI
Ga0209237_120404313300026297Grasslands SoilMDNLSVFFLAEGEQSGDDVMTRLVTFIRAAKQTLAFAIYD
Ga0209153_109746423300026312SoilMDNLSVFFLAEREQSADDVMARLAVFVGGAKQTLDF
Ga0209155_129981823300026316SoilMDSLSVFFLAQGEQSADAVMTRLATFIRAAKQTLDLAVYDMRFGDALKAALSSAL
Ga0209059_115121223300026527SoilVDNVSVFFLAQGEQSADAVMARLTAFIRAAKQTLDFAVYD
Ga0209474_1027623613300026550SoilMAGLSVDNVSVFFLAEGEQAADEVMARLTAFIRAAKQSLDFAIYDMRFSDP
Ga0209474_1046201623300026550SoilMAGPGVDNLSVFFLAQGEQTADAVMARLTTFIRAAKQTLDLAVYD
Ga0209474_1051496513300026550SoilMDNVSVFFLAEGEQSSDYVMTRLVTFIRAAKQTLVFAIYDMRFS
Ga0209648_1057376323300026551Grasslands SoilVDNLSVFFLAQGEQSADAVMARLTTFIRAAKQTLDLAVYDMRFSDPLRTQL
Ga0209577_1044438413300026552SoilMDNVSVFFLAEGEQSSDDVMTRLVTFIHAAKQTLVFAIYDMRFSDLLRA
Ga0209329_108284223300027605Forest SoilLPSTVAKAMGDLGVDTLSVFFLAQGEQSADAVMARLTTFIRAAKQTLDLAVYDMRFSDPLRTQL
Ga0209488_1068515323300027903Vadose Zone SoilMDNLSVFFVAEGEQSGDDVMTRLVTFIRAAKQTLAFAIYDMRFSDPLK
Ga0268265_1190475713300028380Switchgrass RhizosphereVPDDLAVFFLAQDEQSGESVMRRLTTFIGAAQRTLDFALYDMRLSDQLKNLLSAA
Ga0307298_1006299233300028717SoilMAGLGVDNVWVFFLAEGEQPADEVMARLTTFIRAAKQTLDFAI
Ga0307299_1040348313300028793SoilMAGLGVDNVSVFFLAEGEQPGDEVMARLTTFTRAAKQTLDFAIYDMRFSDP
Ga0307296_1072906323300028819SoilMDDLSVFFLAECEQSADDVMARLTTFIRAAKQTLAFAIYDMRFSDSLRAQLAAALRERA
Ga0307289_1044155013300028875SoilMAGLGVDNVSVFFLAEGEQPADEVMARLTTFIRAAKQTLDLAVYDMRFS
Ga0307277_1058321323300028881SoilVDTLSVFFLAQGEQTADMVMARLLAFIGTAKRSLDFAVYDMRLSDRLKAALSSAL
Ga0308309_1016176213300028906SoilMDNLSVFFLAQGEQPANAVMARLTTFLRAAKQTLDLAVYDM
Ga0170824_12488131223300031231Forest SoilMVGLGVDNVSVFFLAEGEQPADEVMARLITFIRAA
Ga0307469_1145690713300031720Hardwood Forest SoilMADLGVDNVSVFFLAEGEQPAEEVMARLTTFLRGAKQTLDFAIYDMRFSDPLK
Ga0318520_1066410813300031897SoilVDTLSVFFLAQGEQSAASVVQRLKAFVLSARKTLDIAVYDMRFGD
Ga0310913_1083816813300031945SoilMDNLSVFFLAEREQSADEVMARLTAFISGAKQSLDFAIYDMRFSDSLRTQLTAALREK
Ga0307479_1044916323300031962Hardwood Forest SoilLDTLSVFLLAQGEQSADAVMARLTAFIRAAKQTLDLAVYDMR
Ga0307479_1146037513300031962Hardwood Forest SoilMGDPSVDNLSVFFLAQGEQSADAVMARLTAFIRAAKQTLDL
Ga0318507_1050810913300032025SoilVDTLSVFFLAQGEQSAASVVQRLKAFVLSARRTLDIAVYDMRFGDPLKAELFSAL
Ga0310911_1050477513300032035SoilMDNLSVFFLAEGEQSAEDVMARLTDFISGAKRALEFAIYDMRFSGPLRA
Ga0306920_10004336263300032261SoilMDNVSVFFLAEREQSLDDVMGRLTAFISGAKQTLDFAVYDMRFSDALGAQLGDGIT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.