NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045240

Metagenome / Metatranscriptome Family F045240

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045240
Family Type Metagenome / Metatranscriptome
Number of Sequences 153
Average Sequence Length 40 residues
Representative Sequence PGAQDADRVVVVPGETHALKGHRAVIVDAVAEWLPTVL
Number of Associated Samples 137
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 94.12 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.346 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(37.255 % of family members)
Environment Ontology (ENVO) Unclassified
(22.222 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.791 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.30%    β-sheet: 3.03%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF13365Trypsin_2 1.31
PF00664ABC_membrane 0.65
PF13191AAA_16 0.65
PF13180PDZ_2 0.65
PF07992Pyr_redox_2 0.65
PF00266Aminotran_5 0.65
PF13581HATPase_c_2 0.65
PF02518HATPase_c 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.35 %
UnclassifiedrootN/A0.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig29898All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300001471|JGI12712J15308_10127038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae653Open in IMG/M
3300002245|JGIcombinedJ26739_100421017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1214Open in IMG/M
3300002245|JGIcombinedJ26739_100776691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales838Open in IMG/M
3300005332|Ga0066388_101376350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1223Open in IMG/M
3300005341|Ga0070691_10426502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales752Open in IMG/M
3300005355|Ga0070671_100214897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1631Open in IMG/M
3300005437|Ga0070710_11138103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales574Open in IMG/M
3300005602|Ga0070762_10119347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1548Open in IMG/M
3300005614|Ga0068856_102478878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura525Open in IMG/M
3300005937|Ga0081455_10375105All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300006028|Ga0070717_10992462All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300006175|Ga0070712_101934337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales516Open in IMG/M
3300006176|Ga0070765_101061867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae765Open in IMG/M
3300006581|Ga0074048_12807582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M
3300006804|Ga0079221_10216369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1062Open in IMG/M
3300009522|Ga0116218_1354713All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300009525|Ga0116220_10163158All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300009545|Ga0105237_10324380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1544Open in IMG/M
3300009824|Ga0116219_10362899All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300010043|Ga0126380_10131277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1568Open in IMG/M
3300010122|Ga0127488_1083726All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300010164|Ga0063827_107762All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300010326|Ga0134065_10311647All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300010379|Ga0136449_102255737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Carbonactinosporaceae → Carbonactinospora → Carbonactinospora thermoautotrophica792Open in IMG/M
3300010400|Ga0134122_13401601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales501Open in IMG/M
3300011053|Ga0138531_132463All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300011068|Ga0138599_1121174All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300011069|Ga0138592_1060462All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300011072|Ga0138563_1116186All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300011087|Ga0138570_1163096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300011120|Ga0150983_11414081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia570Open in IMG/M
3300011120|Ga0150983_13384038All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300012205|Ga0137362_10590714All Organisms → cellular organisms → Bacteria → Terrabacteria group958Open in IMG/M
3300012285|Ga0137370_10391030All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300012378|Ga0134025_1037389All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300012507|Ga0157342_1031748All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300013296|Ga0157374_12559058All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300014164|Ga0181532_10536994All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300014657|Ga0181522_10754371All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300014838|Ga0182030_10057351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6053Open in IMG/M
3300016270|Ga0182036_10607543All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300016357|Ga0182032_10935943All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300017822|Ga0187802_10236979All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300017926|Ga0187807_1204071All Organisms → cellular organisms → Bacteria → Terrabacteria group641Open in IMG/M
3300017928|Ga0187806_1015833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2145Open in IMG/M
3300017932|Ga0187814_10001258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9629Open in IMG/M
3300017946|Ga0187879_10348463All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300017974|Ga0187777_10427395All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300017974|Ga0187777_11026185All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300017975|Ga0187782_10457188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces974Open in IMG/M
3300018007|Ga0187805_10152910All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300018043|Ga0187887_10246458All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300018058|Ga0187766_11300183All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300018060|Ga0187765_10265394All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300019178|Ga0184583_120460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300019361|Ga0173482_10107568All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300019890|Ga0193728_1086796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1465Open in IMG/M
3300019890|Ga0193728_1182601All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300020140|Ga0179590_1118455All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300021404|Ga0210389_10134184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1916Open in IMG/M
3300021404|Ga0210389_10236314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1428Open in IMG/M
3300021404|Ga0210389_10750283All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300021405|Ga0210387_10977035All Organisms → cellular organisms → Bacteria → Terrabacteria group742Open in IMG/M
3300021420|Ga0210394_10567639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces998Open in IMG/M
3300021474|Ga0210390_10862634All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300021478|Ga0210402_10691886All Organisms → cellular organisms → Bacteria → Terrabacteria group942Open in IMG/M
3300021478|Ga0210402_10721781All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300022529|Ga0242668_1110070All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300022709|Ga0222756_1022143All Organisms → cellular organisms → Bacteria → Terrabacteria group822Open in IMG/M
3300022712|Ga0242653_1081025All Organisms → cellular organisms → Bacteria → Terrabacteria group571Open in IMG/M
3300022714|Ga0242671_1029985All Organisms → cellular organisms → Bacteria → Terrabacteria group816Open in IMG/M
3300022715|Ga0242678_1019736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Carbonactinosporaceae → Carbonactinospora → Carbonactinospora thermoautotrophica810Open in IMG/M
3300024288|Ga0179589_10596524All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300024323|Ga0247666_1025692All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300025916|Ga0207663_11205330All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300025928|Ga0207700_10364894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1260Open in IMG/M
3300026876|Ga0207837_1008771All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300027110|Ga0208488_1022648All Organisms → cellular organisms → Bacteria → Terrabacteria group1202Open in IMG/M
3300027313|Ga0207780_1037002All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300027590|Ga0209116_1029587All Organisms → cellular organisms → Bacteria → Terrabacteria group1154Open in IMG/M
3300027676|Ga0209333_1125181All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300027692|Ga0209530_1047563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1259Open in IMG/M
3300027824|Ga0209040_10438551All Organisms → cellular organisms → Bacteria → Terrabacteria group598Open in IMG/M
3300027857|Ga0209166_10335347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia792Open in IMG/M
3300028742|Ga0302220_10178788All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300028879|Ga0302229_10411204All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300028906|Ga0308309_10793348All Organisms → cellular organisms → Bacteria → Terrabacteria group823Open in IMG/M
3300030056|Ga0302181_10154574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1093Open in IMG/M
3300030490|Ga0302184_10089681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1408Open in IMG/M
3300030520|Ga0311372_11114717All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300030535|Ga0210285_1168285All Organisms → cellular organisms → Bacteria → Terrabacteria group704Open in IMG/M
3300030545|Ga0210271_10777820All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300030549|Ga0210257_11024702All Organisms → cellular organisms → Bacteria → Terrabacteria group662Open in IMG/M
3300030573|Ga0210272_1067039All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300030573|Ga0210272_1098133All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300030598|Ga0210287_1042097All Organisms → cellular organisms → Bacteria → Terrabacteria group909Open in IMG/M
3300030602|Ga0210254_10049792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia997Open in IMG/M
3300030617|Ga0311356_10044311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales4761Open in IMG/M
3300030624|Ga0210251_10521516All Organisms → cellular organisms → Bacteria → Terrabacteria group860Open in IMG/M
3300030741|Ga0265459_11300451All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300030743|Ga0265461_10743430All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300030743|Ga0265461_12761632All Organisms → cellular organisms → Bacteria → Terrabacteria group585Open in IMG/M
3300030743|Ga0265461_13761771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300030760|Ga0265762_1167130All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300030906|Ga0302314_10553814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1218Open in IMG/M
3300031035|Ga0074026_11109904All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300031234|Ga0302325_10509191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1815Open in IMG/M
3300031421|Ga0308194_10151109All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300031469|Ga0170819_15274752All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300031525|Ga0302326_11709934All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300031544|Ga0318534_10104016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1627Open in IMG/M
3300031544|Ga0318534_10726099All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300031546|Ga0318538_10245431All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300031636|Ga0310113_128276All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300031680|Ga0318574_10151189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1318Open in IMG/M
3300031680|Ga0318574_10258638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1008Open in IMG/M
3300031681|Ga0318572_10202455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1159Open in IMG/M
3300031682|Ga0318560_10676714All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300031713|Ga0318496_10689563All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031719|Ga0306917_10609529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales858Open in IMG/M
3300031751|Ga0318494_10866827All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300031764|Ga0318535_10036977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1986Open in IMG/M
3300031768|Ga0318509_10123597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1413Open in IMG/M
3300031779|Ga0318566_10257608All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300031793|Ga0318548_10334656All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300031798|Ga0318523_10027641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2543Open in IMG/M
3300031799|Ga0318565_10385074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales680Open in IMG/M
3300031805|Ga0318497_10052556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2104Open in IMG/M
3300031819|Ga0318568_10676958All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300031831|Ga0318564_10126173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1140Open in IMG/M
3300031846|Ga0318512_10202495All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300031869|Ga0316030_105335All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300031942|Ga0310916_11132423All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300031946|Ga0310910_11045883All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300031959|Ga0318530_10271176All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300031959|Ga0318530_10347268All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300032041|Ga0318549_10071456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1473Open in IMG/M
3300032041|Ga0318549_10267056All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300032059|Ga0318533_10956817All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300032063|Ga0318504_10412348All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300032063|Ga0318504_10657347All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300032090|Ga0318518_10503185All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300032160|Ga0311301_12242611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales624Open in IMG/M
3300032261|Ga0306920_100100981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4271Open in IMG/M
3300032515|Ga0348332_12958238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces507Open in IMG/M
3300032515|Ga0348332_14124768All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300032805|Ga0335078_10048203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6308Open in IMG/M
3300032892|Ga0335081_11962719All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300032895|Ga0335074_10252358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2074Open in IMG/M
3300032954|Ga0335083_11202081Not Available587Open in IMG/M
3300033289|Ga0310914_11802736All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300034163|Ga0370515_0195974All Organisms → cellular organisms → Bacteria861Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil37.25%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.19%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.88%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.27%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.27%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.31%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.31%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.31%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.65%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.65%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.65%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.65%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.65%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010122Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010164Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 61 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011053Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011068Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011069Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011072Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011087Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012378Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300019178Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022709Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022715Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026876Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 58 (SPAdes)EnvironmentalOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027313Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030535Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030573Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030602Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030624Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031035Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031636Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031869Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI2 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_018797202124908016QDADRVVVVPGETHALKGHRPAIVAAVAEWLPTVL
JGI12712J15308_1012703813300001471Forest SoilPFGIPGTRDADRVVVVPGETHALKGHRAVIAGAVADWLPGVLRSRISTEG*
JGIcombinedJ26739_10042101733300002245Forest SoilVQDADRVVVVPGETHALKGHRAVIAGTVADWLPGALRLRVSTDG*
JGIcombinedJ26739_10077669123300002245Forest SoilIPGAQDADRVVVVPGETHALRGHRAIIVAAVAEWLPTVL*
Ga0066388_10137635033300005332Tropical Forest SoilPFGIPGAQDADRVVVVPGETHALKGHRAEIVAAVAEWLPAVLSG*
Ga0070691_1042650213300005341Corn, Switchgrass And Miscanthus RhizosphereGVPGAQDADRVVVVPGETHALKGHRAVIVDAVAEWLPTVL*
Ga0070671_10021489733300005355Switchgrass RhizosphereVPGAQDADRVVVVPGETHALKGHRAVIVDAVAEWLPTVL*
Ga0070710_1113810323300005437Corn, Switchgrass And Miscanthus RhizosphereDPFGIPGASDADRVVVVPGETHALKGHRAVIVAAVTEWLYANL*
Ga0070762_1011934743300005602SoilADRIVVVPGETHALKGHRAVIRAAVAEWLPATLPA*
Ga0068856_10247887823300005614Corn RhizosphereSDADRVVVVPGETHALKGHRAVIVAAVTEWLYANL*
Ga0081455_1037510533300005937Tabebuia Heterophylla RhizosphereAEDADRVVVVPGETHALRGHRAVIVAAIAEWLPAVL*
Ga0070717_1099246223300006028Corn, Switchgrass And Miscanthus RhizosphereRVVVVPGETHALRGHRAVIAGAVADWLPGVLRSRVSTEG*
Ga0070712_10193433713300006175Corn, Switchgrass And Miscanthus RhizospherePGASDADRVVVVPGETHALKGHRAVIVAAVTEWLYANL*
Ga0070765_10106186723300006176SoilGIPRARDADRVVVVPGETHALKGHRAVIAGAVADWLPGALRSKVSTEG*
Ga0074048_1280758233300006581SoilAQDADRVVVVPGEAHALKGHRAVIVDAVTEWLTTVL*
Ga0079221_1021636933300006804Agricultural SoilPFGIPGAQDADRVVLVPGETHALKGHRAVIVAAVAEWLPTVL*
Ga0116218_135471323300009522Peatlands SoilGIPSAQDADRVVVVPGETHALKGHRAAIVAAVTEWLSTVL*
Ga0116220_1016315813300009525Peatlands SoilRVVVVPGEAHALKGHRAVIGGAVADWLPGVLRRTGPG*
Ga0105237_1032438033300009545Corn RhizosphereFGVPGAQDADRVVVVPGETHALKGHHAVIVDAVTEWLPTVL*
Ga0116219_1036289923300009824Peatlands SoilIPGPQDADRVVVVPGETHSLKGHRAVIADAVAQWLPTVLR*
Ga0126380_1013127713300010043Tropical Forest SoilDADRVVVVPGETHALKGHRPAIMAAVAEWLPTVL*
Ga0127488_108372623300010122Grasslands SoilFGIPAAQDADRVVVIPGETHALKGHRAIIVAAVAEWLPVVL*
Ga0063827_10776223300010164Peatlands SoilDVDRVVVVPGETHALKGHRGAIVTAITEWLPTVL*
Ga0134065_1031164713300010326Grasslands SoilGAQDADRVVVVPGETHALKGHRAVSAGAVAEWLPTVL*
Ga0136449_10225573713300010379Peatlands SoilPQDADRVVVVPGETHSLKGHRAVIADAVAQWLPTVLR*
Ga0134122_1340160123300010400Terrestrial SoilRVPFGIPGAQDADRVVVVPGETHALKGHRAVIVDAVTEWLPTVL*
Ga0138531_13246313300011053Peatlands SoilVVPGEAHALKGHRAVIGGAVADWLPGVLRRTGPG*
Ga0138599_112117413300011068Peatlands SoilAQDVDRVVVVPGETHALKGHRGAIVTAITEWLPTVL*
Ga0138592_106046213300011069Peatlands SoilPFGIPAVQDADRVVVVPGETHALKGHRAAIVAAITEWLPTVL*
Ga0138563_111618623300011072Peatlands SoilFGIPAAQDVDRVVVVPGETHALKGHRGAIVTAITEWLPTVL*
Ga0138570_116309623300011087Peatlands SoilFGIPRADQADRVVIVPGETHALKGHRAVIAGAVAEWLATVVR*
Ga0150983_1141408123300011120Forest SoilDEADRVVIVPGETHSLKGHRAVIAGAVAEWLATVVR*
Ga0150983_1338403813300011120Forest SoilADADRVVIVPRETHALKGHRKEIAAAVTEWLPTVLGR*
Ga0137362_1059071423300012205Vadose Zone SoilPGARDADRVVVVPGETHALRGHRAVIAGAVADWLPGVLRSRVSTEG*
Ga0137370_1039103013300012285Vadose Zone SoilDADRVVVVPGETHALSGHRAIIVAAVAEWLPVVL*
Ga0134025_103738913300012378Grasslands SoilGIPAAQDADRVVLVPGETHALKGHRAVIVAAVAEWLPTVL*
Ga0157342_103174823300012507Arabidopsis RhizosphereAQDADRVVVVPGETHALKGHRPAVVAAVVEWLPTVL*
Ga0157374_1255905823300013296Miscanthus RhizosphereAQDADRVVVVPGETHALKGHRAVIVDAVAEWLPTVL*
Ga0181532_1053699423300014164BogQDADRVVVVPGETHALKGHRAAIVAAVTEWLSTVL*
Ga0181522_1075437123300014657BogPDSGDADRVVVVPRETHALRGHRAEIVEAVAGWLPTVI*
Ga0182030_1005735113300014838BogIPDAGDADRVVIVRGETHALKAHRPEIIDAVTDWLPSVL*
Ga0182036_1060754323300016270SoilGIPRADDADRVVVVPGETHSLKGHRAVIAGAVTDWLPGVLR
Ga0182032_1093594323300016357SoilGIPGTGDADRVVVVPGETHSLRGHRAVIAGAVTDWLPGVLRLPAYCAQERPR
Ga0187802_1023697923300017822Freshwater SedimentIPGVGDADRVVIVPGETHSLKGHRAVIAGAVAEWLPGVLRSRGSS
Ga0187807_120407123300017926Freshwater SedimentFGIPGVGDADRVVVVPGEAHSLKGHRAVIAGAVAGWLPGVLR
Ga0187806_101583313300017928Freshwater SedimentGDADRVVIVPGETHSLKGHRAVIAGAVAEWLPGVLRSRGSS
Ga0187814_1000125813300017932Freshwater SedimentNPFGIPGPYDADKIVVVPGETHSLKGHRAVIADAVTQWLPTVLR
Ga0187879_1034846313300017946PeatlandGVPDSGDADRIVIVPRETHALRGHRAEIAAAVAGWLPTVL
Ga0187777_1042739513300017974Tropical PeatlandPGTQDADRVVVVPGETHALKGHRAEIVAAVAEWLPTVLSASRP
Ga0187777_1102618513300017974Tropical PeatlandFGIPGSEDADQVVTVPGETHSLKGHRAVIISAVSAWLPTVVR
Ga0187782_1045718833300017975Tropical PeatlandPGPQDADRVVIVPGEAHALRGHRAAIADAVSAWLPAVLR
Ga0187805_1015291013300018007Freshwater SedimentERDPFGIPAAHDVDRVVVVPGETHALKGHRGAIVAAITEWLPTVL
Ga0187887_1024645833300018043PeatlandFGIPDSGDADRVVIVPRETHALKGHRAEIAEAVAGWLPTVI
Ga0187766_1130018323300018058Tropical PeatlandADRVVIVPGETHSLKGHRAVIAAAVTEWLPGVLRSGASS
Ga0187765_1026539413300018060Tropical PeatlandDRVVVVPGEAHALKGHRAAIVAAIADWLPAVLCARMTGEPG
Ga0184583_12046023300019178SoilFGVPDAADADRIVVVPGETHALKGHRAVIRAAVAEWLPKVT
Ga0173482_1010756813300019361SoilPGAQDADRVVVVPGETHALKGHRAVIADTVAEWLPTVL
Ga0193728_108679613300019890SoilIPGVSEADRVVVVPGETHALKGHRAIIVAVIAGWLPAVL
Ga0193728_118260113300019890SoilGAQDADRVVLVPGETHALKGHRAAIVAAVAEWLPTVL
Ga0179590_111845523300020140Vadose Zone SoilQDADRVVVVPGETHALKGHRAVIVDAVAEWLLTVL
Ga0210389_1013418453300021404SoilIPGAQDADRVVVLPGETHALRGHRAAIVTAVTEWLPTVL
Ga0210389_1023631433300021404SoilFGIPGAQDADRVVVVPGETHALKGHRATIVAAVSEWLPTVL
Ga0210389_1075028313300021404SoilCPGAQEADRVVVVPGETHALKGHRAVIVDAVAEWLPTVL
Ga0210387_1097703513300021405SoilPRARDADRVVVVPGETHALKGHRAVIAGAVADWLPGALRSKGFN
Ga0210394_1056763913300021420SoilGIPGAQDADRVVVVPGETHALKGHRAAIVAAVTEWLPTVL
Ga0210390_1086263423300021474SoilRVVVVPGETHALKGHRAVIAGAVADWLPGVLRSRVSTEG
Ga0210402_1069188613300021478SoilFGIPGAQDADRVVVLPGETHALRGHRAAIVTAVTEWLPTVL
Ga0210402_1072178113300021478SoilPFGIPGAQDADRVVVVPGETHALKGHRPAVVAAVAEWLPTVL
Ga0242668_111007013300022529SoilADRVVVVPGETHALKGHRAVIAGAVADWLPGVLRSRVSTEG
Ga0222756_102214313300022709SoilGIPRARDADRVVVVPGETHALKGHRAVIAGAVADWLPGVLRSRVSTEG
Ga0242653_108102513300022712SoilRARDADRVVVVPGETHALKGQRAVIAGAVADWLPGVLRSRVSTEG
Ga0242671_102998513300022714SoilDADRVVVVPGETHALKGHRAVIAGAVADWLPGALRSKVSTEG
Ga0242678_101973623300022715SoilFGIPGPQDADRIVVVPGETHSLKGHRAVIADAVAQWLPTVLG
Ga0179589_1059652413300024288Vadose Zone SoilCGIPGAQDADRVVVVPGETHALKGHRAVIVGAVAEWLPTVL
Ga0247666_102569213300024323SoilGVPGAQDADRVVVVPGETHALKGHRAVIVDAVAEWLPTVL
Ga0207663_1120533013300025916Corn, Switchgrass And Miscanthus RhizosphereIPGAGDADRVVVVPGETHALKGHRAVIVAAVAEWLYANL
Ga0207700_1036489433300025928Corn, Switchgrass And Miscanthus RhizosphereFGVPGVRDADRVVVVPGETHALKGHRAVIVDAVAEWLPTVL
Ga0207837_100877113300026876Tropical Forest SoilQRDPFGIPGREDADLVVAVPGETHSLKGHGEVIVSAVAAWLPAVLR
Ga0208488_102264823300027110Forest SoilEDADRVVVVPGETHALKGHRHVIAAAVADWLPTVL
Ga0207780_103700223300027313Tropical Forest SoilQDADLVVTVPGETHSLKGHGEVIVSAVAAWLPAVLR
Ga0209116_102958723300027590Forest SoilDAFGIPRPEDADRVVVVPGETHALKGHRHVIAAAVADWLPTVL
Ga0209333_112518113300027676Forest SoilGERDAFGIARPEDADRVVVVPGETHALKGHRHVIAAAVADWLPTVL
Ga0209530_104756333300027692Forest SoilVVVVPGETHSLRGHRAVIAGAVADWLPGVLRSRGFN
Ga0209040_1043855123300027824Bog Forest SoilGTGDADRVVIVPGETHSLKGHRTVIAGAVADWLPGVLRERNPN
Ga0209166_1033534733300027857Surface SoilQADRVVIVPGETHALRGHRAVITGAVAEWLATVLS
Ga0302220_1017878823300028742PalsaDADRVVIVPRETHALKGHRAEIVEAVAEWLPTALKASML
Ga0302229_1041120413300028879PalsaDSGDADRVVVVPRETHALRGHRAEIVEAVAGWLPTVI
Ga0308309_1079334823300028906SoilEDADRVVVVPGETHALKGHRQVITAAVADWLPTML
Ga0302181_1015457413300030056PalsaRDLFGIPDSGDADRIVIVPRETHALRGHRAEIAAAVTGWLPTVL
Ga0302184_1008968133300030490PalsaFGIPDSGDADRVVIVPRETHALKGHRAEIAEAVAEWLPTVI
Ga0311372_1111471713300030520PalsaDSGDADRVVIVPRETHALKGHRAEIAEAVAEWLPTVI
Ga0210285_116828523300030535SoilGARDGDRVVVVPGETHSLRGHRAVIAGAVADWLPGVLRSRVSTKG
Ga0210271_1077782023300030545SoilCFVVPGETHSLKGHRAVIAGAVADWLPGVLRSRASTEG
Ga0210257_1102470213300030549SoilGARDADRVVVVPGETHSLRGHRAVIAGAVADWLPGVLR
Ga0210272_106703913300030573SoilYDIFLLPFGIPDSEDADRVVIVPRETHSLKGHRTEIVSAIAEWLPTVLGR
Ga0210272_109813313300030573SoilGADEADRVVIVPGETHSLRGHRAVIAGAVAEWLATVLR
Ga0210287_104209723300030598SoilRDADRVVVVPGETHALKGHRAVIAAAVADWLPGVLRSRVSTEG
Ga0210254_1004979213300030602SoilQDADRVVVVPGETHSLKGHRAVIVDAIAQWLPTVLW
Ga0311356_1004431153300030617PalsaDPGDADRVVIVPRETHALKGHRAEIAEAVAGWLPTVI
Ga0210251_1052151623300030624SoilVVVVPGETHSLKGHRAIIAGAVTDWLPGALRSRGFN
Ga0265459_1130045123300030741SoilGVPGPEDADRVVVVPGETHALKGHGRAIAAAVADWLAIVL
Ga0265461_1074343013300030743SoilPGARDADRVVVVPGETHSLKGHRAVIAGAVADWLPGVLRSRASTEG
Ga0265461_1276163213300030743SoilGIPGAADADRVVVVPGETHLRKGHRAFIAGAVADWLPGVLG
Ga0265461_1376177123300030743SoilLSFYFCWIPDPGDADRVVIVPRETHALKGHRAEIAEAVAGWLPTVI
Ga0265762_116713013300030760SoilADADRIVVVPGETHALKGHRAVIRAAVAEWLPKVT
Ga0302314_1055381433300030906PalsaLFGIPDSGDADRIVIVPRETHALRGHRAEIAAAVTGWLPTVL
Ga0074026_1110990413300031035SoilPDAADADRIVVVPGETHALKGHRAVIRAAVAEWLPKVMPAGGLAT
Ga0302325_1050919113300031234PalsaGIPDSGDADRVVIVPRETHALKGHRAEIAEAVAEWLPTVI
Ga0308194_1015110913300031421SoilPGAQDADRVVVVPGETHALKGHRAVIVDAVAEWLPTVL
Ga0170819_1527475223300031469Forest SoilGIPGAQDADRVVVVPGETHALKGHRAAIAAAVAEWLPTVL
Ga0302326_1170993423300031525PalsaHESLADRVVIVPRETHALKGHRAEIAEAVAEWLPTVI
Ga0318534_1010401643300031544SoilQDADRVVVVPGETHALKGHRAVIAAAVAAWLPTVLSASRP
Ga0318534_1072609913300031544SoilIPGTGDADRVVVVPGETHSLRGHRAVIAGAVTDWLPGVLRLPAYCA
Ga0318538_1024543113300031546SoilGIPDARDADRVVVVPGETHALKGHREAIVTAVAEWLPTVL
Ga0310113_12827623300031636SoilVPDAADADEVVIVPGETHALRGHGRIISAAIERWLPTVLG
Ga0318574_1015118913300031680SoilIPGSEDADRVVTVPGEAHWLKGHRAVIISAVTAWLPTVLR
Ga0318574_1025863823300031680SoilPGARDADRVVVVPGETHALKGHRAAIVAAVAEWLPVVL
Ga0318572_1020245513300031681SoilFGIPDARDADRVVVVPGETHALKGHREAIVTAVAEWLPTVL
Ga0318560_1067671413300031682SoilPFGIPGLEDADLVVTVPGETHSLKGHRAVIVSAVTAWLPTVLR
Ga0318496_1068956313300031713SoilDADRVVVVPGETHSLRGHRAVIAGAVTDWLPGVLR
Ga0306917_1060952913300031719SoilRDPFGIPGAQDADRVVVIPGETHALKGHRPVIVAAVAEWLPTVL
Ga0318494_1086682723300031751SoilAQDADRVVVVPGETHALKGHRAVIAAAVAEWLPTVLSVSRP
Ga0318535_1003697753300031764SoilPGSEDADRVVTVPGEAHWLKGHRAVIISAVTAWLPTVLR
Ga0318509_1012359713300031768SoilDDADRVVVVPGETHSLKGHHAVVTGAVTDWLPGVLRLREALLRES
Ga0318566_1025760813300031779SoilIPGAQDADRVVVIPGETHALKGHRPVIVAAVAEWLPTVL
Ga0318548_1033465613300031793SoilRADDADRVVVVPGETHSLKGHRAVIAGAVTDWLPGVLR
Ga0318523_1002764113300031798SoilPFGIPGSEDADRVVTVPGEAHWLKGHRAVIISAVTAWLPTVLR
Ga0318565_1038507423300031799SoilPFGIPGAQDADRVVVVPGETHALKGHRAVIAAAVAEWLPTVLSASRP
Ga0318497_1005255643300031805SoilGDADRVVVVPGETHSLRGHRAVIAGAVTDWLPGVLRLPAYCAQERPR
Ga0318568_1067695813300031819SoilFGIPRAHDADRVVVVPGETHSLKGHRAVIAGAVTDWLPGVLR
Ga0318564_1012617313300031831SoilAQDADRVVVVPGETHALKGHRAVIAAAVAEWLPTVLSASRP
Ga0318512_1020249513300031846SoilPGDPERVVVVPGETHSLKGHRAVIAGAVTDWLPGVLR
Ga0316030_10533523300031869SoilDADEVVIVPGETHALRGHSGIITAAVERWLPTVLRTLSQRG
Ga0310916_1113242313300031942SoilAGDADRVVVVPGETHSLKGHRAVIAGAVTDWLPGVLR
Ga0310910_1104588323300031946SoilPFGIPGREDADLVVTVPGETHSLKGHRAVIVSAVTAWLPTVLR
Ga0318530_1027117623300031959SoilGIPGSEDADRVVTVPGEAHWLKGHRAVIISAVTAWLPTVLR
Ga0318530_1034726813300031959SoilFGIPGASDADRVVVVPGETHSLKGHRAVIAGAVTDWLPHVLR
Ga0318549_1007145613300032041SoilFGIPGSEDADRVVTVPGEAHWLKGHRAVIISAVTAWLPTVLR
Ga0318549_1026705613300032041SoilGVQDADRVVVIPGETHALKGHRPVIVAAVAEWLPTVL
Ga0318533_1095681723300032059SoilFGIPRADDADRVVVVPGETHSLKGHRAVIAGAVTDWLPGVLR
Ga0318504_1041234813300032063SoilDADRVVVVPGETHSLRGHRAVIAGAVTDWLPGVLRLPAYCA
Ga0318504_1065734723300032063SoilFGIAGASDADRVVVVPGETHSLKGHRAVIAGAVTDWLPHVLR
Ga0318518_1050318513300032090SoilQDADRVVVVPGETHALKGHRAVIAAAVAEWLPTVLSASRP
Ga0311301_1224261113300032160Peatlands SoilDPFGIPGAEDADRVVVVPGETHALKGHRAAIVAAVTEWLPTVL
Ga0306920_10010098163300032261SoilGIPGASDADRVVVVPGETHSLKGHRAVIAGAVTDWLPHVLR
Ga0348332_1295823813300032515Plant LitterIPGAQDADRVVVVPGETHALKGHRAAIVAAVTEWLPTVP
Ga0348332_1412476823300032515Plant LitterVVVVPGETHALKGHRAVIGGAVADWLPGVLRLRVSTEG
Ga0335078_1004820313300032805SoilFGIPGPGDAGRVVVVPGETHALKGHRQVISAAVADWLATVL
Ga0335081_1196271933300032892SoilGIPAARDADRVIVVPGETHALKGHRAAIAAAVAEWLPTVL
Ga0335074_1025235813300032895SoilDRVVVVPGETHSLKGHRTVIAAAVAGWLPGVLRSAGSS
Ga0335083_1120208113300032954SoilVPGAQDADRVVVVPGETHALKGHRAVIVDAVAGWLPTVLTKK
Ga0310914_1180273623300033289SoilPRADDADRVVVVPGETHSLKGHRAVIAGAVTDWLPGVLR
Ga0370515_0195974_740_8593300034163Untreated Peat SoilIPGRADADRVVIIPRETHALKGHRADVISIVTEWLPTVL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.