NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F045229

Metagenome Family F045229

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045229
Family Type Metagenome
Number of Sequences 153
Average Sequence Length 44 residues
Representative Sequence HDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP
Number of Associated Samples 131
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.96 %
% of genes near scaffold ends (potentially truncated) 94.12 %
% of genes from short scaffolds (< 2000 bps) 89.54 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.346 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(13.072 % of family members)
Environment Ontology (ENVO) Unclassified
(19.608 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.170 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.29%    β-sheet: 0.00%    Coil/Unstructured: 55.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF02567PhzC-PhzF 9.15
PF04073tRNA_edit 5.23
PF11199DUF2891 3.92
PF02558ApbA 3.27
PF12802MarR_2 1.96
PF08546ApbA_C 1.96
PF05163DinB 1.96
PF00589Phage_integrase 1.96
PF08240ADH_N 1.96
PF00266Aminotran_5 1.31
PF07883Cupin_2 1.31
PF12704MacB_PCD 1.31
PF03446NAD_binding_2 1.31
PF14833NAD_binding_11 1.31
PF13561adh_short_C2 1.31
PF00126HTH_1 0.65
PF04397LytTR 0.65
PF00326Peptidase_S9 0.65
PF12867DinB_2 0.65
PF14707Sulfatase_C 0.65
PF00709Adenylsucc_synt 0.65
PF14329DUF4386 0.65
PF06580His_kinase 0.65
PF01850PIN 0.65
PF01361Tautomerase 0.65
PF00595PDZ 0.65
PF02633Creatininase 0.65
PF00156Pribosyltran 0.65
PF03781FGE-sulfatase 0.65
PF05016ParE_toxin 0.65
PF04851ResIII 0.65
PF01557FAA_hydrolase 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 9.15
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 1.96
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 1.96
COG0104Adenylosuccinate synthaseNucleotide transport and metabolism [F] 0.65
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.65
COG1402Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis)Coenzyme transport and metabolism [H] 0.65
COG1942Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.65
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 0.65
COG3275Sensor histidine kinase, LytS/YehU familySignal transduction mechanisms [T] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.35 %
UnclassifiedrootN/A0.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001305|C688J14111_10000416All Organisms → cellular organisms → Bacteria10845Open in IMG/M
3300001593|JGI12635J15846_10650243All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300002245|JGIcombinedJ26739_100048083All Organisms → cellular organisms → Bacteria3873Open in IMG/M
3300002245|JGIcombinedJ26739_100834331All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300002917|JGI25616J43925_10146914All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300004479|Ga0062595_101244828All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300004635|Ga0062388_101777349All Organisms → cellular organisms → Bacteria → Proteobacteria632Open in IMG/M
3300005175|Ga0066673_10118914All Organisms → cellular organisms → Bacteria1439Open in IMG/M
3300005332|Ga0066388_105077291All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300005332|Ga0066388_106263032All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300005332|Ga0066388_106517902All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005355|Ga0070671_100631747All Organisms → cellular organisms → Bacteria → Proteobacteria926Open in IMG/M
3300005440|Ga0070705_101629804All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005468|Ga0070707_101708366All Organisms → cellular organisms → Bacteria → Proteobacteria596Open in IMG/M
3300005535|Ga0070684_101467128All Organisms → cellular organisms → Bacteria → Proteobacteria643Open in IMG/M
3300005542|Ga0070732_10919445All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300005549|Ga0070704_100764967All Organisms → cellular organisms → Bacteria → Proteobacteria861Open in IMG/M
3300005553|Ga0066695_10412754All Organisms → cellular organisms → Bacteria → Proteobacteria836Open in IMG/M
3300005557|Ga0066704_10335726All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1016Open in IMG/M
3300005576|Ga0066708_10153955All Organisms → cellular organisms → Bacteria → Proteobacteria1414Open in IMG/M
3300005591|Ga0070761_10379832All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300005602|Ga0070762_10427615All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300005610|Ga0070763_10100086All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300006050|Ga0075028_100100576All Organisms → cellular organisms → Bacteria → Proteobacteria1474Open in IMG/M
3300006176|Ga0070765_100219422All Organisms → cellular organisms → Bacteria1733Open in IMG/M
3300006178|Ga0075367_10421220All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium845Open in IMG/M
3300006755|Ga0079222_10565796All Organisms → cellular organisms → Bacteria → Proteobacteria856Open in IMG/M
3300006794|Ga0066658_10096933All Organisms → cellular organisms → Bacteria1387Open in IMG/M
3300006854|Ga0075425_100068960All Organisms → cellular organisms → Bacteria → Proteobacteria3979Open in IMG/M
3300009088|Ga0099830_11583399All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300009137|Ga0066709_102829574All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300009177|Ga0105248_10547469All Organisms → cellular organisms → Bacteria → Proteobacteria1305Open in IMG/M
3300009551|Ga0105238_11450871All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300010046|Ga0126384_11809793All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300010048|Ga0126373_11590587All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300010048|Ga0126373_11926195All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300010322|Ga0134084_10096057All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300010360|Ga0126372_11746169All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300010361|Ga0126378_12594695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales579Open in IMG/M
3300010371|Ga0134125_10980186All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300012199|Ga0137383_10881278All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300012202|Ga0137363_11167353All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300012357|Ga0137384_10690465All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300012917|Ga0137395_10713271All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300012924|Ga0137413_11776369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. PAMC 26617509Open in IMG/M
3300012929|Ga0137404_10151883All Organisms → cellular organisms → Bacteria → Proteobacteria1927Open in IMG/M
3300012929|Ga0137404_10816647All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300012929|Ga0137404_11700298All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300012929|Ga0137404_12149365All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300012930|Ga0137407_12129862All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300012930|Ga0137407_12419290All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300012944|Ga0137410_11072735All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300012948|Ga0126375_11060813All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300012957|Ga0164303_10027036All Organisms → cellular organisms → Bacteria → Proteobacteria2303Open in IMG/M
3300012960|Ga0164301_11787904All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300012986|Ga0164304_11112882All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300014495|Ga0182015_10870474All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300014501|Ga0182024_10167057All Organisms → cellular organisms → Bacteria3061Open in IMG/M
3300015054|Ga0137420_1412810All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300016341|Ga0182035_11457266All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300016387|Ga0182040_11745901All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300016404|Ga0182037_11211334All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300016404|Ga0182037_11260357All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300016445|Ga0182038_10720892All Organisms → cellular organisms → Bacteria → Proteobacteria870Open in IMG/M
3300016445|Ga0182038_10734655All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300017822|Ga0187802_10017690All Organisms → cellular organisms → Bacteria2412Open in IMG/M
3300017930|Ga0187825_10227129All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300017955|Ga0187817_10882752All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300017975|Ga0187782_10078336All Organisms → cellular organisms → Bacteria2418Open in IMG/M
3300017975|Ga0187782_10422453All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300017975|Ga0187782_11068601All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300018009|Ga0187884_10341376All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300018032|Ga0187788_10032117All Organisms → cellular organisms → Bacteria1723Open in IMG/M
3300018058|Ga0187766_11082861All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300018062|Ga0187784_10025032All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae4814Open in IMG/M
3300018062|Ga0187784_10177383All Organisms → cellular organisms → Bacteria1741Open in IMG/M
3300018064|Ga0187773_11001525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. PAMC 26617548Open in IMG/M
3300020170|Ga0179594_10371640All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300020199|Ga0179592_10133426All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1139Open in IMG/M
3300021168|Ga0210406_10581399All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300021170|Ga0210400_11470659All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium541Open in IMG/M
3300021180|Ga0210396_10508998All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300021181|Ga0210388_10065831All Organisms → cellular organisms → Bacteria3044Open in IMG/M
3300021402|Ga0210385_10368555All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300021407|Ga0210383_10372914All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1231Open in IMG/M
3300021433|Ga0210391_10090982All Organisms → cellular organisms → Bacteria2407Open in IMG/M
3300021560|Ga0126371_12697252All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300021560|Ga0126371_13352627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales541Open in IMG/M
3300022515|Ga0224546_1009047All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300022557|Ga0212123_10211516Not Available1427Open in IMG/M
3300024225|Ga0224572_1011186All Organisms → cellular organisms → Bacteria1697Open in IMG/M
3300024330|Ga0137417_1023111All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300025905|Ga0207685_10152789All Organisms → cellular organisms → Bacteria → Proteobacteria1046Open in IMG/M
3300025905|Ga0207685_10569034All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300025916|Ga0207663_10162412All Organisms → cellular organisms → Bacteria1578Open in IMG/M
3300025922|Ga0207646_11927355All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300025928|Ga0207700_11107198All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300025941|Ga0207711_10430023All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. OK0911228Open in IMG/M
3300026304|Ga0209240_1077989All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300026304|Ga0209240_1239649All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300026555|Ga0179593_1081607All Organisms → cellular organisms → Bacteria2077Open in IMG/M
3300026555|Ga0179593_1199349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4084Open in IMG/M
3300026555|Ga0179593_1207592All Organisms → cellular organisms → Bacteria2999Open in IMG/M
3300027648|Ga0209420_1032169All Organisms → cellular organisms → Bacteria1634Open in IMG/M
3300027652|Ga0209007_1036177All Organisms → cellular organisms → Bacteria → Proteobacteria1264Open in IMG/M
3300027676|Ga0209333_1214030All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300027745|Ga0209908_10182265All Organisms → cellular organisms → Bacteria → Proteobacteria567Open in IMG/M
3300027829|Ga0209773_10461619All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300027842|Ga0209580_10374519All Organisms → cellular organisms → Bacteria → Proteobacteria710Open in IMG/M
3300027857|Ga0209166_10520661All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L60610Open in IMG/M
3300027867|Ga0209167_10786392All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300027879|Ga0209169_10043171All Organisms → cellular organisms → Bacteria2358Open in IMG/M
3300027884|Ga0209275_10303693All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium886Open in IMG/M
3300027884|Ga0209275_10306065All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium883Open in IMG/M
3300028759|Ga0302224_10339305All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300028773|Ga0302234_10350822All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300028785|Ga0302201_10067007All Organisms → cellular organisms → Bacteria → Proteobacteria1710Open in IMG/M
3300028906|Ga0308309_10266861All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1437Open in IMG/M
3300029882|Ga0311368_10220044All Organisms → cellular organisms → Bacteria → Proteobacteria1489Open in IMG/M
3300029910|Ga0311369_10339524All Organisms → cellular organisms → Bacteria → Proteobacteria1325Open in IMG/M
3300029911|Ga0311361_10400628All Organisms → cellular organisms → Bacteria → Proteobacteria1442Open in IMG/M
3300029913|Ga0311362_10409410All Organisms → cellular organisms → Bacteria → Proteobacteria1321Open in IMG/M
3300029944|Ga0311352_11158025All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300029951|Ga0311371_10917327All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300029993|Ga0302304_10175201All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300029999|Ga0311339_10539667All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300030580|Ga0311355_10835498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. PAMC 26617842Open in IMG/M
3300030617|Ga0311356_10361341All Organisms → cellular organisms → Bacteria → Proteobacteria1441Open in IMG/M
3300030739|Ga0302311_10605776All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300030746|Ga0302312_10157782All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300031233|Ga0302307_10261580All Organisms → cellular organisms → Bacteria → Acidobacteria887Open in IMG/M
3300031234|Ga0302325_11413027All Organisms → cellular organisms → Bacteria → Acidobacteria904Open in IMG/M
3300031236|Ga0302324_103433976All Organisms → cellular organisms → Bacteria515Open in IMG/M
(restricted) 3300031248|Ga0255312_1016789All Organisms → cellular organisms → Bacteria → Proteobacteria1747Open in IMG/M
3300031545|Ga0318541_10867480All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300031680|Ga0318574_10701478All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300031708|Ga0310686_100510024All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300031708|Ga0310686_112500675All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1105Open in IMG/M
3300031747|Ga0318502_10142637All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1362Open in IMG/M
3300031747|Ga0318502_10628097All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300031754|Ga0307475_11209088All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300031771|Ga0318546_10196124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1378Open in IMG/M
3300031823|Ga0307478_10265505All Organisms → cellular organisms → Bacteria → Proteobacteria1398Open in IMG/M
3300031823|Ga0307478_11064881All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300031890|Ga0306925_10470159All Organisms → cellular organisms → Bacteria → Proteobacteria1342Open in IMG/M
3300031910|Ga0306923_12544863All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300031912|Ga0306921_10114074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3143Open in IMG/M
3300031942|Ga0310916_10486870All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300032074|Ga0308173_10436444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571160Open in IMG/M
3300032076|Ga0306924_11939628All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300032180|Ga0307471_100002957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia9969Open in IMG/M
3300032205|Ga0307472_101152887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria737Open in IMG/M
3300032898|Ga0335072_10988466All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46774Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.07%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa9.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.23%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.23%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.23%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.27%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.27%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.61%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.96%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.31%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.31%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.65%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.65%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.65%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.65%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.65%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.65%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.65%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.65%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.65%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022515Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1EnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
C688J14111_1000041683300001305SoilMIPSEIHDMARYSSWMLLFNATDLYFDRQLNKRSAPSP*
JGI12635J15846_1065024313300001593Forest SoilEDLRSHNIDHDVIMIPNEIHEMARYSSWMMLFNAADVYFDRHLDKRSAPAP*
JGIcombinedJ26739_10004808313300002245Forest SoilXXIMIPNEIHVMARYSSWMILFNAADVYFDRHLDKRSAPAP*
JGIcombinedJ26739_10083433113300002245Forest SoilVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP*
JGI25616J43925_1014691413300002917Grasslands SoilDVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPSP*
Ga0062595_10124482813300004479SoilHDVIMIPNEIHDMARYSSWMLLFNAADVYFDRHLDKRSVPAP*
Ga0062388_10177734913300004635Bog Forest SoilRSHNIDHDVIMIPNEIHVMVRYSSWMTLFNAADVYFDRHLDKRIAPTP*
Ga0066673_1011891433300005175SoilIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPSP*
Ga0066388_10507729123300005332Tropical Forest SoilEGLRSHNIDHDVIMIPNEIHDMARYSSWMLLFNAADLYFARHLDKRNAPAP*
Ga0066388_10626303213300005332Tropical Forest SoilGLRSHNIDHDVIMIPNEIHDMARYASWMMLFNAADVYFDRHLNKRSAPGAP*
Ga0066388_10651790223300005332Tropical Forest SoilEHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRQLNKRSASLRL*
Ga0070671_10063174713300005355Switchgrass RhizosphereVIMIPNEIHDMARYSSWMLLFNAADGYFDRHLDKRSVPAP*
Ga0070705_10162980413300005440Corn, Switchgrass And Miscanthus RhizosphereIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP*
Ga0070707_10170836623300005468Corn, Switchgrass And Miscanthus RhizosphereHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRNAPSPQADP*
Ga0070684_10146712813300005535Corn RhizosphereEGLRSHGVDHDVIMIPNEIHDMARYSSWMTLFDAAAAYFDRQLNR*
Ga0070732_1091944523300005542Surface SoilNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPSP*
Ga0070704_10076496713300005549Corn, Switchgrass And Miscanthus RhizosphereIMIPNEIHDMARYSSWMLLFNAADVYFDRHLDKRNVPAP*
Ga0066695_1041275433300005553SoilHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPSP*
Ga0066704_1033572613300005557SoilIPNEIHDMARYSSWMMLFKAADAYFDRQLNKRSAPAP*
Ga0066708_1015395513300005576SoilHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPSP*
Ga0070761_1037983223300005591SoilMIPNEIHVMARYASWMILFNATDVYFDRHLDKRSAPNP*
Ga0070762_1042761523300005602SoilNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP*
Ga0070763_1010008633300005610SoilNEIHAMSRYSSWMTLFNAADVYFDRHLEKRSALTP*
Ga0075028_10010057623300006050WatershedsSHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP*
Ga0070765_10021942253300006176SoilMIPNEIHEMARYSSWMTLFNAADVYFDRHLDKRSA
Ga0075367_1042122023300006178Populus EndosphereGSPLNIHDMARYSSSLFDAADVYFDRHLDKRSAPAL*
Ga0079222_1056579623300006755Agricultural SoilIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNRRSAPSP*
Ga0066658_1009693313300006794SoilIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP*
Ga0075425_10006896023300006854Populus RhizosphereMGSPLNIHDMARYSSSLFDAADVYFDRHLDKRSAPAL*
Ga0099830_1158339913300009088Vadose Zone SoilIDHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPSP*
Ga0066709_10282957423300009137Grasslands SoilHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSASSP*
Ga0105248_1054746933300009177Switchgrass RhizosphereHNIDHDVIMIPNEIHDMARYSSWMLLFNAADVYFDRHLDKRNVPAP*
Ga0105238_1145087123300009551Corn RhizosphereLEGLRSHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP*
Ga0126384_1180979313300010046Tropical Forest SoilELIEGLRSHDIDHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRRLNKRGAPSPQAGPSSRL*
Ga0126373_1159058713300010048Tropical Forest SoilIMIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP*
Ga0126373_1192619513300010048Tropical Forest SoilIDHGVIMIPNEIHDLARYSSWLMLFNAAAVYFDQHLDKRTAPAP*
Ga0134084_1009605723300010322Grasslands SoilNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP*
Ga0126372_1174616913300010360Tropical Forest SoilIMIPNEIHDMARYSSWMMLFNAADAYFDRHLDKRSAPAP*
Ga0126378_1259469513300010361Tropical Forest SoilIMIPNEIHDMARYSSWMLLFNAADVYFDRQLNKRSALAP*
Ga0134125_1098018623300010371Terrestrial SoilHDVIMIPNEIHDMARYSSWMMLFSAADVYFDRHLDQRSAPAP*
Ga0137383_1088127813300012199Vadose Zone SoilELIEGLRSRRIDHDVIVIPNEIHDPARYSSWMMLFKAADAYFDRQLNKRSAPAP*
Ga0137363_1116735313300012202Vadose Zone SoilIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPAP*
Ga0137384_1069046513300012357Vadose Zone SoilIDYDVIMIPNEIHVMARYSSWMTSFNATDAYFDRHLGKQTVPTP*
Ga0137395_1071327113300012917Vadose Zone SoilEIHDMARYSSWMMLFNAADVYFDQHLDKRSAPAP*
Ga0137413_1177636913300012924Vadose Zone SoilDHDVILIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPSP*
Ga0137404_1015188313300012929Vadose Zone SoilIMIPNEIHDLARYSSWMILFNAADVYFDRHLDKRSAPAP*
Ga0137404_1081664723300012929Vadose Zone SoilLRSHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP*
Ga0137404_1170029813300012929Vadose Zone SoilLIEGLRSHNIEHDVIMIPNEIHDMARYSSWMMLFNEADMYFDRHLDKRSAPSP*
Ga0137404_1214936513300012929Vadose Zone SoilVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLDKRSTPAR*
Ga0137407_1212986213300012930Vadose Zone SoilIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRRAPAP*
Ga0137407_1241929023300012930Vadose Zone SoilDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP*
Ga0137410_1107273513300012944Vadose Zone SoilHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP*
Ga0126375_1106081313300012948Tropical Forest SoilAELIEGLRSHNIDHDVIMIPNEIHDLARYSSWMMLFNAADVYFGRQLNKRSAPSP*
Ga0164303_1002703643300012957SoilHNIDHDVIMIPNEIHDMARYSSWMMLFRAADVYFDRHLDKRSVPAP*
Ga0164301_1178790423300012960SoilSHNIDHDVIMIPNEIHDMARYSSWMMLFNAADAYFDRHLDKRSAPAP*
Ga0164304_1111288213300012986SoilHNIDHDVIMIPNEIHDMARYSSWMMLFSAADVYFDRHLDQRSAPAP*
Ga0182015_1087047413300014495PalsaIPNEIHVMARYSSWMILFNAANVYFDRHLDKRSAPTP*
Ga0182024_1016705763300014501PermafrostSHNIDHDVIMIPNEIHDLARYSSWMTLFNAADVYFDRHLDKRSAPAP*
Ga0137420_141281013300015054Vadose Zone SoilIEGLRSHNIDHDVIMIPNEIHDMARYSSWMMLLSWMMLFNAADVYFDRHLDKRSAPAP*
Ga0182035_1145726623300016341SoilILIPNEIHDLARYSSWMMLFNAADVYFDRQLNRQNAPSL
Ga0182040_1174590113300016387SoilDLARYSSWMMLFTAADVYFNRHLNKQTAPSPLAGSSL
Ga0182037_1121133413300016404SoilIPNEIHDLARYSSWMMLFNAADVYFDRQLNRQNAPSL
Ga0182037_1126035733300016404SoilHNIEHDVIMIPNEIHDLARYSSWMMLFDAADVYFGRQLNRRSAPSP
Ga0182038_1072089223300016445SoilIEGLRSHNIDHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0182038_1073465533300016445SoilLARYSSWMMLFTAADVYFNRHLNKQTAPSPLAGSSL
Ga0187802_1001769013300017822Freshwater SedimentGLRSHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0187825_1022712923300017930Freshwater SedimentLRSHNIDHDVIMIPNEIHDMARYSSWMMLFSAADVYFDRHLDQRSAPAP
Ga0187817_1088275223300017955Freshwater SedimentSHNIEHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSALSP
Ga0187782_1007833653300017975Tropical PeatlandMIPNEIHDLARYSSWMMLFNAAAVYFDRHLDQRSVPAR
Ga0187782_1042245313300017975Tropical PeatlandLIEDLRSHNIDHDVIVIPNEIHVMARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0187782_1106860113300017975Tropical PeatlandNEIHVMVRYSSWMMLFNAADVYFDRHLDKRSAPTP
Ga0187884_1034137613300018009PeatlandQATELIEDLRSHNIDHDVIMIPNEIHVMARCSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0187788_1003211713300018032Tropical PeatlandRNIEHDVIMIPNEIHDLARYSSWMTLFAAADVYFDRQLQQRSAPFP
Ga0187766_1108286113300018058Tropical PeatlandNIDHDVIMIPNEIHIMARYSSWMMLFNAADVYFDRHLDKRSAPTP
Ga0187784_1002503233300018062Tropical PeatlandMIPNEIHDLARYSSWMMLFNAAAVYFDRHLDQRSVPAP
Ga0187784_1017738313300018062Tropical PeatlandIPNEIHVMARYSSWMMLFNAADVYFDRHLDKRSAPTP
Ga0187773_1100152513300018064Tropical PeatlandRSHNIDHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0179594_1037164023300020170Vadose Zone SoilNEIHDMARYSSWMMLFNAADVYFDRHLGKRSAPAP
Ga0179592_1013342633300020199Vadose Zone SoilMIPNEIHDLARYSSWMILFNAADVYFDRHLDKRSAPAP
Ga0210406_1058139923300021168SoilEGLRSHNIDHDVIMIPNEMHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0210400_1147065923300021170SoilEHDVVMIPNEIHAMSRYSSWMTLFNAADVYFDRHLEKRSALTP
Ga0210396_1050899823300021180SoilGLRSHNIDHDVILIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPTP
Ga0210388_1006583163300021181SoilNIDHDVIMIPNEIHVMARCSSWMTLFNAADVYFDRHLDKRSAPTP
Ga0210385_1036855523300021402SoilMIPNEIHVMARYASWMILFNATDVYFDRHLDKRSAPNP
Ga0210383_1037291423300021407SoilIEHDVVMIPNEIHAMSRYSYWMTLFNAADVYFDRHLEKRSALTP
Ga0210391_1009098243300021433SoilDVIMIPNEIHDMARYSSWMILFNAADVYFDRHLDKRSPAP
Ga0126371_1269725213300021560Tropical Forest SoilHNIEHDVIMIPNEIHDLARYSAWLMLFTAAAVYFDRHLDKRTAPAP
Ga0126371_1335262713300021560Tropical Forest SoilIPNEIHDMARYSSWMLLFNAADVYFDRQLNKRSALAP
Ga0224546_100904713300022515SoilEVIMIPNEIHVMVRYASWMTLFHAADVYFDRHLDKRSAPAP
Ga0212123_1021151613300022557Iron-Sulfur Acid SpringMIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0224572_101118633300024225RhizosphereDVIMIPNEIHVMARYSSWMILFNAADVYLDRHLDKRSAPTP
Ga0137417_102311113300024330Vadose Zone SoilGRRTHRRLAVARSHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0207685_1015278913300025905Corn, Switchgrass And Miscanthus RhizosphereAELLEGLRSHHIDHDVIMIPNEIHDMARYASWMLLFNAADVYFDRQLDKRSAPAP
Ga0207685_1056903413300025905Corn, Switchgrass And Miscanthus RhizosphereIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0207663_1016241243300025916Corn, Switchgrass And Miscanthus RhizosphereIMIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0207646_1192735513300025922Corn, Switchgrass And Miscanthus RhizosphereIEGLRSHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRNAPSPQADP
Ga0207700_1110719813300025928Corn, Switchgrass And Miscanthus RhizosphereIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPLP
Ga0207711_1043002313300025941Switchgrass RhizosphereLRSHNIDHDVIMIPNEIHDMARYSSWMLLFNAADVYFDRHLDKRNVPAP
Ga0209240_107798913300026304Grasslands SoilDHDVIMIPNEIHDMARYSSWMALFNAAAVYFDRQLNKRSGP
Ga0209240_123964923300026304Grasslands SoilMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0179593_108160723300026555Vadose Zone SoilMIPNEIHVMARYSSWMMLFNAADVYFDRHLDKRSAPNIPSASQGER
Ga0179593_119934913300026555Vadose Zone SoilEGLRLHNIDHDVIMIPNEIHDLARYSSWMILFNAADVYFDRHLDKRSAPAP
Ga0179593_120759263300026555Vadose Zone SoilMIPNEIHDMARYSSWMMLFNAADMYFDRHLDKRRAPAP
Ga0209420_103216913300027648Forest SoilIDHDVIMIPNEIHEMARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0209007_103617733300027652Forest SoilNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0209333_121403023300027676Forest SoilSDHDVIMIPNEIHEMARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0209908_1018226523300027745Thawing PermafrostLDVYKRQGLRSHNVDHDVIMIPNEIHDLARYSSWMMLFNAAYVYFDRHLDKWSAPAP
Ga0209773_1046161923300027829Bog Forest SoilQATALIEDLRSHNIDHDVIMIPNEIHVMARYSSWMILFNAADVYFDRHLDKRSAPTP
Ga0209580_1037451923300027842Surface SoilGLRSHNIEHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRQLNKRSAPSP
Ga0209166_1052066113300027857Surface SoilMIPNEIHDLARYSSWMMLFNAADVYFDRQLNKRSAPSP
Ga0209167_1078639223300027867Surface SoilLRSHNIDHDVIMIPNEIHDFARYSSWMMLFNAADMYFDRQLDKR
Ga0209169_1004317133300027879SoilNEIHAMSRYSSWMTLFNAADVYFDRHLEKRSALTP
Ga0209275_1030369323300027884SoilNIDHDVIMIPNEIHVMARCSSWMTLFNAADVYFDRHLDKRSVPTP
Ga0209275_1030606513300027884SoilHDVVMIPNEIHAMSRYSSWMTLFNAADVYFDRHLEKRSALTP
Ga0302224_1033930523300028759PalsaAAELIEGLRSHNIDHDVIMIPNEMHDLARYSSWMMLFNAANVYFDRHLDKRSAPVP
Ga0302234_1035082213300028773PalsaAELIEGLRSHNIDHDVIMIPNEMHDLARYSSWMMLFNAADVYFDRHLDKRSAPVP
Ga0302201_1006700713300028785BogLIEGLRSHNIDHDVIMIPNEMHDLARYSSWMMLFNAANVYFDRHLDKRSAPVP
Ga0308309_1026686133300028906SoilIIEHDVVMIPNEIHAMSRYSSWMTLFNAADVYFDRHLEKRSALTP
Ga0311368_1022004413300029882PalsaHDVIMIPNEMHDLARYSSWMMLFNAADVYFDRHLDKRSAPVP
Ga0311369_1033952413300029910PalsaMEGLRSHNIDHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRHLGKQSAPAP
Ga0311361_1040062833300029911BogAAELIEGLRSHNIDHDVIMIPNEMHDLARYSSWMMLFNAADVYFDRHLDKRSAPVP
Ga0311362_1040941033300029913BogVPSQQAAELIEGLRSHNIDHDVIMIPNEMHDLARYSSWMMLFNAADVYFDRHLDKRSAPV
Ga0311352_1115802523300029944PalsaDVIMIPNEMHDLARYSSWMMLFNAANVYFDRHLDKRSAPVP
Ga0311371_1091732713300029951PalsaMIPNEIHDLARYSSWMMLFNAADAYFDRHLDKRSAPTP
Ga0302304_1017520113300029993PalsaADGVVPSQQAAELIEGLRSHNIDHDVIMIPNEMHDLARYSSWMMLFNAANVYFDRHLDKRSAPVP
Ga0311339_1053966713300029999PalsaDVIMIPNEMHDLARYSSWMMLFNAANMYFDRHLDKRSAPVP
Ga0311355_1083549813300030580PalsaSRNIDHDVIMIPNEIHVMVRYSSWMTLFNATDMYLDRHLDKRSVPTP
Ga0311356_1036134133300030617PalsaSHNIDHDVIMIPNEMHDLARYSSWMMLFNAANVYFDRHLDKRSAPVP
Ga0302311_1060577623300030739PalsaNEMHDLARYSSWMMLFNAADVYFDRHLDKRSAPVP
Ga0302312_1015778233300030746PalsaMIPNEIHDLARYSSWMTLFNAADVYFDRHLDKRSAPAP
Ga0302307_1026158023300031233PalsaIEDLRSRNIDHDVIMIPNEIHVMARYSSWMILFNATDVYFDRHLDKRSAPAP
Ga0302325_1141302713300031234PalsaEDLRSRNIDHDVIMIPNEIHVMARYSSWMILFNATDVYFDRHLDKRSAPAP
Ga0302324_10343397623300031236PalsaRSHNIDHDVIIIPNEIHDLARYSSWMILFDAADVYFDRHLVKRSAPAP
(restricted) Ga0255312_101678933300031248Sandy SoilIDHDVIMLPNEIHDMARYASWMLLFNAADVYFDRQLNKRSAPAP
Ga0318541_1086748023300031545SoilLRSHNIDHDVIMIPNEIHDLARYSSWMMLFNAADVYFERQLNKRSAPAPQAFPLPRF
Ga0318574_1070147813300031680SoilMIPNEIHDLARYSSWMMLFTAADVYFNRHLNKQTAPSPLAGSSL
Ga0310686_10051002433300031708SoilLRSHNIDHDVIMIPNEIHEMARYSSWMILFNAADVYFDRHLDKRSAPTP
Ga0310686_11250067533300031708SoilDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLGKRSAPAP
Ga0318502_1014263713300031747SoilNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0318502_1062809713300031747SoilIPNEIHDLARYSSWMMLFTAADVYFNRHLNKQTAPSPLAGSSL
Ga0307475_1120908813300031754Hardwood Forest SoilDVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPSP
Ga0318546_1019612413300031771SoilDIEHDVIMIPNEIHDLARYSSWMMLFTAADVYFNRHLNKQTAPAPLAGPSLRF
Ga0307478_1026550523300031823Hardwood Forest SoilVIMIPNEIHDMARYSSWMLLFKAADVYFDRHLDKRSVPAP
Ga0307478_1106488123300031823Hardwood Forest SoilNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPTP
Ga0306925_1047015913300031890SoilDVIMIPNEIHDMARYSSWMLLFNAAAVYFDRHLDQRSVPAR
Ga0306923_1254486313300031910SoilHDVIMIPNEIHDLARYSSWMMLFNAADVYFERQLNKRSAPAPQAFPLPRF
Ga0306921_1011407463300031912SoilLRSHDIEHDVIMIPNEIHDLARYSSWMMLFTAADVYFNRHLNKQTAPSPLAGSSL
Ga0310916_1048687023300031942SoilLRSHNIEHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRQLNKRSAPFL
Ga0308173_1043644413300032074SoilEHDVVMIPNEIHDLARYSSWMTLFNAADAYFDRQLNKLSTPTR
Ga0306924_1193962823300032076SoilMIPNEIHDMARYSSWMLLFNAADLYFARHLDKRNAPAP
Ga0307471_10000295713300032180Hardwood Forest SoilNEIHDMARYSSWMLLFNAADVYFDRHLDKRSVPAP
Ga0307472_10115288723300032205Hardwood Forest SoilHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP
Ga0335072_1098846623300032898SoilALIEDLRSHNIDHDLIVIPNEIHVMTRYSSWMMLFNAADVYLDRHLGKRSAPTP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.