NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F045189

Metagenome Family F045189

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045189
Family Type Metagenome
Number of Sequences 153
Average Sequence Length 53 residues
Representative Sequence SNPSFVTAITAAVLGVGVVLPANVPALVLSDAWRTSAPIPIAPVPKHVLLSVFLV
Number of Associated Samples 127
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.08 %
% of genes from short scaffolds (< 2000 bps) 94.12 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.039 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(26.797 % of family members)
Environment Ontology (ENVO) Unclassified
(28.758 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(37.908 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.12%    β-sheet: 0.00%    Coil/Unstructured: 69.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF00873ACR_tran 83.66
PF02321OEP 1.96
PF00512HisKA 1.31
PF02518HATPase_c 1.31
PF00072Response_reg 0.65
PF13115YtkA 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 3.92

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.04 %
UnclassifiedrootN/A1.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_106555974All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300001976|JGI24752J21851_1037481All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300002073|JGI24745J21846_1040806All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300002244|JGI24742J22300_10035815All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300004463|Ga0063356_104871117All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300005295|Ga0065707_10414760All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300005334|Ga0068869_101115385All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37691Open in IMG/M
3300005343|Ga0070687_100008144All Organisms → cellular organisms → Bacteria → Proteobacteria4419Open in IMG/M
3300005543|Ga0070672_101102160All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300005547|Ga0070693_100639760All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300005564|Ga0070664_100020522All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium5441Open in IMG/M
3300005617|Ga0068859_103133690All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300006196|Ga0075422_10048902All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1526Open in IMG/M
3300006237|Ga0097621_102151008All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300006845|Ga0075421_102315428All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300006845|Ga0075421_102418921All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37549Open in IMG/M
3300006846|Ga0075430_100648561All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300006846|Ga0075430_100854343All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300006846|Ga0075430_101585503All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300006853|Ga0075420_101839977All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300006894|Ga0079215_10216220All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300007004|Ga0079218_11379151All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300009094|Ga0111539_12641714All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300009147|Ga0114129_10310188All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-372100Open in IMG/M
3300009148|Ga0105243_10740723All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37962Open in IMG/M
3300009177|Ga0105248_12342412All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300009553|Ga0105249_13479582All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300009678|Ga0105252_10243296All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300009789|Ga0126307_11434062All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300009799|Ga0105075_1049290All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37540Open in IMG/M
3300009802|Ga0105073_1007517All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300009822|Ga0105066_1118758All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300009840|Ga0126313_11107671All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300010036|Ga0126305_11134420All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300010039|Ga0126309_11200752All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300010400|Ga0134122_12582093All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300010403|Ga0134123_12157445All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37618Open in IMG/M
3300010403|Ga0134123_12943707All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300011402|Ga0137356_1064105All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300011429|Ga0137455_1176313All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300012133|Ga0137329_1037242All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300012143|Ga0137354_1053064All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300012146|Ga0137322_1070394All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300012231|Ga0137465_1118378All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300012469|Ga0150984_121252628All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300012511|Ga0157332_1020500All Organisms → cellular organisms → Bacteria → Acidobacteria764Open in IMG/M
3300012882|Ga0157304_1027046All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300012883|Ga0157281_1047436All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300012891|Ga0157305_10118514All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300012891|Ga0157305_10188168All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300012897|Ga0157285_10141149All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300012898|Ga0157293_10344962All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012905|Ga0157296_10383919All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300012907|Ga0157283_10281665All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300012909|Ga0157290_10254559All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300012910|Ga0157308_10471281All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300012913|Ga0157298_10030462All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300012914|Ga0157297_10485142All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300012915|Ga0157302_10119199All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37858Open in IMG/M
3300012943|Ga0164241_10335387All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300012943|Ga0164241_10780605All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300012951|Ga0164300_10344514All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300012955|Ga0164298_10551344All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300012960|Ga0164301_11731994All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300012961|Ga0164302_11286881All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300012961|Ga0164302_11640858All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300012984|Ga0164309_11838618All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300012989|Ga0164305_11118872All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300013096|Ga0157307_1056862All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300013297|Ga0157378_10989022All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300013306|Ga0163162_13024943All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300013308|Ga0157375_12004572All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300013308|Ga0157375_12135039All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300013308|Ga0157375_13590484All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300013754|Ga0120183_1002626All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300014325|Ga0163163_13051698All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300014745|Ga0157377_10131310All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1530Open in IMG/M
3300014864|Ga0180068_1034484All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300015201|Ga0173478_10620587All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300015371|Ga0132258_11734969Not Available1574Open in IMG/M
3300015373|Ga0132257_102943443All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300015374|Ga0132255_104575641All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300017792|Ga0163161_10308504All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1248Open in IMG/M
3300018067|Ga0184611_1254771All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300018081|Ga0184625_10456864All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300018429|Ga0190272_12595455All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300018429|Ga0190272_13173712All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300018465|Ga0190269_10454196All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300018476|Ga0190274_13175827All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300019361|Ga0173482_10260162All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300019362|Ga0173479_10181542All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300019377|Ga0190264_10837456All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300019377|Ga0190264_12124365All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300025165|Ga0209108_10123304All Organisms → cellular organisms → Bacteria → Acidobacteria1382Open in IMG/M
3300025315|Ga0207697_10554223All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300025908|Ga0207643_10727814All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300025911|Ga0207654_10698079All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300025926|Ga0207659_10841779All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300025930|Ga0207701_11405181All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300025937|Ga0207669_11052356All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300025937|Ga0207669_11232349All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300025940|Ga0207691_10184164All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1824Open in IMG/M
3300025960|Ga0207651_10048871All Organisms → cellular organisms → Bacteria2862Open in IMG/M
3300025960|Ga0207651_11928372All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300025972|Ga0207668_11336194All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300026023|Ga0207677_10455004All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300026811|Ga0207529_101107All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300027866|Ga0209813_10321271All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300027909|Ga0209382_10742393All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300028592|Ga0247822_10403159All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300028592|Ga0247822_10459351All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300028802|Ga0307503_10801640All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300028885|Ga0307304_10311111All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37698Open in IMG/M
3300031200|Ga0307496_10126742All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300031538|Ga0310888_10136123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1294Open in IMG/M
3300031562|Ga0310886_10371565All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300031740|Ga0307468_100943228All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300031847|Ga0310907_10758236All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300031854|Ga0310904_11195888All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031858|Ga0310892_10310987All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300031892|Ga0310893_10423711All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300031892|Ga0310893_10557851All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300031903|Ga0307407_10439636All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300031903|Ga0307407_11221845All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300031908|Ga0310900_11406638All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300031913|Ga0310891_10265391All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300031939|Ga0308174_10221859All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1453Open in IMG/M
3300031940|Ga0310901_10520149All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300031940|Ga0310901_10521144All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300031943|Ga0310885_10833368All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300031944|Ga0310884_10029901All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2295Open in IMG/M
3300031944|Ga0310884_10377116All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300031944|Ga0310884_10435344All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300032000|Ga0310903_10517741All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300032000|Ga0310903_10842071All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300032005|Ga0307411_10311259All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300032013|Ga0310906_10273743All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300032013|Ga0310906_11002455All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300032122|Ga0310895_10415249All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300032144|Ga0315910_10057460All Organisms → cellular organisms → Bacteria2829Open in IMG/M
3300032144|Ga0315910_10101745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2111Open in IMG/M
3300032144|Ga0315910_10561169All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300032144|Ga0315910_11010897All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300032157|Ga0315912_11222926All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300032179|Ga0310889_10695513All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37530Open in IMG/M
3300032211|Ga0310896_10075527All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1442Open in IMG/M
3300032211|Ga0310896_10768148All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300033551|Ga0247830_10387499All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300034149|Ga0364929_0336123All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300034151|Ga0364935_0019108All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1830Open in IMG/M
3300034151|Ga0364935_0060878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371114Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil26.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil17.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.54%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.27%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.61%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.96%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.96%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.31%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.65%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.65%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.65%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.65%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300002073Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4Host-AssociatedOpen in IMG/M
3300002244Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1Host-AssociatedOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009799Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30EnvironmentalOpen in IMG/M
3300009802Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300012133Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2EnvironmentalOpen in IMG/M
3300012143Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2EnvironmentalOpen in IMG/M
3300012146Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2EnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013754Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014864Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10DEnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026811Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A4w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031200Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10655597423300000956SoilITSAVLGAPVVLPARVPASVLTDGWRTTAPISTGPVPKHVLLSVFLV*
JGI24752J21851_103748123300001976Corn, Switchgrass And Miscanthus RhizosphereNPPFVTAITAAVLGVGVVLPANVPALVLSDAWRTSAPLPIAPVPKHVLLSVFLV*
JGI24745J21846_104080613300002073Corn, Switchgrass And Miscanthus RhizosphereAEGQNSTQSNPPFVTAITAAVLGVGVVLPANVPALVLSDAWRTSAPLPIAPVPKHVLLSVFLV*
JGI24742J22300_1003581513300002244Corn, Switchgrass And Miscanthus RhizosphereNSTQSNPPFVTAITAAVLGVGVVLPANVPALVLSDAWRTSAPLPIAPVPKHVLLSVFLV*
Ga0063356_10487111713300004463Arabidopsis Thaliana RhizosphereEQSSPSTPTFANAISIAVLGPATVVLMIVPPLVLSDDWRTALPIPTAPVPRHVLLSVYLV
Ga0062594_10141589013300005093SoilASSEPDHSNQSAPTFGAVISSAVLGPGVVLPDTAPALMLSDAWRTVAPKPLGPVRTHVLLSVYLV*
Ga0065707_1041476013300005295Switchgrass RhizosphereVLGVGVALPANVPALVLSDAWRTSSPIPIAPVPKHVLLSVFLV*
Ga0068869_10111538523300005334Miscanthus RhizosphereCCASSEGKNSNLFSPTFVVAITAVLGDGIILPASVPSLVLSDGWRTSAPIPIEPVPKHVLLSVFLV*
Ga0070687_10000814413300005343Switchgrass RhizosphereSIVVISGAVLGPGVVVPETAPALVLSDAWRTAALIPRAPVPKHVLLSVFLV*
Ga0070672_10110216023300005543Miscanthus RhizosphereSEAQNSNQPNPSSVTAITAAVLGVGIVQPANVPALVLSDAWRTSAPIPVAPVPKHVLLSVFLV*
Ga0070693_10063976023300005547Corn, Switchgrass And Miscanthus RhizosphereAVLGPGVVVPETAPALVLSDAWRTAALIPLAPVPKHLLLSVFLV*
Ga0070664_10002052243300005564Corn RhizosphereSPTSIVVISGAVLGPGVVVPETAPALVLSDLWRTAALIPLAPVPKHVLLSVFLV*
Ga0068854_10096118323300005578Corn RhizosphereHNSNQSSPTSIVVISGAVLGPGVVVPETAPALVLSDAWRTAALIPLAPVPKHLLLSVFLV
Ga0068859_10313369023300005617Switchgrass RhizosphereVAALTAVLGAGIVVPANVPALVVSDGWRTSAPIPVAPVPKHVLLSLFLV*
Ga0075422_1004890213300006196Populus RhizosphereALGVGVVRPAIAPAFVLTDGWRTDAPPPGPPVSRHLLLSVFLV*
Ga0097621_10215100813300006237Miscanthus RhizosphereSNQSNPSFVTAITAAVLGVGVVLPANVPTLILSDAWRTSVPRPIAPVPRHVLLSVFLV*
Ga0075421_10231542823300006845Populus RhizosphereTLGAAISSAVLGAGIVVPLRVPALVLSDGWRTAVPIPIAPVPKHVLLSVFLV*
Ga0075421_10241892113300006845Populus RhizosphereAAITSAVLGTGIVIPATVPALVLSDGWRTVAPIPTTHVPKHVLLSVFLV*
Ga0075430_10064856123300006846Populus RhizosphereSNQSNPSFVTVITSAVLGVGVIVPASVPALVLSDAWRTSAPLPIAPVPKHVLLSVFLV*
Ga0075430_10085434313300006846Populus RhizosphereAISSAVLGAGVVVPAPVPALVASDAWRIVAPIPIAPVPRHVLLSVFLV*
Ga0075430_10158550323300006846Populus RhizosphereFAAALSFAVLGPGVVLPPSVPALVLSDGWRTILPIPATPVPRHVLLSVFLV*
Ga0075420_10183997723300006853Populus RhizosphereDPQVPTFAAALSFAVLGPGVVLPPSVPALVLSDGWRTILPIPATPVPRHVLLSVFLV*
Ga0079215_1021622023300006894Agricultural SoilCCAASEPENSSQPGPTFVAATTAAVLGVGVVLPADVPALVLSNSWRRSAPIPVAPVPKHVLLSVFLV*
Ga0079218_1137915113300007004Agricultural SoilNQFSPTFVAAITASVLGAGIVLPTNVPTLVLSDGWRASAPIPVAPVPKHVLLSVFLI*
Ga0111539_1264171413300009094Populus RhizosphereGVGVVMPADVPALVLSDAWRTSAPIPSTPVPKHVLLSVFLV*
Ga0114129_1031018823300009147Populus RhizosphereLVTVITAAVLGVGVVLPADVPALVLSDAWRRSVPIRVAPVPKYVLLSVFLV*
Ga0105243_1074072323300009148Miscanthus RhizosphereMTAITAAVLGVGVVLPARVPALVLSDAWRTSAPIPIAPVPKHVLLSVFLV*
Ga0105248_1234241223300009177Switchgrass RhizosphereLGVGVVLPANVPALVLSDAWRTSAPIPIAAVPKHVLLSVFLV*
Ga0105249_1347958223300009553Switchgrass RhizosphereGATTALPANVPALVLSDGWRTSAPIPIAPVPRHVLLSVFLV*
Ga0105252_1024329613300009678SoilSNTTAVTAITVAVLGVGIVMPADVPALVLSDAWRTSAPIPSAPVPKHVLLSVFLV*
Ga0126307_1143406213300009789Serpentine SoilVVAISSAVLGSGVTLPASVPALVLSDSWRTAAPVPVAPVPKHVLLSVFLV*
Ga0105075_104929013300009799Groundwater SandTGIALPATVPALVLSDGWRTVAPIQTTHVPKHVLLSVFLV*
Ga0105073_100751713300009802Groundwater SandAAVLGVGVVLPANVPALVVSDAWRTLAPIPIAPVPKHVLLSVFLV*
Ga0105066_111875823300009822Groundwater SandSNPSFVTAITAAVLGVGVVLPANVPALVLSDAWRTSAPIPIAPVPKHVLLSVFLV*
Ga0126313_1110767123300009840Serpentine SoilPPVSHAITAAVLGVATVLPASVPALVLSDAWRTSAPLPVISVPKHVLLSVFLV*
Ga0126305_1113442013300010036Serpentine SoilPTFVAAITAAVLGVAVVLPANVPALVLSDAWRTSAPLPVAPVPKHVLLSVFLV*
Ga0126309_1120075223300010039Serpentine SoilVITAAVLGVAVVLHLNVPALVLSDAWRTSAPIPVAPPPKHVFLSVFLV*
Ga0134122_1258209323300010400Terrestrial SoilAITAAVLGVGVVLPANVPTLVLTDAWRTSAPIPIAPVPKHVLLSVFLV*
Ga0134123_1215744523300010403Terrestrial SoilCASSEGKNSNLFSPTFVVAITAVLGDGIILPASVPSLVLSDGWRTSAPIPIEPVPKHVLLSVFLV*
Ga0134123_1294370713300010403Terrestrial SoilRKSNQSNPSFVTAITAAVLGVGVVLPANVPALVLSDAWRTSAPIPIAPVPKHVLLSVFLV
Ga0137356_106410513300011402SoilEGNTPNHPSPTFVAAITAAVLGAGTVLPVNVPALVLSDRWRNSAPIPIEPVPKHILLSVFLV*
Ga0137455_117631323300011429SoilSSESKNSSQSSPTSVAAITAAVLGVGIVLPVNVPALVLSDAWRTSAPIPIASVSKHVLLSVFLV*
Ga0137329_103724213300012133SoilPNLTFVAAISSAVLGSRVVVPANVPAFVLSDGWRSSMPIPTAPPPKHLLLSVFLV*
Ga0137354_105306423300012143SoilAITAAVLGAGIVVPASVPALVLSDAWRTSAPIPIAPVPRHVLLSVFLV*
Ga0137322_107039423300012146SoilVTAITAAVLGVGVVMPANVPALVLSDAWRTSSPIPIGLVPKHVLLSVFLV*
Ga0137465_111837813300012231SoilPSFVTAITAAVLGVGVVMPANVPALVLSDAWRTFAPIPIAPVPKHVLLSVFLV*
Ga0150984_12125262813300012469Avena Fatua RhizosphereSQSTPSFVTAITAAVLGVGVVVPANVPALVLSDAWRTSAPIPVPPVPKHVLLSVFLV*
Ga0157332_102050023300012511SoilSAVLGAGVVLPAVAPALVLSDGWRTVAPIPTAHVPKHVLLSVFLV*
Ga0157304_102704623300012882SoilAAVLGVGVVLPVSVPALVLSDAWRTSTPIPIAPVPKHVLLSVFLI*
Ga0157281_104743613300012883SoilVVAATTVAVLGDGIVLPANIPALVLSDGWRTLAPLPVSPVPKHILLTVFLV*
Ga0157305_1011851413300012891SoilAFTAVRGDGIILPANVPALVLSDGWRTSAPIHIEPVPKHVLLSVFLV*
Ga0157305_1018816823300012891SoilFVPAITAMVLGVGIVLPANVPALVRNDAWRTSAPIPVAPVPKHVLLSVFLV*
Ga0157285_1014114913300012897SoilNPTFVAAITAAVLGDGIIFPANVPALVLSDEWRVSAPIPLAPVPKHVLLSVFLV*
Ga0157293_1034496213300012898SoilNPSLVTAINSSVLGVGVVLPVSVPALVLSDAWRRSAPIPLAPVPKHVLLSVFLV*
Ga0157296_1038391913300012905SoilITAAVLGVGAVLPANVPALVLSDARRSSTPIPTAPVPRHILLSVFLV*
Ga0157283_1028166513300012907SoilSTPTFVSAISVAVLGPGIVLPVSVPALVLSDDWRTCSPIPTLPVPKYVLLSVFLV*
Ga0157290_1025455923300012909SoilASAEGQRSNQSNPSFVTAITVAVLGIGVVLPANVSALVLRDAWRRSAPIPIAPVPRHVLLSVFLV*
Ga0157308_1047128113300012910SoilAEGQNSNQSNPSFVTAITAAVLGVGVVLPANVPALVLSDGWRPAAPTRPGPVPRHVLLSVFLV*
Ga0157298_1003046213300012913SoilERESSNQANPSFVTAITAAVLGAWIVLPVDVPGLVLSDGWRPTAPTRAGPVPKHVLLSVFLV*
Ga0157297_1048514223300012914SoilVLGVGVVLPPNVPALVLSDAWRTSTPIPIAPVPKHVLLSVFLV*
Ga0157302_1011919913300012915SoilCAASEGKTSNQSNPTFVAAISVAVLGAGTVLPANVPALVLSDGWRTSAPMPVAPVPKHVLLSVFLV*
Ga0164241_1033538723300012943SoilPTFVAAITAAVLGDGIILPAIVPALILSGRISAPIPVEPVPKHVLLSVFLV*
Ga0164241_1078060523300012943SoilNSNQSNPSFVTAITAAVLGVGVVLPANVPALVLSDAWRTSAPIPVAPVPKHVLLSVFLV*
Ga0164300_1034451423300012951SoilASAEGQHSNQSHPSFVTAITAAVLGVGVVLPANIPALVLSDAWRTSAPIPIASVPKHLLLSVFLV*
Ga0164298_1055134423300012955SoilSSERKNSNQSNPTFVTAITAAVLGVGVVLPANVPALVLSDAWRTSAPIPITPVPKHVLLSVFLV*
Ga0164301_1173199413300012960SoilNQSSPTFVAAITAAVLGAGTALPANVPALVLSDAWRTSAPIPIAPVPKHVLLSVFLV*
Ga0164302_1128688113300012961SoilAVLGAGVVLPANVPALVLSDAWRASAPIPIAPVPKHVLLSVFLV*
Ga0164302_1164085823300012961SoilNSNQSNPSFVAAITMAVLGAGVVVPANVPALVLSDAWRTSAPIPTAPVPKHVLLSVFLV*
Ga0164309_1183861823300012984SoilSNPTFVTAITAAVLGVGVVLPADVPALVLSDAWRTSAPIPIAPVPKHLLLSVFLV*
Ga0164305_1111887213300012989SoilQNSSQSSPSFGTAITAAVLGVGVVLPANVPALVLSDAWRTSAPIPIGPVPKHVLLSVFLV
Ga0157307_105686213300013096SoilTFVAAITAAVLGDGIIFPANVPALVLSDEWRVSAPIPLAPVPKHVLLSVFLV*
Ga0157378_1098902223300013297Miscanthus RhizosphereIPTSATAITAAVLGVGVVLPANVPALVLSDAWRTSAPIPIAPVPKHVLLSIFLV*
Ga0163162_1302494313300013306Switchgrass RhizosphereTAAVLGVGVVLPANVPALVLSDSWRISAPIPIAPVPKHVLLSVFLV*
Ga0157375_1200457213300013308Miscanthus RhizosphereAEGKSSNQSSPTVVAATTVAVLGDGIVLPANIPALVLSDGWRTLAPLPVSPVPKHILLTVFLV*
Ga0157375_1213503923300013308Miscanthus RhizospherePSTPTFVAAISVAVLGSGMVMPASLPTLTLSSDWRTFSPIRTPPVSRHVLLSVFLI*
Ga0157375_1359048423300013308Miscanthus RhizospherePAPFPALVAADAWRTVAPVPIAHVPRYVLFSVFLV*
Ga0120183_100262623300013754TerrestrialAITAAVLGVGMVLPASVPALVLSDVWRTSAPIPIAPVPKHVLLSVFLV*
Ga0163163_1305169823300014325Switchgrass RhizosphereVLPANVPALVLSDAWRTSAPIPIAPVPKHVLFSVFLV*
Ga0157377_1013131013300014745Miscanthus RhizosphereNSNQSNPSFVTAITAAVLGVGVVLPANVPALVLSDAWRTSAPIPIAPVPKHVLLSVFLV*
Ga0180068_103448423300014864SoilGQHSNRSNPSFVTAITAAVLGVGVVLPANVPALVLSEAWRTSAPIPIAPVPKHVLLSVFIL*
Ga0173478_1062058723300015201SoilQSNTTAVTAITVAVLGVGIVMPADVPALVLSDAWRTSAPIPSAPVPKHLLLSVFLV*
Ga0132258_1173496923300015371Arabidopsis RhizosphereCASSEGKNSNLFSLTFVAAITAVLDHGIILPANVPALVLSDGWRISAPIPIEPVPKHVLLSVFLV*
Ga0132257_10294344323300015373Arabidopsis RhizosphereNPSFVTAITGAVLGVGVLLPANVPALVLSDAWRTSAPMPVAAVPKHVLLSTFLV*
Ga0132255_10457564113300015374Arabidopsis RhizosphereNQSNPSFVTAITAAVLGVGVVLPANVPALVLRDAWRTSAPIPIAPVPKHVLLSVFLV*
Ga0163161_1030850423300017792Switchgrass RhizosphereLGPGVVVPETAPALVLSDAWRTAALIPLAPVPKHLLLSVFLV
Ga0184611_125477123300018067Groundwater SedimentSPTFAPAITAAVLGAGIVLPADVPALVLSDGWRTSAPRRVAPVPKHVLLSVFLV
Ga0184625_1045686413300018081Groundwater SedimentSERENSNQPNLTFVAAISSAVLGSGVVVPAHIPAFVLSDGWRSSMPIPIAPPPKHLLLSVFLV
Ga0190272_1259545513300018429SoilNPSFVTAITAAVLGVGVVLPANVPALVLSDAWRTSAPIPIGLVPKHLLLSVFLV
Ga0190272_1317371213300018429SoilRSSNQSKPSLATAITAAVLGVGVVLPANLDALVRRDAWRRSAPIPLAPVPRHVLLSVFLV
Ga0190269_1045419623300018465SoilLGAGTILPASVPALVLTDGWRTSAPMPVRAIPKRLLLSVFLL
Ga0190274_1317582723300018476SoilVTAITAAVLGVRVLLPVNVPALVLSDACRRSAPIPIASVPKHVLLSVFLV
Ga0173482_1026016223300019361SoilSSEGKNSNQFSPTFIAAITAVLGDGIILPAKVSALVLSDGWRTSAPMPVAPVPKHVLLSVFLV
Ga0173479_1018154213300019362SoilITAAVLGAGIAFPAYVPALVLSDGWRTSAPRRVAPVPKHLLLSVFLV
Ga0190264_1083745613300019377SoilVLGVGVILPAKVPALVLSDAWRTSAPIPIAPVPKHVLLSVYLV
Ga0190264_1212436513300019377SoilITSAVLGPAIVLPPTVPTLVLTDGWRTAAPTPTPPVPKHVLLSVFLV
Ga0209108_1012330423300025165SoilFAAAISSAVLGAGIALPATVPALVLSDGWRTVSPIPTAHVPKHVLLSVFLV
Ga0207697_1055422313300025315Corn, Switchgrass And Miscanthus RhizosphereTSKQSSPTFVAAITAAVLGAGTVLPANVPALVLSDGWRTSAPIPVAPVPKHVLLSVFLV
Ga0207643_1072781423300025908Miscanthus RhizosphereGKSSNQSSPTVVAATTVAVLGDGIVLPANIPALVLSDGWRTSTPIPVSPVPKHILLTVFL
Ga0207654_1069807923300025911Corn RhizosphereAVLGVGVVLPANVPTLVLTDAWRTSAPIPIAPVPKHVLLSVFLV
Ga0207659_1084177923300025926Miscanthus RhizosphereILPVNVPALVLSDGWRTSAPIPIEPVPKHVLLSVFLV
Ga0207701_1140518123300025930Corn, Switchgrass And Miscanthus RhizosphereVVTAVTAAVLGVGVVLPASVPALVLSDAWRLSAPIPIALVPKHVLLSVFLV
Ga0207669_1105235613300025937Miscanthus RhizosphereNSNLFSPTFVVAITAVLGDGIILPASVPSLVLSDGWRTSAPIPIEPVPKHVLLSVFLV
Ga0207669_1123234923300025937Miscanthus RhizosphereGQNSTQSNPPFVTAITAAVLGVGVVLPANVPALVLSDAWRTSAPLPIAPVPKHVLLSVFL
Ga0207691_1018416423300025940Miscanthus RhizosphereCCASSEAQNSNQPNPSSVTAITAAVLGVGIVQPANVPALVLSDAWRTSAPIPVAPVPKHVLLSVFLV
Ga0207651_1004887113300025960Switchgrass RhizosphereVVPETAPALVLSDLWRTAALIPLAPVPKHVLLSVFLV
Ga0207651_1192837223300025960Switchgrass RhizosphereVTAAVLGVGVVLPASVPALVLSDAWRLSAPIPIALVPKHVLLSVFLV
Ga0207668_1133619413300025972Switchgrass RhizosphereEGQNSNQSSPSFVTAITAAVLGVGVVLPANAPALVLSDAWRTSAPIPIAPVPKHVLLSVFLV
Ga0207677_1045500423300026023Miscanthus RhizosphereQSSPTSIVVISGAVLGPGVVVPETAPALVLSDAWRTAALIPLAPVPKHVLLSVFLV
Ga0207529_10110733300026811SoilLGVGVVLPANVPALVLSDAWRTSAPMPIAPVPKHVLLSVFLV
Ga0209813_1032127123300027866Populus EndosphereSNPSIVVTISNVVLGEAVVIPSPIPSLVLSDHWRTAVPIPAAPVARHVLLSVFLV
Ga0209382_1074239323300027909Populus RhizosphereVGTVLPARVPALVLSDAWRTSVPIAIAQTPKHVLLSVFLV
Ga0247822_1040315913300028592SoilVGVVLPPSIPARVLSDGWRTPVPTPIAGVPKHVLLSVFLV
Ga0247822_1045935123300028592SoilSNPTFAPAITAAVLGAGIVFPADVPALVLSDGWRTSAPRRVAPVPKHVLLSVILV
Ga0307503_1080164023300028802SoilASSQGQHSNQSNPSFVTAITAAVLGVAIVRPVNISALVLSDAWRTSAPIPLAPVPKHVLLSVFLV
Ga0307304_1031111123300028885SoilVTAITAAVLAVGVVLPANVPALVLSDAWRTSAPIPIAPVPKHVLLSVFLV
Ga0307496_1012674223300031200SoilSNQSHPSFVTAITSAVLGVGVVLPANIPALVLSDAWRTLAPIPIAPVPKHVLLTVFLV
Ga0310888_1013612313300031538SoilDQSNPAFAPAITAAVLGAGIVFPADVPALVLSDGWRTSAPRRVAPVPKHVLLSVFLV
Ga0310886_1037156513300031562SoilVTAITAAVLGVGVGLPANVPALVLSDGWRPAAPTRPGPVPRHVLLSVFLV
Ga0307468_10094322823300031740Hardwood Forest SoilNPSFVTAVTAAVLGVGVVLPANVPTLVRRDAWRRLAPIPIAAVPRHVLLSVFLV
Ga0310907_1075823623300031847SoilSSPTFVAAITAAVLGAGTVLPANVPALVLSDGWRTSAPIPVAPVPKHVLLSVFLV
Ga0310904_1119588823300031854SoilAVLGPGVVVPVTVPALVLSDAWRASAPLPTTPIPKYVLLSVFLV
Ga0310892_1031098713300031858SoilLGPGIVLPVSVPALVLSDDWRTYSPIPTPPVPKYVLLSVFLV
Ga0310893_1042371113300031892SoilGVVVDVSVPTLVLTDGWRTTVPIPIAAVPRHVLLSVFLV
Ga0310893_1055785113300031892SoilRTSDQSNPAFAPAITAAVLGAGIVLPADVPALVLSDGWRTSAPRRVAPVPKHVLLSVFLV
Ga0307407_1043963623300031903RhizosphereAAAEGQNSNQSSPSFVTAITAAVLGVGVVQPGDVPALVLSDAWRASAPIPIAPVPRHVLLSVFLV
Ga0307407_1122184513300031903RhizosphereEGQHSNQSNPSFVTAITAAVLGVGVVLPANVPALVLSDAWRTSAPIPIAPVPKHVLLSVFLV
Ga0310900_1140663813300031908SoilSNQSNPSFVTAITFAVLGAGVVLPANVPALVLSDGWRTSTPISIASVPRHVLLSVFLV
Ga0310891_1026539113300031913SoilREKSSPSSPAFVAAISAAILGAGVVVDVSVPTLVLTDGWRTTVPIPIAAVPRHVLLSVFL
Ga0308174_1022185923300031939SoilVLPRMVPALVLSDAWRTVSPLPTAAVPKHLLLSVFLV
Ga0310901_1052014923300031940SoilNSNQSNPSSVTAITAAVLGAGVVLPANIPALVLSDAWRTSAPIPIARVPKHVLLSVFLV
Ga0310901_1052114413300031940SoilFVSAISVAVLGPGIVLPVSVPALVLSDDWRTYSPIPTPPVPKYVLLSVFLV
Ga0310885_1083336813300031943SoilGQTSKQSSPTFVAAITAAVLGAGTVLPANVPALVLSDGWRTSAPIPVAPVPKHVLLSVFL
Ga0310884_1002990123300031944SoilFVTAITAAVLGVGVVLPANVPALVLSDAWRTSAPIPIAPVARHVLLSVFLV
Ga0310884_1037711613300031944SoilFVVVISAAVLGPGVVVPVTSPALVLSDAWRTVSPIPTAPVPKHILLSVFLV
Ga0310884_1043534413300031944SoilSSPTFVVVISNAVLGPGVVVPVTVPALVLSDAWRTSAPLPTAPIPKYVLLSVFLI
Ga0310903_1051774123300032000SoilVAVLGPGIVLPVSVPALVLSDDWRTYSPIPTPPVPKYVLLSVFLV
Ga0310903_1084207123300032000SoilVVAITAAVLGAGIVLPASVPALVLSDGWRTSAPTPGAAVPKHVLLSVFLV
Ga0307411_1031125913300032005RhizosphereAPTAISAAVLGVAVVLPVITPALVLTDGWRTETPAPSPPVPRHVLLSVFLL
Ga0310906_1027374323300032013SoilEGQNSNKSNPSFVTAVTAAVLGVGVVLPANVPALVLSDAWRASVPLPVAPVPRHVLLSVFLV
Ga0310906_1100245513300032013SoilNQPNPSSVTAITAAVLGVGIVQPANVPALVLSDAWRTSAPIPVAPVPKHVLLSVFLV
Ga0310895_1041524923300032122SoilQSNPTFAPAITAAVLGAGIVLPADVPALVLSDGWRTSAPRRVAPVPKHVLLSVFLV
Ga0315910_1005746033300032144SoilLGTGTVLPALVPALVLSDGWRTVAPILSPPVPRHLLLSVFLV
Ga0315910_1010174513300032144SoilCCAAAEGQNSNQSNPSFVTVISAAVLGAGVVLPAVVPALVLSDGWRASVPIPIAPVPRHVLLSVFLV
Ga0315910_1056116923300032144SoilVLPANVPAIVLSDAWRTSAPIPDASVPKHLLLSVFLV
Ga0315910_1101089713300032144SoilVAAISNAVLGTGIALPAPVPALVLSDGWRTAAPVPTAHVPKHVLLSVFLV
Ga0315912_1122292613300032157SoilPSSVTAITAAVLGVGVVLPANVPALVLSDAWRTSAPIPIAPVPKYVLLSVFLV
Ga0310889_1069551313300032179SoilKSSESSPTFVAAVPSAVLGAGVVLPAVAPALVLSDGWRTVAPIPTAHVPKHVLLSVFLV
Ga0310896_1007552713300032211SoilQNSNQPNPSSVTAITAAVLGVGIVQPANVPALVLSDAWRTSAPIPVAPVPKHVLLSVFLV
Ga0310896_1076814823300032211SoilKNSNQSSPTFVVAITAAVLGAGIVLPASVPALVLSDGWRTSAPTPGAAVPKHVLLSVFLV
Ga0247830_1038749923300033551SoilVLPANVPALVLSDAWRTSAPIPVAPVPKHVLLSVFLV
Ga0364929_0336123_1_1893300034149SedimentERKHSDPSSPASVTAITSAVLGVGNVLPARVPAFTLSDFWRTAAPIPIGAVPKHVLFSVFLV
Ga0364935_0019108_1690_18303300034151SedimentTAAVLGVGMVLPAKVPALVLSDAWRTSAPIPIAPVPKHVLLSVFIL
Ga0364935_0060878_205_3573300034151SedimentVPPITAAVLGVGVVLLPYVPPLVLNDAWRRSAPIPIAPVPKHVLLSVFLV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.