NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F045185

Metagenome Family F045185

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045185
Family Type Metagenome
Number of Sequences 153
Average Sequence Length 53 residues
Representative Sequence DGVQPLVPRGDGKFGIGDPEAPDWVSFESIVDGRAMRLNFSGIIFRRVFTP
Number of Associated Samples 120
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.96 %
% of genes near scaffold ends (potentially truncated) 96.73 %
% of genes from short scaffolds (< 2000 bps) 89.54 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.850 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(11.765 % of family members)
Environment Ontology (ENVO) Unclassified
(45.752 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(73.856 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 29.11%    Coil/Unstructured: 70.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF13360PQQ_2 7.19
PF12681Glyoxalase_2 5.88
PF00463ICL 3.27
PF01797Y1_Tnp 1.96
PF13576Pentapeptide_3 1.96
PF04264YceI 1.96
PF02371Transposase_20 1.31
PF02698DUF218 1.31
PF13570PQQ_3 1.31
PF08241Methyltransf_11 1.31
PF13180PDZ_2 0.65
PF13207AAA_17 0.65
PF02348CTP_transf_3 0.65
PF02457DAC 0.65
PF00005ABC_tran 0.65
PF05977MFS_3 0.65
PF03781FGE-sulfatase 0.65
PF13476AAA_23 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG2224Isocitrate lyaseEnergy production and conversion [C] 3.27
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 1.96
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 1.96
COG1434Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 familyCell wall/membrane/envelope biogenesis [M] 1.31
COG2949Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycinCell wall/membrane/envelope biogenesis [M] 1.31
COG3547TransposaseMobilome: prophages, transposons [X] 1.31
COG1083CMP-N-acetylneuraminic acid synthetase, NeuA/PseF familyCell wall/membrane/envelope biogenesis [M] 0.65
COG1212CMP-2-keto-3-deoxyoctulosonic acid synthetaseCell wall/membrane/envelope biogenesis [M] 0.65
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.65
COG1861Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase familyCell wall/membrane/envelope biogenesis [M] 0.65
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.85 %
UnclassifiedrootN/A9.15 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2001200001|2001213063All Organisms → cellular organisms → Bacteria → Acidobacteria1564Open in IMG/M
3300000956|JGI10216J12902_117813770All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300001139|JGI10220J13317_10478688Not Available554Open in IMG/M
3300001904|JGI24736J21556_1047281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300003267|soilL1_10060815All Organisms → cellular organisms → Bacteria5092Open in IMG/M
3300003324|soilH2_10165971All Organisms → cellular organisms → Bacteria1979Open in IMG/M
3300004114|Ga0062593_100741503All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium966Open in IMG/M
3300004157|Ga0062590_100474439All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1056Open in IMG/M
3300004479|Ga0062595_102136448All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans546Open in IMG/M
3300005093|Ga0062594_102459365All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300005290|Ga0065712_10262064All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300005293|Ga0065715_10768400All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300005293|Ga0065715_10898385All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300005294|Ga0065705_10011465All Organisms → cellular organisms → Bacteria3575Open in IMG/M
3300005295|Ga0065707_10522999All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300005328|Ga0070676_10090537All Organisms → cellular organisms → Bacteria1873Open in IMG/M
3300005328|Ga0070676_10447027All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300005330|Ga0070690_100053672All Organisms → cellular organisms → Bacteria2578Open in IMG/M
3300005331|Ga0070670_101010414All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium756Open in IMG/M
3300005334|Ga0068869_101084924All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300005338|Ga0068868_100143870All Organisms → cellular organisms → Bacteria1959Open in IMG/M
3300005340|Ga0070689_100559171All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium986Open in IMG/M
3300005345|Ga0070692_10242050Not Available1076Open in IMG/M
3300005345|Ga0070692_11014952All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300005345|Ga0070692_11182160All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005355|Ga0070671_100831020All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium805Open in IMG/M
3300005364|Ga0070673_101601951All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300005364|Ga0070673_101639451Not Available608Open in IMG/M
3300005406|Ga0070703_10358841All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans624Open in IMG/M
3300005438|Ga0070701_10284527All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300005444|Ga0070694_100069376All Organisms → cellular organisms → Bacteria → Acidobacteria2425Open in IMG/M
3300005444|Ga0070694_100946972All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium713Open in IMG/M
3300005444|Ga0070694_101147105All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300005444|Ga0070694_101692160All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300005457|Ga0070662_100086069All Organisms → cellular organisms → Bacteria2350Open in IMG/M
3300005459|Ga0068867_100091766All Organisms → cellular organisms → Bacteria2306Open in IMG/M
3300005459|Ga0068867_100284700All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1357Open in IMG/M
3300005459|Ga0068867_101089784All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300005530|Ga0070679_100356526All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300005539|Ga0068853_100670804All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300005544|Ga0070686_100085042All Organisms → cellular organisms → Bacteria2103Open in IMG/M
3300005545|Ga0070695_100176727All Organisms → cellular organisms → Bacteria1510Open in IMG/M
3300005545|Ga0070695_100664584All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300005547|Ga0070693_100043240All Organisms → cellular organisms → Bacteria2543Open in IMG/M
3300005547|Ga0070693_101064702All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300005547|Ga0070693_101195806Not Available584Open in IMG/M
3300005547|Ga0070693_101346954All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005548|Ga0070665_101431087All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300005549|Ga0070704_101549839All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300005564|Ga0070664_100325669All Organisms → cellular organisms → Bacteria → Acidobacteria1393Open in IMG/M
3300005578|Ga0068854_101638731All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300005617|Ga0068859_100864645All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium990Open in IMG/M
3300005617|Ga0068859_101000663All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300005618|Ga0068864_100291446Not Available1526Open in IMG/M
3300005618|Ga0068864_102650774All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005841|Ga0068863_100140372All Organisms → cellular organisms → Bacteria2309Open in IMG/M
3300005841|Ga0068863_100497986All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1200Open in IMG/M
3300005841|Ga0068863_100810354All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300005841|Ga0068863_101027366All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium827Open in IMG/M
3300005843|Ga0068860_100449590All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1281Open in IMG/M
3300005843|Ga0068860_102607822All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300005844|Ga0068862_102044700All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300005844|Ga0068862_102422992All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005888|Ga0075289_1005033All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae1684Open in IMG/M
3300006049|Ga0075417_10638979All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300006196|Ga0075422_10237130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria762Open in IMG/M
3300006755|Ga0079222_11821228All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300006804|Ga0079221_10094510All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1454Open in IMG/M
3300006806|Ga0079220_10956705All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium673Open in IMG/M
3300006806|Ga0079220_11849201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans534Open in IMG/M
3300006844|Ga0075428_100628670All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300006847|Ga0075431_101690170All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300006854|Ga0075425_103064985All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300006876|Ga0079217_10675723All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300006880|Ga0075429_101034200All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium718Open in IMG/M
3300006918|Ga0079216_10001897All Organisms → cellular organisms → Bacteria5790Open in IMG/M
3300006954|Ga0079219_10060090All Organisms → cellular organisms → Bacteria1685Open in IMG/M
3300006969|Ga0075419_11270218All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300009147|Ga0114129_12730092All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300009147|Ga0114129_12936632All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300009156|Ga0111538_12220375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium690Open in IMG/M
3300009162|Ga0075423_10698952Not Available1070Open in IMG/M
3300009162|Ga0075423_11911756All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300009162|Ga0075423_12263275All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300009174|Ga0105241_10882870All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium829Open in IMG/M
3300009174|Ga0105241_11376658All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300009177|Ga0105248_11299535All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium823Open in IMG/M
3300009177|Ga0105248_13102846All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300009553|Ga0105249_10647233All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300009789|Ga0126307_10486820Not Available995Open in IMG/M
3300010037|Ga0126304_10052802All Organisms → cellular organisms → Bacteria2474Open in IMG/M
3300010040|Ga0126308_10638268All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium728Open in IMG/M
3300010041|Ga0126312_10959930All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300010371|Ga0134125_12970969Not Available514Open in IMG/M
3300010375|Ga0105239_12007053All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300010397|Ga0134124_10302909All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1490Open in IMG/M
3300010397|Ga0134124_11072057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium821Open in IMG/M
3300010399|Ga0134127_13320119All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300010401|Ga0134121_12675061All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans543Open in IMG/M
3300010403|Ga0134123_10778208All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium947Open in IMG/M
3300010403|Ga0134123_10880774All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium899Open in IMG/M
3300012948|Ga0126375_10868192All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium722Open in IMG/M
3300012958|Ga0164299_11353643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans547Open in IMG/M
3300013102|Ga0157371_10596184All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium822Open in IMG/M
3300013306|Ga0163162_11211393All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium857Open in IMG/M
3300013307|Ga0157372_13096618All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300013308|Ga0157375_10748139All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300013754|Ga0120183_1007621All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300014325|Ga0163163_10343717All Organisms → cellular organisms → Bacteria1548Open in IMG/M
3300014745|Ga0157377_11051844Not Available620Open in IMG/M
3300014968|Ga0157379_10624117Not Available1007Open in IMG/M
3300015372|Ga0132256_100323434All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales1631Open in IMG/M
3300015373|Ga0132257_100640894All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1316Open in IMG/M
3300018422|Ga0190265_11993218All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium686Open in IMG/M
3300018469|Ga0190270_11298760All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium770Open in IMG/M
3300024325|Ga0247678_1054902All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300025885|Ga0207653_10267473Not Available658Open in IMG/M
3300025899|Ga0207642_10770445All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300025899|Ga0207642_11118099All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300025901|Ga0207688_10709810All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300025911|Ga0207654_11300347All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300025917|Ga0207660_11165157All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300025918|Ga0207662_11187163Not Available542Open in IMG/M
3300025921|Ga0207652_10407996All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1226Open in IMG/M
3300025922|Ga0207646_10106779All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales2511Open in IMG/M
3300025926|Ga0207659_11641844All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300025927|Ga0207687_10162824All Organisms → cellular organisms → Bacteria1714Open in IMG/M
3300025930|Ga0207701_10064731All Organisms → cellular organisms → Bacteria3328Open in IMG/M
3300025931|Ga0207644_10129630All Organisms → cellular organisms → Bacteria1929Open in IMG/M
3300025938|Ga0207704_11122760All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300025940|Ga0207691_10009892All Organisms → cellular organisms → Bacteria9154Open in IMG/M
3300025945|Ga0207679_11922104Not Available539Open in IMG/M
3300025961|Ga0207712_10027433All Organisms → cellular organisms → Bacteria3803Open in IMG/M
3300025961|Ga0207712_11226848All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans669Open in IMG/M
3300025981|Ga0207640_10794235All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium819Open in IMG/M
3300026041|Ga0207639_10672303All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium959Open in IMG/M
3300026078|Ga0207702_12529421All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300026088|Ga0207641_10346828All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1414Open in IMG/M
3300026088|Ga0207641_12203323All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300026095|Ga0207676_11540566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300026116|Ga0207674_10498799All Organisms → cellular organisms → Bacteria → Proteobacteria1176Open in IMG/M
3300027873|Ga0209814_10048288All Organisms → cellular organisms → Bacteria1775Open in IMG/M
3300028380|Ga0268265_10033429All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3739Open in IMG/M
3300028380|Ga0268265_12283965All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans548Open in IMG/M
3300028381|Ga0268264_10442408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1258Open in IMG/M
3300030496|Ga0268240_10153553All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans569Open in IMG/M
3300031852|Ga0307410_11249601All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300031892|Ga0310893_10307703Not Available673Open in IMG/M
3300031908|Ga0310900_10724275All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300031911|Ga0307412_10184571All Organisms → cellular organisms → Bacteria1572Open in IMG/M
3300032004|Ga0307414_11514025All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300032005|Ga0307411_10596493All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium949Open in IMG/M
3300033412|Ga0310810_10705740All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium937Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere11.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.15%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.23%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.58%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.58%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.61%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.61%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.61%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.31%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.65%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.65%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.65%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2001200001Soil microbial communities from Waseca County, Minnesota, USA - Sample 10150EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300001904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2Host-AssociatedOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013754Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
20012301232001200001SoilMRVVLRKGQLFVEGVQPLVPRGDGKFGVGDPEGPDWITFETIVEGRAMRLNFSGIIFRRVFTP
JGI10216J12902_11781377023300000956SoilPLVPRGDGKFGLNDPEGPDWITFESNINGKAMRMNLSGVVFRRSFTP*
JGI10220J13317_1047868813300001139SoilLVPRSDGKFGIGDSEGPDWMSFESIVDGRAMVLSHSGILFRRMFTP*
JGI24736J21556_104728123300001904Corn RhizosphereGLGDPDGPDWISFQSIVDGRAMRLNFSGIIFRRVFTP*
soilL1_1006081573300003267Sugarcane Root And Bulk SoilLEGVQPLVERSDGKFGVGDPEGPDWIAFESIIDGRAMRMNFSGIIFRRMFTP*
soilH2_1016597113300003324Sugarcane Root And Bulk SoilADGKFGLGETNSPDWISFESIVDGRAMRLNLSGVIFRRVFTP*
Ga0062593_10074150323300004114SoilYYNDSAWYGDARVVLRNGQLLIDGVQPLVPRGDGKFGIGDPEGPDWISFESVVDGRAMRLNYSGIIFRRMFTP*
Ga0062590_10047443923300004157SoilWYGDTRIVLRKGQLYVDGVQPLVPRADGKFGITDPQAPDWISFESIIDGRAMRLNQSGVIFRRAFTP*
Ga0062595_10213644813300004479SoilVLRNGQLLIDGVQPLVPRGDGKFGIGDPEGPDWISFESVVDGRAMRLNFSGIIFRRIFTP
Ga0062594_10245936523300005093SoilEGVQPLVPRGDGKFGIGDPDGPDWMTFESIVDGRAMRLNFSGIIFRRVFTP*
Ga0065712_1026206423300005290Miscanthus RhizosphereWYGDTRIVYRRGRLYLEGVQPLTPRADGKFGVSDPEAPDWMAFESIVDGRAMRLNFSGIPFRRMFTP*
Ga0065715_1076840013300005293Miscanthus RhizosphereGVQPLVPRGDGKFGLGDPDGPDWMAFETIVDGRAMRLNFSGIIFRRVFTP*
Ga0065715_1089838513300005293Miscanthus RhizosphereKFGLGDPEGPDWMAFETIVDGRAMRLSFSGIIFRRVFTP*
Ga0065705_1001146553300005294Switchgrass RhizosphereTQRPDGRFGSGDPEAPDRLGFESIIDGRAMRLNYSGIIYRRTFTP*
Ga0065707_1052299913300005295Switchgrass RhizosphereQPLVPRGDGKFSFGDPEAPDWMSFETVVDGRAMRLNFSGIIFRRVFTP*
Ga0070676_1009053713300005328Miscanthus RhizosphereDGKFGLGDPEAPDWIVFETIINGRAMRLSLSGVVFRRAFTP*
Ga0070676_1044702723300005328Miscanthus RhizosphereMRKGQLLVEGVQPLVPRGDGKFGLGDPDGPDWMTFETIVDGRAMRLNLSGIIFRRAFT
Ga0070690_10005367213300005330Switchgrass RhizosphereAWYGDSRVVLRKGQLFVDGVQALVVRSDGKFGLGDPEAPDWIVFETIINGRAMRLNLSGVVFRRAFTP*
Ga0070670_10101041413300005331Switchgrass RhizosphereGKFGIGEPEGPDWITFESIVDGRAMRMNFSGIIFRRTFTP*
Ga0068869_10108492413300005334Miscanthus RhizosphereVQPLVPRGDGKFGLGDPDGPDWMAFETIVDGRAMRLNFSGIIFRRVFTP*
Ga0068868_10014387013300005338Miscanthus RhizosphereRSDGKFGLGDPEAPDWIVFETIINGRAMRLNLSGVVFRRAFTP*
Ga0070689_10055917123300005340Switchgrass RhizosphereARVVLRKGQLFMDGVQPLVPRGDGKFGIGEPEGPDWITFESIVNGRAMRMNFSGIIFRRTFTP*
Ga0070692_1024205023300005345Corn, Switchgrass And Miscanthus RhizosphereQLFLDGVQPLVPRGDGKFGIGDPEGPDWISFESIVDGRAMRMNSSGMIRRRTFTP*
Ga0070692_1101495213300005345Corn, Switchgrass And Miscanthus RhizosphereGQLFLEGMQPLAPRSDGKFGIIVPDGPDWLNFESIVDGRAMRLNFSGIIFRRVFTP*
Ga0070692_1118216013300005345Corn, Switchgrass And Miscanthus RhizosphereQPLVPRGDGKFGLGDPDGPDWMTFESIVDGRAMRLNFSGIIFRRVFTP*
Ga0070671_10083102023300005355Switchgrass RhizosphereLVPRGDGKFGLGDPEAPDWIGFESIVDGRAMRLNFSGIIYRRVFTP*
Ga0070673_10160195123300005364Switchgrass RhizosphereRFGSGDPEAPDRLGFESIIDGRAMRLNYSGIIYRRTFTP*
Ga0070673_10163945113300005364Switchgrass RhizosphereQLFIDGVQPLVTRGDGKFGVGEPDGPDWISFESIVDGRAMRMNYSGIIFRRAFTP*
Ga0070703_1035884123300005406Corn, Switchgrass And Miscanthus RhizosphereWYGDTRIVLRNGQLFIDGVQSLVPRGDGKFGVGEPEGPDWIAFDTVVDGRAMHLNYSGIIYRRIFTP*
Ga0070701_1028452723300005438Corn, Switchgrass And Miscanthus RhizosphereVVLRKGQLFMDGVQPLVPRGDGKFGLGDTDGPDWIAFESIVDGRAMRMSLSGIIFRRIFTP*
Ga0070694_10006937613300005444Corn, Switchgrass And Miscanthus RhizosphereDGKFGIGDPEAPDWIAFESIVDGRAMQLNYSGILFRRMFTP*
Ga0070694_10094697213300005444Corn, Switchgrass And Miscanthus RhizosphereVMRKGQLFVEGVQPLVPRGDGKFGLGDPEGPDWMNFESIVDGRAMRLNFSGIIFRRVFTP
Ga0070694_10114710523300005444Corn, Switchgrass And Miscanthus RhizosphereRKGQLFLDGVQPLVPRGDGKFGIGDPEGPDWVSFESIVDGRAMRMNSSGMIRRRTFTP*
Ga0070694_10169216013300005444Corn, Switchgrass And Miscanthus RhizosphereGVQPLVPRGDGKFGLGDPDGPDWMTFETIVDGRAMRLNFSGIIFRRVFTP*
Ga0070662_10008606913300005457Corn RhizosphereKGQLYLNGSQRLTQRPDGRFGSGDPEAPDRLGFESIIDGRAMRLNYSGIIYRRTFTP*
Ga0068867_10009176643300005459Miscanthus RhizosphereWYGDSRIVLRKDKLYVDGVQPLVARSDGKFGINDPEAPDWIEFESIINGRAMRLNLSGVVFRRTFTP*
Ga0068867_10028470013300005459Miscanthus RhizosphereLDGLQPLVARGDGKFGIGDPEAPDWVSFETVIDGRAMRLNFSGIPFRRMFTP*
Ga0068867_10108978423300005459Miscanthus RhizosphereDGKFGLGDPDGPDWMTFETIVDGRAMRLNFSGIIFRRVFTP*
Ga0070679_10035652613300005530Corn RhizosphereAPLVPRGDGKFGVGDPEAPDWISFESIVDGRAMRLNYSGIIFRRVFTP*
Ga0068853_10067080413300005539Corn RhizosphereGVQPLVARADGKFGLGETEAPDWISFESIIDGRAMRLNFSGVIFRRVFTP*
Ga0070686_10008504233300005544Switchgrass RhizosphereDSAWYGDSRVVLRKGQLFVDGVQPLVVRSDGKFGLGDPEAPDWIVFETIINGRAMRLNLSGVVFRRAFTP*
Ga0070695_10017672713300005545Corn, Switchgrass And Miscanthus RhizosphereTPRPDGRFGSGDPEAPDRLGFESIIDGRAMRLNYSGIIYRRTFTP*
Ga0070695_10066458423300005545Corn, Switchgrass And Miscanthus RhizosphereLRKGQLYLDGVQQLVPRADGKFGIGDPEAPDWISFESIVDGRAMRMSLSGTPFRRTFTP*
Ga0070693_10004324043300005547Corn, Switchgrass And Miscanthus RhizosphereVLRKGQLFLDGVQPLVPRGDGKFGVGDAEGPDWISFESIVDGRAMRMNSSGMIRRRTFTP
Ga0070693_10106470213300005547Corn, Switchgrass And Miscanthus RhizosphereTRVVMRKGQLFLDGVQPLVPRGDGKFGLGDPDGPDWISFESIVDGRAMRLNFSGIIFRRVFTP*
Ga0070693_10119580623300005547Corn, Switchgrass And Miscanthus RhizosphereDGKFGIGDPEAPDWVSFETVIDGRAMRLNFSGIPFRRMFTP*
Ga0070693_10134695413300005547Corn, Switchgrass And Miscanthus RhizosphereGVQPLVARNDGKFGLGDPEAPDWIAFESIINGKAMRLILSGVIFRRTNTP*
Ga0070665_10143108713300005548Switchgrass RhizosphereWYGDSRVVLRKGQLFVDGVQPLVVRSDGKFGLGDPEAPDWIVFETIINGRAMRLNLSGVVFRRAFTP*
Ga0070704_10154983923300005549Corn, Switchgrass And Miscanthus RhizosphereDGVQPLVPRGDGKFGIGDPEAPDWVSFESIVDGRAMRLNFSGIIFRRVFTP*
Ga0070664_10032566913300005564Corn RhizospherePLVARGDGKFSVGDPEGPDWIGFETIVNGRAMQMNYSGIIYRRMFTP*
Ga0068854_10163873123300005578Corn RhizosphereQPLVPRGDGKFGLGDPDGPDWMTFETIVDGRAMRLNFSGIIFRRVFTP*
Ga0068859_10086464523300005617Switchgrass RhizosphereQLFLDGVQPLVPRGDGKFGLGDPDGPDWISFQSIVDGRAMRLNFSGIIFRRVFTP*
Ga0068859_10100066323300005617Switchgrass RhizosphereLFLDGVQPLVPRGDGKFGLGDPEGPDWVSFESIVDGRAMRLNLSGIIFRRVFTP*
Ga0068864_10029144623300005618Switchgrass RhizosphereRSDGKFGINDPEAPDWIEFESIINGRAMRLNLSGVVFRRTFTP*
Ga0068864_10265077423300005618Switchgrass RhizosphereRVVLRKGQLFIDGVQPLVTRGDGKFGVGEPDGPDWISFESIVDGRAMRMNYSGIIFRRAFTP*
Ga0068863_10014037253300005841Switchgrass RhizospherePRGDGKFGIGDPEGPDWISFETLVDGRAMRLNFSGIIFRRIFTP*
Ga0068863_10049798623300005841Switchgrass RhizosphereDPEAPDWISFETVVDGRAMRMSYSGIIFRRAFTP*
Ga0068863_10081035413300005841Switchgrass RhizosphereRGQLFLDGTVPLLARADGKFGVGDPESPDWIAFETIVNGRAMQLNYSGIIFRRMSTP*
Ga0068863_10102736613300005841Switchgrass RhizospherePLVPRGDGKFGIGEPEGPDWITFESIVDGRAMRMNFSGIIYRRAFTP*
Ga0068860_10044959013300005843Switchgrass RhizosphereSDGKFGLGDTDGPDWIGFESIVDGRAMRMNFSGIIFRRIFTP*
Ga0068860_10260782223300005843Switchgrass RhizosphereRGDGKFGIGDPDGPDWMTFESIVDGRAMRLNFSGIIFRRVFTP*
Ga0068862_10204470023300005844Switchgrass RhizosphereADGKFGVSDPEAPDWMAFESIVDGRAMRLNFSGIPFRRMFTP*
Ga0068862_10242299223300005844Switchgrass RhizosphereSAWYGDSRVVLRKGQLFADGVQPLVVRGDGKFGLGDPAAPDWIAFETIINGRAMRLNLSGVVFRRAFTP*
Ga0075289_100503313300005888Rice Paddy SoilFGIGDPDGPDWISFETIVDGRAMRLNFSGIVFRRIFTP*
Ga0075417_1063897923300006049Populus RhizosphereDGVQPLIPRPDGKFGLNDPEAPDWIAFESIIDGRAMRLNLSGIPFRRMFTP*
Ga0075422_1023713013300006196Populus RhizosphereLQPLVLRGDGKFGIGDPEAPDWIAFESIIDGRAMRLNFSGIPFRRTSTP*
Ga0079222_1182122823300006755Agricultural SoilQPLVPRADGKFGIVIPEGPDWMTFESIVDGRAMRLNFSGIIFRRVFTP*
Ga0079221_1009451023300006804Agricultural SoilRRGQLFLEGMVPLVRRADGKFGIGDPEAPDWIGFESIINGRAMQLNYSGIVFRRMFTP*
Ga0079220_1095670523300006806Agricultural SoilWYGDTRIVMRKGQLFVEGVQPLVPRADGKFGIVIPEGPDWMTFESIVDGRAMRLNFSGIIFRRVFTP*
Ga0079220_1184920113300006806Agricultural SoilDGVQPLVPRGDGKFGLGEAEGPDWISFDTIVDGCAMRLSLSGIIFRRMFTP*
Ga0075428_10062867013300006844Populus RhizospherePWYGDTRIVYRRGRLYADGVQPLIPRPDGKFGLSDPEAPDWIAFESIIDGRAMRLNLSGIPFRRMFTP*
Ga0075431_10169017023300006847Populus RhizosphereLVPRADGKFAVNDPQAPDWMAFESIIEGRAMRLNLSGIPFRRIFTP*
Ga0075425_10306498513300006854Populus RhizosphereGKFGLGETEAPDWISFESIVDGRAMRLNLSGVIFRRVFTP*
Ga0079217_1067572323300006876Agricultural SoilLRKGQLFVEGVQPLIPRGDGKFGIGDPEAPDWISFESIVDGRAMRLNFSGIPFRRVFTP*
Ga0075429_10103420013300006880Populus RhizosphereTRVVMRKGQLFIDGVQPLVPRGDGKFGIGDPEAPDWVSFESIVDGRAMRLNFSGIIFRRVFTP*
Ga0079216_1000189713300006918Agricultural SoilKFGIGDPEAPDWIAFESIIDGRAMRLNFSGIIFRRMFTP*
Ga0079219_1006009023300006954Agricultural SoilMRKGQLFVEGVQPLVPRGDGKFGLGDPDGPDWMSFETIVDGRAMRLSFSGIIFRRVFTP*
Ga0075419_1127021813300006969Populus RhizosphereLQPLVDRGDGKFGIGDPEAPDWIAFESIIDGRAMRLNFSGIIFRRMFTP*
Ga0114129_1273009223300009147Populus RhizosphereYQGGVQRLTPRANGKFGFGDAEQPDQISFETIINGRAMRLNYSGIIFRRTFTP*
Ga0114129_1293663213300009147Populus RhizosphereQPLVPRGDGKFGLGDPEEPDWISFEAIVDGRAMRLNYSGTIFRRIFTP*
Ga0111538_1222037523300009156Populus RhizosphereAGHYYNDSAWYGDARVVLRNGQLLIDGVQPLVPRGDGKFGVGDPDGPDWMSFESVVDGRAMRLNFSGIIFRRIFTP*
Ga0075423_1069895213300009162Populus RhizosphereSRIVLRKDKLYVDGVQPLVPRGDGKFGLNDPEGPDWITFESNINGKAMRMNLSGVVFRRSFTP*
Ga0075423_1191175623300009162Populus RhizosphereVDGVQPLVPRSDGKFGIGDPEAPDWISFETVVDGRAMRMSYSGIIFRRAFTP*
Ga0075423_1226327523300009162Populus RhizospherePEYGDTRVVMRKGQLFLDGVQPLVPRGDGKFGLGDPEGPDWISFESIVDGRAMRLSLSGIIFRRVFTP*
Ga0105241_1088287013300009174Corn RhizosphereVMRKGQLFAEGVQSLVPRADGKFSLGDPEAPDWMSFETIVDGRAMRLNLSGIIFRRAFTP
Ga0105241_1137665813300009174Corn RhizosphereGVQPLVPRGDGKFGLGDPDGPDWIGFETIVDGRAMRLNFSGVIFRRSFTP*
Ga0105248_1129953513300009177Switchgrass RhizosphereLFLEGVQPLVPRGDGKFGLGDPEAPDWMNFETIVDGRAMRLNFSGIIFRRVFTP*
Ga0105248_1310284623300009177Switchgrass RhizosphereDGKFGLNEPNAPDWIQFETIIDGKAMRMNLSGVVFHRAFTP*
Ga0105249_1064723313300009553Switchgrass RhizosphereGTQPLVPRGDGKFGMGDPEAPDWISFESIVDGRAMRLNFSGIIFRRIFTP*
Ga0126307_1048682013300009789Serpentine SoilGQLFFDGVQQLVPRGDGKFGIGDPEAPDWISFESIVDGRAMRMNFSGIVFRRTFTP*
Ga0126304_1005280233300010037Serpentine SoilGDPEAPDWMTFETIVDGRAMRLNFSGIIFRRVFTP*
Ga0126308_1063826823300010040Serpentine SoilGKFGIGDPDAPDWISFESIVDGRAMRMNFSGIVFRRTFTP*
Ga0126312_1095993023300010041Serpentine SoilFDGLQQLVPRADGKFGIGDPEAPDWISFDSIVEGRAMRMNFSGIVFRRTFTP*
Ga0134125_1297096923300010371Terrestrial SoilKFGLGDPEAPDWIGFESIVDGRAMRLNFSGIIYRRVFTP*
Ga0105239_1200705313300010375Corn RhizosphereRGDGKFGLGDPEGPDWMAFETIVDGRAMRLNFSGIIFRRVFTP*
Ga0134124_1030290943300010397Terrestrial SoilVQPLVPRGDGKFGLGDPDGPDWIGFETIVDGRAMRLNFSGVIFRRSFTP*
Ga0134124_1107205713300010397Terrestrial SoilLFLDGVQPLVPRGDGKFGLGDPEAPDWIGFESIVDGRAMRLNFSGIIYRRVFTP*
Ga0134127_1332011923300010399Terrestrial SoilYGDTRVVMRKGQLFVEGVQPLVPRGDGKFGLGDPDGPDWMAFETIVNGRAMRLNFSGIIFRRVFTP*
Ga0134121_1267506113300010401Terrestrial SoilWYGDTRIVLRNGQLFIDGVQPLVPRGDGKFGVGEPEGPDWIAFDTVVDGRAMHLNYSGIIFRRIFTP*
Ga0134123_1077820823300010403Terrestrial SoilDGKFGLGDPETPDWISFESIVDGRAMRLNYSGILFRRTFTP*
Ga0134123_1088077423300010403Terrestrial SoilYGDIRIVMRKGQLFAEGVQPLVPRGDGKFSLGDPEAPDWMSFETIVDGRAMRLNFSGIIFRRAVTP*
Ga0126375_1086819223300012948Tropical Forest SoilGFGEPDQPDHISFETIIDGRAMRASYSGIIFRRTFTP*
Ga0164299_1135364313300012958SoilPRGDGKFGIGDPEGPDWISFETVVDGRAMRLNYSGIIFRRIFTP*
Ga0157371_1059618423300013102Corn RhizosphereLRKGQLFVDGVQPLVVRSDGKFGLGDPEAPDWIVFETIINGRAMRLNLSGVVFRRAFTP*
Ga0163162_1121139323300013306Switchgrass RhizosphereDGKFGLGETEAPDWISFESIIDGRAMRLNLSGVIFRRVFTP*
Ga0157372_1309661823300013307Corn RhizosphereVVLRRGQLFLDGTVPLIARGDGKFGVGDPEAPDWISFESIVNGRAMQLNYSGVIFRRMSTP*
Ga0157375_1074813923300013308Miscanthus RhizosphereMDGVQPLVPRGDGKFGIGEPEGPDWISFESIVDGRAMRMNFSGIIFRRTFTP*
Ga0120183_100762113300013754TerrestrialGIGDPEAPDWISFESVVDGRAMRLNYSGIVFRRTFTP*
Ga0163163_1034371713300014325Switchgrass RhizosphereFGIGEPEGPDWISFESIVDGRAMRMNFSGIIFRRTFTP*
Ga0157377_1105184423300014745Miscanthus RhizosphereRVVYRKGKLFLDGIQPLVLRADGKFGIGDPEAPDWIAFESIIDGRAMRLNFSGIPFRRMSTP*
Ga0157379_1062411713300014968Switchgrass RhizosphereLVPRADGKFGLGDPDGPDWMAFETIVDGRAMRLNFSGIIFRRVFTP*
Ga0132256_10032343413300015372Arabidopsis RhizosphereVRADGKFGLNEPDAPDWIQFETIIDGKAMRMNLSGVVFHRAFTP*
Ga0132257_10064089413300015373Arabidopsis RhizospherePRGDGKFGLGDTDGPDWIAFESIVGGHAMQLNYSGIVFRRMFTP*
Ga0190265_1199321823300018422SoilTRVVLRKGQLFIDGVQPLIPRGDGKFGIGDPEAPDWISFESIVDGRAMRLNYSGILFRRAFTP
Ga0190270_1129876023300018469SoilHYYNDSAWYGDTRIVLRKGQLFADGVQPLIPRGDGKFGLGDPEGPDWINFESIVDGRAMRMSLSGIVFRRAFTP
Ga0247678_105490213300024325SoilLRRGQLYVDGVQSLVPRSDGKFGLGDPEAPDWMSFESIVDGRAMVLNFSGIIFRRMFTP
Ga0207653_1026747323300025885Corn, Switchgrass And Miscanthus RhizosphereGQLFIDGVQSLVPRGDGKFGVGEPEGPDWIAFDTVVDGRAMHLNYSGIIYRRIFTP
Ga0207642_1077044523300025899Miscanthus RhizosphereAWYGDSRVVLRKGQLFVDGVQPLVVRSDGKFGLGDPEAPDWIVFETIINGRAMRLNLSGVVFRRAFTP
Ga0207642_1111809923300025899Miscanthus RhizosphereYGDTRIVMRKGQLFIEGVQPLVPRSDGKFGIGDPEAPDWMSFESIVDGRAMRLNFSGIIFRRVFTP
Ga0207688_1070981013300025901Corn, Switchgrass And Miscanthus RhizosphereWYGDSRVVLRKGQLFVDGVQPLVVRSDGKFGLGDPEAPDWIVFETIINGRAMRLNLSGVVFRRAFTP
Ga0207654_1130034723300025911Corn RhizosphereTRIVLRRGQLYMDGVQSLIPRGDGKFGIGDPEAPDWVSFESIVDGRALILNYSGVRFRRMFTP
Ga0207660_1116515713300025917Corn RhizosphereLFVEGVQPLVPRGDGKFGLGDPDGPDWMTFETIVDGRAMRLNFSGIIFRRSFTP
Ga0207662_1118716313300025918Switchgrass RhizosphereFVDGVQPLVVRSDGKFGLGDPEAPDWIVFETIINGRAMRLNLSGVVFRRAFTP
Ga0207652_1040799613300025921Corn RhizosphereAPLVPRGDGKFGVGDPEAPDWISFESIVDGRAMRLNYSGIIFRRVFTP
Ga0207646_1010677953300025922Corn, Switchgrass And Miscanthus RhizosphereDGTAPLVPRGDGKFGVGDPEAPDWISFESIVDGRAMRLSYSGIIFRRVFTP
Ga0207659_1164184413300025926Miscanthus RhizosphereLYLEGVQPLTPRADGKFGVSDPEAPDWMAFESIVDGRAMRLNFSGIPFRRMFTP
Ga0207687_1016282413300025927Miscanthus RhizosphereQPLVVRSDGKFGLGDPEAPDWIVFETIINGRAMRLNLSGVVFRRAFTP
Ga0207701_1006473153300025930Corn, Switchgrass And Miscanthus RhizosphereKGQLFVDGVQPLVVRSDGKFGLGDPEAPDWIVFETIINGRAMRLNLSGVVFRRAFTP
Ga0207644_1012963013300025931Switchgrass RhizosphereRIVLRKDKLYVDGVQPLVARSDGKFGINDPEAPDWIEFESIINGRAMRLNLSGVVFRRTFTP
Ga0207704_1112276013300025938Miscanthus RhizosphereRSDGKFGINDPEAPDWIEFESIINGRAMRLNLSGVVFRRTFTP
Ga0207691_1000989213300025940Miscanthus RhizosphereSAWYGDSRVVLRKGQLFVDGVQPLVVRSDGKFGLGDPEAPDWIVFETIINGRAMRLNLSGVVFRRAFTP
Ga0207679_1192210413300025945Corn RhizosphereDGVQPLVVRSDGKFGLGDPEAPDWIVFETIINGRAMRLNLSGVVFRRAFTP
Ga0207712_1002743363300025961Switchgrass RhizosphereDGKFGLGDPEAPDWIVFETIINGRAMRLNLSGVVFRRAFTP
Ga0207712_1122684813300025961Switchgrass RhizosphereGTQPLVPRGDGKFGMGDPEAPDWISFESIVDGRAMRLNFSGIIFRRIFTP
Ga0207640_1079423523300025981Corn RhizosphereIGDPEGPDWMTFESIVDGRAMRLNFSGIIFRRVFTP
Ga0207639_1067230323300026041Corn RhizosphereDGKFGLGETEAPDWISFESIVDGRAMRLNFSGVIFRRVFTP
Ga0207702_1252942123300026078Corn RhizosphereDSRIVLRKDKLYVDGVQPLVARSDGKFGINDPEVPDWIEFESIINGRAMRLNLSGVVFRRTFTP
Ga0207641_1034682813300026088Switchgrass RhizosphereNGQLLIDGVQPLVPRGDGKFGIGDPEGPDWISFESIVDGRAMRLNYSGIIFRRMFTP
Ga0207641_1220332323300026088Switchgrass RhizosphereIVYRRGRLYLEGVQPLTPRADGKFGVSDPEAPDWMAFESIVDGRAMRLNFSGIPFRRMFT
Ga0207676_1154056613300026095Switchgrass RhizosphereGDPEAPDWMSFETIVDGRAMRLNLSGIIFRRAFTP
Ga0207674_1049879913300026116Corn RhizosphereQPLVERADGKFGIGDPEAPDWIAFESIIDGRAMRLNFSGIIFRRMFTP
Ga0209814_1004828813300027873Populus RhizosphereGVQRLTPRANSKFGFGDAEQPDQISFETIINGRAMRLNYSGIIFRRTFTP
Ga0268265_1003342913300028380Switchgrass RhizosphereRSDGKCGLGDPEAPDWIVFETIINGRAMRLNLSGVVFRRAFTP
Ga0268265_1228396523300028380Switchgrass RhizosphereVQPLVPRGDGKFGLGDPDGPDWISFQSIVDGRAMRLNFSGIVFRRVFTP
Ga0268264_1044240823300028381Switchgrass RhizosphereGKFGLGDPEAPDWIGFESIVDGRAMRLNFSGIIYRRVFTP
Ga0268240_1015355313300030496SoilQLLIDGVQPLVPRGDGKFGVGDPEGPDWISFESVVDGRAMRLNYSGVIFRRMFTP
Ga0307410_1124960123300031852RhizosphereRLLVEGIQPLVPRDDGKFGIGDPEAPDWISFDSIVDGRAMRMSYSGVIFRRTFTP
Ga0310893_1030770323300031892SoilPLVARGDGKFGIGDPEAPDWVSFETVIDGRAMRLNFSGIPFRRMFTP
Ga0310900_1072427523300031908SoilDLRVVLRKGQLYLNGSQRLTPRPDGRFGSGDPEAPDRLGFESIIDGRAMRLNYSGIIYRRTFTP
Ga0307412_1018457133300031911RhizosphereGKFGVGDPEAPDWISFESIVDGRAMRLNFSGIVFRRIFTP
Ga0307414_1151402513300032004RhizospherePWYGDTRVVLRKGQLFVDGVQPLVPRGDGKFGVGDPEAPDWISFESIVDGRAMRLNFSGIVFRRTFTP
Ga0307411_1059649323300032005RhizosphereGQLFVDGVQPLVPRGDGKFGVGDPEAPDWISFESIVDGRAMRLNFSGIIFRRMFTP
Ga0310810_1070574023300033412SoilRKGQLYVDGVQPLVARADGKFGLGDAEGPDWMSFESIIDGRALRLNLSGVIFRRVFTP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.