| Basic Information | |
|---|---|
| Family ID | F045080 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 42 residues |
| Representative Sequence | LPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRRH |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 47.02 % |
| % of genes near scaffold ends (potentially truncated) | 50.98 % |
| % of genes from short scaffolds (< 2000 bps) | 84.97 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.582 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.915 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.719 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.752 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.33% β-sheet: 0.00% Coil/Unstructured: 41.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF01977 | UbiD | 32.03 |
| PF00211 | Guanylate_cyc | 18.30 |
| PF00490 | ALAD | 9.80 |
| PF00931 | NB-ARC | 2.61 |
| PF00033 | Cytochrome_B | 1.31 |
| PF13401 | AAA_22 | 1.31 |
| PF12698 | ABC2_membrane_3 | 1.31 |
| PF01637 | ATPase_2 | 0.65 |
| PF07883 | Cupin_2 | 0.65 |
| PF12681 | Glyoxalase_2 | 0.65 |
| PF12270 | Cyt_c_ox_IV | 0.65 |
| PF01061 | ABC2_membrane | 0.65 |
| PF00355 | Rieske | 0.65 |
| PF03069 | FmdA_AmdA | 0.65 |
| PF00005 | ABC_tran | 0.65 |
| PF03992 | ABM | 0.65 |
| PF13545 | HTH_Crp_2 | 0.65 |
| PF00496 | SBP_bac_5 | 0.65 |
| PF13277 | YmdB | 0.65 |
| PF13191 | AAA_16 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 32.03 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 18.30 |
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 9.80 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 1.31 |
| COG1373 | Predicted ATPase, AAA+ superfamily | General function prediction only [R] | 0.65 |
| COG1672 | Predicted ATPase, archaeal AAA+ ATPase superfamily | General function prediction only [R] | 0.65 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.58 % |
| Unclassified | root | N/A | 12.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_102129625 | Not Available | 1613 | Open in IMG/M |
| 3300000956|JGI10216J12902_117406313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 924 | Open in IMG/M |
| 3300001536|A1565W1_10378590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
| 3300002568|C688J35102_120078465 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300002568|C688J35102_120501145 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300003659|JGI25404J52841_10101612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 603 | Open in IMG/M |
| 3300004081|Ga0063454_100258008 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300004479|Ga0062595_101857701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
| 3300005093|Ga0062594_100799157 | Not Available | 872 | Open in IMG/M |
| 3300005167|Ga0066672_10777476 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005172|Ga0066683_10192275 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300005176|Ga0066679_10737906 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005179|Ga0066684_11071161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300005184|Ga0066671_11067686 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005294|Ga0065705_11151618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 508 | Open in IMG/M |
| 3300005356|Ga0070674_100093731 | All Organisms → cellular organisms → Bacteria | 2173 | Open in IMG/M |
| 3300005434|Ga0070709_10172784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1511 | Open in IMG/M |
| 3300005435|Ga0070714_100081749 | All Organisms → cellular organisms → Bacteria | 2813 | Open in IMG/M |
| 3300005436|Ga0070713_101493618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 656 | Open in IMG/M |
| 3300005437|Ga0070710_10690316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
| 3300005444|Ga0070694_100909192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
| 3300005457|Ga0070662_101571436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
| 3300005526|Ga0073909_10115443 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300005529|Ga0070741_10064991 | All Organisms → cellular organisms → Bacteria | 4187 | Open in IMG/M |
| 3300005529|Ga0070741_10942727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
| 3300005536|Ga0070697_100235999 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300005538|Ga0070731_10196548 | Not Available | 1339 | Open in IMG/M |
| 3300005549|Ga0070704_100048759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2966 | Open in IMG/M |
| 3300005549|Ga0070704_101226231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 685 | Open in IMG/M |
| 3300005559|Ga0066700_10054224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2477 | Open in IMG/M |
| 3300005576|Ga0066708_10226404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1182 | Open in IMG/M |
| 3300005576|Ga0066708_11051441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
| 3300005719|Ga0068861_101069939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
| 3300005873|Ga0075287_1030928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 695 | Open in IMG/M |
| 3300006574|Ga0074056_11150206 | Not Available | 997 | Open in IMG/M |
| 3300006606|Ga0074062_12769708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 744 | Open in IMG/M |
| 3300006804|Ga0079221_10424793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
| 3300006806|Ga0079220_10371388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 920 | Open in IMG/M |
| 3300007820|Ga0104324_134225 | All Organisms → cellular organisms → Bacteria | 3522 | Open in IMG/M |
| 3300009012|Ga0066710_102493301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 748 | Open in IMG/M |
| 3300009093|Ga0105240_11309576 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300009098|Ga0105245_10168598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2083 | Open in IMG/M |
| 3300009098|Ga0105245_11187801 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300009148|Ga0105243_10174946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1862 | Open in IMG/M |
| 3300009148|Ga0105243_10726981 | Not Available | 971 | Open in IMG/M |
| 3300010152|Ga0126318_11006681 | Not Available | 503 | Open in IMG/M |
| 3300010154|Ga0127503_10495084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3466 | Open in IMG/M |
| 3300010323|Ga0134086_10333453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
| 3300010362|Ga0126377_11247625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 814 | Open in IMG/M |
| 3300010371|Ga0134125_10446130 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300010371|Ga0134125_10598010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1219 | Open in IMG/M |
| 3300010373|Ga0134128_10969195 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300010396|Ga0134126_10503893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1395 | Open in IMG/M |
| 3300011003|Ga0138514_100016447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1279 | Open in IMG/M |
| 3300011269|Ga0137392_11256134 | Not Available | 599 | Open in IMG/M |
| 3300012011|Ga0120152_1162159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300012014|Ga0120159_1010241 | All Organisms → cellular organisms → Bacteria | 3973 | Open in IMG/M |
| 3300012014|Ga0120159_1074270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1012 | Open in IMG/M |
| 3300012199|Ga0137383_10181326 | Not Available | 1543 | Open in IMG/M |
| 3300012200|Ga0137382_10622715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
| 3300012201|Ga0137365_10010858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 7196 | Open in IMG/M |
| 3300012206|Ga0137380_10506385 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300012207|Ga0137381_11224930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300012208|Ga0137376_10054707 | Not Available | 3276 | Open in IMG/M |
| 3300012209|Ga0137379_10523890 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300012209|Ga0137379_10696977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 921 | Open in IMG/M |
| 3300012212|Ga0150985_106146085 | Not Available | 1302 | Open in IMG/M |
| 3300012356|Ga0137371_10613643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
| 3300012359|Ga0137385_10232882 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300012469|Ga0150984_112959087 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300012469|Ga0150984_112966161 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300012469|Ga0150984_117966365 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300012478|Ga0157328_1031608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 504 | Open in IMG/M |
| 3300012494|Ga0157341_1001220 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300012901|Ga0157288_10176648 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300012910|Ga0157308_10184984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 692 | Open in IMG/M |
| 3300012914|Ga0157297_10528289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300012922|Ga0137394_10743988 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300012922|Ga0137394_11616439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300012960|Ga0164301_11517974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
| 3300012989|Ga0164305_11645816 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300013297|Ga0157378_10570552 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300013308|Ga0157375_12007868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 687 | Open in IMG/M |
| 3300013772|Ga0120158_10025737 | All Organisms → cellular organisms → Bacteria | 4656 | Open in IMG/M |
| 3300015077|Ga0173483_10737488 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300015200|Ga0173480_10627644 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300015245|Ga0137409_11579196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300015261|Ga0182006_1217362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 630 | Open in IMG/M |
| 3300015265|Ga0182005_1181469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
| 3300017792|Ga0163161_11383530 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300018027|Ga0184605_10285453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
| 3300018061|Ga0184619_10023209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2566 | Open in IMG/M |
| 3300018061|Ga0184619_10469069 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300018076|Ga0184609_10468656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 577 | Open in IMG/M |
| 3300018468|Ga0066662_12403659 | Not Available | 554 | Open in IMG/M |
| 3300018482|Ga0066669_10821631 | Not Available | 825 | Open in IMG/M |
| 3300018482|Ga0066669_12105451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
| 3300019356|Ga0173481_10474226 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300019875|Ga0193701_1105569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 519 | Open in IMG/M |
| 3300019886|Ga0193727_1109144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 806 | Open in IMG/M |
| 3300019888|Ga0193751_1158198 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300019890|Ga0193728_1039913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2311 | Open in IMG/M |
| 3300020005|Ga0193697_1001168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8028 | Open in IMG/M |
| 3300020070|Ga0206356_10626909 | Not Available | 2106 | Open in IMG/M |
| 3300021415|Ga0193694_1000486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5342 | Open in IMG/M |
| 3300021445|Ga0182009_10279022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 837 | Open in IMG/M |
| 3300021445|Ga0182009_10543396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 616 | Open in IMG/M |
| 3300022756|Ga0222622_10298144 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300022756|Ga0222622_10735681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
| 3300022756|Ga0222622_11313462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
| 3300025893|Ga0207682_10333056 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300025899|Ga0207642_10816223 | Not Available | 594 | Open in IMG/M |
| 3300025901|Ga0207688_10169991 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300025910|Ga0207684_10917542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 736 | Open in IMG/M |
| 3300025915|Ga0207693_10883269 | Not Available | 686 | Open in IMG/M |
| 3300025922|Ga0207646_10522844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1068 | Open in IMG/M |
| 3300025922|Ga0207646_11532122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300025937|Ga0207669_11100121 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300026078|Ga0207702_10425879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1284 | Open in IMG/M |
| 3300026095|Ga0207676_10761380 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300026550|Ga0209474_10647205 | Not Available | 544 | Open in IMG/M |
| 3300027669|Ga0208981_1060704 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300027821|Ga0209811_10087021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1110 | Open in IMG/M |
| 3300028145|Ga0247663_1044689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 733 | Open in IMG/M |
| 3300028146|Ga0247682_1025979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1033 | Open in IMG/M |
| 3300028380|Ga0268265_11005191 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300028707|Ga0307291_1192145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
| 3300028711|Ga0307293_10118010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
| 3300028712|Ga0307285_10147638 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300028716|Ga0307311_10216088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 564 | Open in IMG/M |
| 3300028718|Ga0307307_10124092 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300028719|Ga0307301_10052306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1258 | Open in IMG/M |
| 3300028720|Ga0307317_10225995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300028722|Ga0307319_10000101 | All Organisms → cellular organisms → Bacteria | 26061 | Open in IMG/M |
| 3300028744|Ga0307318_10002755 | All Organisms → cellular organisms → Bacteria | 5734 | Open in IMG/M |
| 3300028790|Ga0307283_10081378 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300028796|Ga0307287_10369152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
| 3300028875|Ga0307289_10482137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 510 | Open in IMG/M |
| 3300028878|Ga0307278_10031984 | All Organisms → cellular organisms → Bacteria | 2405 | Open in IMG/M |
| 3300028878|Ga0307278_10245585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 795 | Open in IMG/M |
| 3300028881|Ga0307277_10000305 | All Organisms → cellular organisms → Bacteria | 17552 | Open in IMG/M |
| 3300028884|Ga0307308_10140554 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300030336|Ga0247826_10627211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 827 | Open in IMG/M |
| 3300030511|Ga0268241_10061645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 821 | Open in IMG/M |
| 3300031562|Ga0310886_10614578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 669 | Open in IMG/M |
| 3300031716|Ga0310813_10530237 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300031944|Ga0310884_10789347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 580 | Open in IMG/M |
| 3300031962|Ga0307479_10690373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1000 | Open in IMG/M |
| 3300032174|Ga0307470_10330732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1048 | Open in IMG/M |
| 3300033158|Ga0335077_10798834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 961 | Open in IMG/M |
| 3300034384|Ga0372946_0068377 | Not Available | 1630 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.19% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.27% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.27% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.27% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.96% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.31% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.31% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.31% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.65% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.65% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007820 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1021296251 | 3300000956 | Soil | TEGKKVITGMLIVGLIFLGVIVVGETTHWLRHRRR* |
| JGI10216J12902_1174063131 | 3300000956 | Soil | LPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRHR* |
| A1565W1_103785901 | 3300001536 | Permafrost | MLTVLAETAAQEGKKTIFAMLIVGLVFVSVIALGELTHWLRHRR* |
| C688J35102_1200784653 | 3300002568 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRRH* |
| C688J35102_1205011452 | 3300002568 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFFGVIVLGELTHWLRHRRH* |
| JGI25404J52841_101016122 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MVPLAAKTAAQEGLDVIRAMLVVGLIFLGVILVGELTHWLRHRR* |
| Ga0063454_1002580083 | 3300004081 | Soil | AATAAEEGKKVIFAMLITGLIFISVIALGELTHWLRSRR* |
| Ga0062595_1018577012 | 3300004479 | Soil | MIVLAATAAEEGKKVIEAMLVVGLIFAGVIALGQFTHWVRHRRH* |
| Ga0062594_1007991573 | 3300005093 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRHR* |
| Ga0066672_107774762 | 3300005167 | Soil | MLNVLAETAAQEGKKVIFAMLIVGLIFLSVIALGELTHWLRHRR* |
| Ga0066683_101922752 | 3300005172 | Soil | VLHVFAATAAEEGKKVIFAMLITGLVFVSVIVLGELTHWLRSRR* |
| Ga0066679_107379062 | 3300005176 | Soil | MALAVLNLLAAETAAQEGKKVILAMLIVGLVFFGVIVLGETTHYLRQRRHR* |
| Ga0066684_110711611 | 3300005179 | Soil | MLNVLAETAAQEGKKVIFAMLIVGLIFVSVIALGELTHWLR |
| Ga0066671_110676862 | 3300005184 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGVIFLGVIVLGELTHWLRHRRH* |
| Ga0065705_111516182 | 3300005294 | Switchgrass Rhizosphere | LPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRRH* |
| Ga0070674_1000937313 | 3300005356 | Miscanthus Rhizosphere | AAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRR* |
| Ga0070709_101727842 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VLPLAAKTAAQEGKEVIEAMLVVGLIFLAVILLGEFSKWLRHRRH* |
| Ga0070714_1000817493 | 3300005435 | Agricultural Soil | MLPLAAKTAAQEGKEVIEAMLVVGLIFLAVILLGEFSKWLRHRRH* |
| Ga0070713_1014936182 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPLAAKTAAQEGLDVIKAMLVVGLIFLSVIVLGELLHWLRHRRH* |
| Ga0070710_106903161 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VLPLAAKTAAQEGKEVIEAMLVVGLIFLAVILLGEFSKWL |
| Ga0070694_1009091922 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLAAKTAAEEGLDVIRAMLIVGLIFASVIAIGQTVHWLRHRRHH* |
| Ga0070662_1015714362 | 3300005457 | Corn Rhizosphere | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWL |
| Ga0073909_101154432 | 3300005526 | Surface Soil | EGKEVIEAMLVVGLIFLAVILLGEFSKWLRHRRH* |
| Ga0070741_100649913 | 3300005529 | Surface Soil | VVHVLAATAAEEGKKVIFAMLITGLIFVAVIVIGELTHWLRSRRG* |
| Ga0070741_109427272 | 3300005529 | Surface Soil | VLLAAKTAAQEGLDVIRAMLIVGLIFASVIAIGQTVHWLRHRRHH* |
| Ga0070697_1002359992 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLAAKTAAEEGLDVIRAMLIVGLIFASVIAIGQTVHWLRHRRHD* |
| Ga0070731_101965481 | 3300005538 | Surface Soil | AQEGRKTVLMMLGVGGVFLAVIAIGELTHWLTSRRARHH* |
| Ga0070704_1000487593 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRRH* |
| Ga0070704_1012262312 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLAVKTAAQEGLDVIRAMLIVGLIFASVIAVGQTLHWLRHRRHRH* |
| Ga0066700_100542241 | 3300005559 | Soil | MLFPLAVKTAAQEGKEVIEAMLGVGAVFLGVIVLGELSRWLRHRR* |
| Ga0066708_102264042 | 3300005576 | Soil | AEEGKKVIEAMLVVGLIFAGVIALGQFTHWVRHRRH* |
| Ga0066708_110514411 | 3300005576 | Soil | EEGKKVIEAMLVVGLVFAGVIALGQLTHWLRHRRH* |
| Ga0068861_1010699392 | 3300005719 | Switchgrass Rhizosphere | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRR* |
| Ga0075287_10309281 | 3300005873 | Rice Paddy Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVVGELTHWLRHRR* |
| Ga0074056_111502061 | 3300006574 | Soil | AKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRRH* |
| Ga0074062_127697082 | 3300006606 | Soil | IALMLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRQRRH* |
| Ga0079221_104247932 | 3300006804 | Agricultural Soil | VILAAKTAAQEGLDVIKAMLVVGLIFLSVILLGELTHWLRHRRH* |
| Ga0079220_103713882 | 3300006806 | Agricultural Soil | VLPLAAKTAAQEGKEVIEAMLVVGLIFLAVILLGEFSKWLRHR |
| Ga0104324_1342251 | 3300007820 | Soil | MLNVLAETAAQEGKKVIFAMLIVGLVFISVIALGELTHWLRHKR* |
| Ga0066710_1024933011 | 3300009012 | Grasslands Soil | MALAVLNLLAASETAAQEGKTVIIAMLIVGLVFLGVIVLGETTHYLRQRRHR |
| Ga0105240_113095761 | 3300009093 | Corn Rhizosphere | AQEGKKTILSMLVVGLVFLSVVAIGELTHWLRHRR* |
| Ga0105245_101685982 | 3300009098 | Miscanthus Rhizosphere | LAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRRH* |
| Ga0105245_111878013 | 3300009098 | Miscanthus Rhizosphere | VIFDAATEGKHVIVGMLVVGLIFLVVIGLGELSHWANHRRHGRAR |
| Ga0105243_101749461 | 3300009148 | Miscanthus Rhizosphere | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHR |
| Ga0105243_107269811 | 3300009148 | Miscanthus Rhizosphere | EGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRRH* |
| Ga0126318_110066812 | 3300010152 | Soil | QEGKKTILSMLVVGLVFLSVIAIGELTHWLRHRR* |
| Ga0127503_104950841 | 3300010154 | Soil | QEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHLR* |
| Ga0134086_103334532 | 3300010323 | Grasslands Soil | MLPLAAKTAAEEGLDVIRAMLIVGLTFAAVIALGQ |
| Ga0126377_112476251 | 3300010362 | Tropical Forest Soil | EEGKDVITAMLIVGLVFLSVIVLGELTHWLLHRRR* |
| Ga0134125_104461302 | 3300010371 | Terrestrial Soil | MLNVLAATAAEEGKKVIYAMLITGLVFVSVIILGELTHWLRSRR* |
| Ga0134125_105980101 | 3300010371 | Terrestrial Soil | KTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRRH* |
| Ga0134128_109691951 | 3300010373 | Terrestrial Soil | AQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRR* |
| Ga0134126_105038932 | 3300010396 | Terrestrial Soil | MLPLAAKNAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRRH* |
| Ga0138514_1000164472 | 3300011003 | Soil | MTLLVLAATAAEEGKKVIEAMLVVGLIFAGVIALGQFTHWIRHRRH* |
| Ga0137392_112561342 | 3300011269 | Vadose Zone Soil | MLYALVATAAEEGKKVIFAMLITGLVFVAVIAVGELSHWLRHKR* |
| Ga0120152_11621592 | 3300012011 | Permafrost | MLNVLAETAAQEGKKVIFAMLIVGLVFVSVIALGELTHWLRHRR* |
| Ga0120159_10102412 | 3300012014 | Permafrost | MLNVLAETAAQEGKKVIFAMLIVGLVFLSVIALGELTHWLRHRR* |
| Ga0120159_10742701 | 3300012014 | Permafrost | MLNVLAETAAQEGKKVIFAMLIVGLVFISVIALGELTHWLRHRR* |
| Ga0137383_101813262 | 3300012199 | Vadose Zone Soil | MAFALLNLLAASETAAQEGKKVIIAMLIVGLVFLGVIVLGETTHYLRQRRHR* |
| Ga0137382_106227151 | 3300012200 | Vadose Zone Soil | MLNVLAETAAQEGKKVIFAMLIVGLIFVSVIALGELTHWLRHRR* |
| Ga0137365_100108582 | 3300012201 | Vadose Zone Soil | MALAVLNLLAASETAAQEGKKVIIAMLIVGLVFLGVIVLGETTHYLRQRRHR* |
| Ga0137365_102908743 | 3300012201 | Vadose Zone Soil | MILAATAAEEGKKVIEAMLVVGLVFAGVIALGQFTHWLRHRRN* |
| Ga0137380_105063852 | 3300012206 | Vadose Zone Soil | MALALLNLLAASETAAQEGKKVIIAMLIVGLVFLGVIVLGETTHYLRQRRHR* |
| Ga0137381_112249301 | 3300012207 | Vadose Zone Soil | EGKKVIEAMLVVGLIFAGVIALGQFTHWLRHRRH* |
| Ga0137376_100547074 | 3300012208 | Vadose Zone Soil | MLNVLAETAAQEGKKVIFAMLIVGLIFVSVIALGVLTNWLRHRR* |
| Ga0137379_105238901 | 3300012209 | Vadose Zone Soil | MALAVLNLLVASETAAQEGKKVIIAMLIVGLVFLGVIVLGETTHYLRQRRHR* |
| Ga0137379_106969771 | 3300012209 | Vadose Zone Soil | MTLALLAATAAEEGKKVIEAMLVVGLIFAGVIALGQFTHWVRHRRH* |
| Ga0150985_1061460852 | 3300012212 | Avena Fatua Rhizosphere | ALMLPLAAKTAAQEGLDVIRAMLVVGLIFFGVIVLGELTHWLRHRRH* |
| Ga0137371_106136432 | 3300012356 | Vadose Zone Soil | MGLVLAATAAEEGKKVIEAMLVVGLIFAGVIALGQFTHWLRHRRH* |
| Ga0137385_102328822 | 3300012359 | Vadose Zone Soil | MALALLNLLAASETAAQEGNKVIIAMLIVGLVFLGVIVLGETTHYLRQRRHR* |
| Ga0150984_1129590871 | 3300012469 | Avena Fatua Rhizosphere | AAEEGKKVIFAMLITGLIFLSVIALGELTHWLRSRR* |
| Ga0150984_1129661612 | 3300012469 | Avena Fatua Rhizosphere | AAEEGKKVIFAMLITGLIFLSVIAVGELTHWLRSRR* |
| Ga0150984_1179663651 | 3300012469 | Avena Fatua Rhizosphere | AKTAAQEGLDVIRAMLVVGLIFFGVIVLGELTHWLRHRRH* |
| Ga0157328_10316081 | 3300012478 | Arabidopsis Rhizosphere | VLPLAAKTAAQEGKEVIEAMLVVGLIFLAVILLGE |
| Ga0157341_10012203 | 3300012494 | Arabidopsis Rhizosphere | MAPLGTLLPLAKTAAEEGKSVITAMLIVGLIFLGVIVLGELSRYL |
| Ga0157288_101766482 | 3300012901 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVILLGELTHWLRHRRH* |
| Ga0157308_101849841 | 3300012910 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFLAVIVLGELTHWL |
| Ga0157297_105282892 | 3300012914 | Soil | EEGKDVITAMLVVGLIFLGVIVVGELSKWLRHRR* |
| Ga0137394_107439883 | 3300012922 | Vadose Zone Soil | MLTVLAETAAQEGKKVIFAMLITGLVFLSVIALGELTHWLRHRR* |
| Ga0137394_116164391 | 3300012922 | Vadose Zone Soil | MLNVLAETAAQEGKKVIFAMLIVGLIFVSVIALCELTHWLRHRR* |
| Ga0164301_115179742 | 3300012960 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVVGELTHWLRHRRH* |
| Ga0164305_116458162 | 3300012989 | Soil | MTVLALVSPLAATAAEEGKKVIIAMLIVGLIFLGVIVRGETSRWVRHRRH* |
| Ga0157378_105705521 | 3300013297 | Miscanthus Rhizosphere | QEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRR* |
| Ga0157375_120078681 | 3300013308 | Miscanthus Rhizosphere | TAAQEGLDVIKAMLVVGLIFLSVIVLGELLHWLRHRRH* |
| Ga0120158_100257374 | 3300013772 | Permafrost | MLNVLAETAAQEGKKVIFAMLIVGLIFLSVIAVGELTHWLRHRR* |
| Ga0173483_107374881 | 3300015077 | Soil | TAAEEGKSVITAMLVVGLIFLGVIVLGELSRYLRHRRH* |
| Ga0173480_106276442 | 3300015200 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFLAVIVLGELTHWLRHRR* |
| Ga0137409_115791961 | 3300015245 | Vadose Zone Soil | MLNVLAETAAQEGKKVIFAMLIVGLIFVSVIALGELTHWLRH |
| Ga0182006_12173621 | 3300015261 | Rhizosphere | MLPLAAKTAAQEGLDVIRAMLVVGLIFASVIALGQ |
| Ga0182005_11814692 | 3300015265 | Rhizosphere | MSMLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHW |
| Ga0163161_113835302 | 3300017792 | Switchgrass Rhizosphere | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRR |
| Ga0184605_102854533 | 3300018027 | Groundwater Sediment | GSGRVAPMVLAAKTAAQEGLDVSRAMLVVGLAFLGVIVLGELSRRLRHRRH |
| Ga0184619_100232093 | 3300018061 | Groundwater Sediment | EEGKKVIEAMLVVGLVFAGVIALGQLTHWLRHRRH |
| Ga0184619_104690691 | 3300018061 | Groundwater Sediment | AEEGKSVITAMLVVGLIFLGVIVLGELSRYFRHRRH |
| Ga0184609_104686561 | 3300018076 | Groundwater Sediment | MAPLGSLLPLAAKTAAEEGKSVITAMLVVGLIFLSVIV |
| Ga0066662_124036591 | 3300018468 | Grasslands Soil | PGSIDFRVMLNVLAETAAQEGKKVIFAMLIVGLIFLSVIALGELTHWLRHRR |
| Ga0066669_108216312 | 3300018482 | Grasslands Soil | GKEVIEAMLVVGLIFVGVIALGQFLHWLRHRRRRA |
| Ga0066669_121054512 | 3300018482 | Grasslands Soil | MIVLAATAAEEGKKVIEAMLVVGLIFAGVIALGQFTHWVRHRRH |
| Ga0173481_104742262 | 3300019356 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFLAVIVLGELTHWLRHRR |
| Ga0193701_11055692 | 3300019875 | Soil | MLPLAAKTAAQEGLDVIKAMLVVGLIFLSVIVLGELLHWLRHRRH |
| Ga0193727_11091442 | 3300019886 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRQRRH |
| Ga0193751_11581983 | 3300019888 | Soil | MLNVLAETAAQEGKKVIFAMLIVGLIFLSVIAVGELAHWLR |
| Ga0193728_10399132 | 3300019890 | Soil | MMVLAATAAEEGKKVIEAMLVVGLIFAGVIALGQLTHWVRHRRH |
| Ga0193697_10011686 | 3300020005 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVILVGELTHWLRHRR |
| Ga0206356_106269091 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | ETAAEEGKKTILAMLIVGLIFLSVVAIGELTHWLRSKR |
| Ga0193694_10004863 | 3300021415 | Soil | VLLAAKTAAQEGKEVIEAMLIVGLIFLGVIVLGELTKWLRHRH |
| Ga0182009_102790223 | 3300021445 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFASVIALGQLTHWLRHRRH |
| Ga0182009_105433961 | 3300021445 | Soil | MLLAAKTAAQEGKEVIEAMLIVGLIFLGVILLGELSKWLRHRH |
| Ga0222622_102981442 | 3300022756 | Groundwater Sediment | ALMLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVVGELTHWLRHRR |
| Ga0222622_107356812 | 3300022756 | Groundwater Sediment | LPLAAKTAAQEGLDVIRAMLVVGLIFLGVILVGELTHWLRHRRH |
| Ga0222622_113134622 | 3300022756 | Groundwater Sediment | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVVGELTHWLRHRRH |
| Ga0207682_103330562 | 3300025893 | Miscanthus Rhizosphere | TAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRR |
| Ga0207642_108162231 | 3300025899 | Miscanthus Rhizosphere | AQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRRH |
| Ga0207688_101699913 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRSRRH |
| Ga0207684_109175421 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPLGVLAATAAEEGKKVIEAMLVVGLIFVGVIAVGQFTHWI |
| Ga0207693_108832691 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | TAAEEGLDVIRAMLIVGLIFASVIAIGQTVHWLRHRRHH |
| Ga0207646_105228442 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPLGVLAATAAEEGKKVIEAMLVVGLIFVGVIAVGQFTHWIRHRRH |
| Ga0207646_115321222 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLAAKTAAEEGLDVIRAMLIVGLIFASVIAIGQTVHWLRHRRHH |
| Ga0207669_111001212 | 3300025937 | Miscanthus Rhizosphere | ALMLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRR |
| Ga0207702_104258792 | 3300026078 | Corn Rhizosphere | AAKTAAQEGKEVIEAMLVVGLIFLGVILLGELSKWRRHRR |
| Ga0207676_107613803 | 3300026095 | Switchgrass Rhizosphere | MSMLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHR |
| Ga0209474_106472052 | 3300026550 | Soil | AEEGKKVIEAMLVVGLVFAGVIALGQFTHWFRHRRH |
| Ga0208981_10607042 | 3300027669 | Forest Soil | MLNVLAETAAQEGKKVIFAMLIVGLIFLSVIALGELTHWLRHRR |
| Ga0209811_100870213 | 3300027821 | Surface Soil | MLPLAAKTAAQEGLDVIKAMLVVGLIFLSVIVLGELVHWLRHRRH |
| Ga0247663_10446891 | 3300028145 | Soil | VLPLAAKTAAQEGKEVIEAMLVVGLIFLAVILLGEFS |
| Ga0247682_10259791 | 3300028146 | Soil | VLPLAAKTAAQEGKEVIEAMLVVGLIFLAVILLGEFSKWLRHRR |
| Ga0268265_110051912 | 3300028380 | Switchgrass Rhizosphere | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRRSGHGAAGRRP |
| Ga0307291_11921452 | 3300028707 | Soil | MMVLAATAAEEGKKVIEAMLVVGLIFAGVIALGQFTHWVRHRRH |
| Ga0307293_101180102 | 3300028711 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFLSVIVLGELLHWLRHRRH |
| Ga0307285_101476382 | 3300028712 | Soil | EEGKSVITAMLVVGLIFLGVIVLGELSRYLRHRRH |
| Ga0307311_102160881 | 3300028716 | Soil | VLLAAKTAAQEGKEVIEAMLIVGLIFLGVIVLGELTKW |
| Ga0307307_101240921 | 3300028718 | Soil | AQEGLDVIRAMLVVGLIFAGVITLGQLTHWLRHRRH |
| Ga0307301_100523061 | 3300028719 | Soil | MVLAAKTAAQEGLDVIRGMLVVGLIFLSVIVLGELTHWLRRRRH |
| Ga0307317_102259952 | 3300028720 | Soil | AQEGLDVIRAMLVVGLIFLGVILVGELTHWLRHRRH |
| Ga0307319_1000010122 | 3300028722 | Soil | MVLAAKTAAQEGLDVIRGMLVVGLIFLSVIVLGELTHWLRRRRQ |
| Ga0307318_100027558 | 3300028744 | Soil | LAAKTAAQEGLDVIRGMLVVGLIFLSVIVLGELTHWLRRRRH |
| Ga0307283_100813781 | 3300028790 | Soil | AAKTAAQEGLDVIKAMLVVGLIFLSVIVLGELLHWLRHRRH |
| Ga0307287_103691521 | 3300028796 | Soil | MVLAAKTAAQEGLDVIEAMLVVGLIFLGVIVLGEVSRRLRH |
| Ga0307289_104821371 | 3300028875 | Soil | MMVLAATAAEEGKKVIEAMLVVGLIFAGVIALGQFTHWVRHRQH |
| Ga0307278_100319841 | 3300028878 | Soil | TEGKKVITGMLIVGLIFLGVIVLGETTHWLRHRRR |
| Ga0307278_102455852 | 3300028878 | Soil | ATEGKKVITGMLIVGLIFLGVIVLGETTHWLRHRRR |
| Ga0307277_1000030521 | 3300028881 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFASVIAVGQTIHWLRRRNH |
| Ga0307308_101405542 | 3300028884 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFAGVITLGQLTHWLRHRRH |
| Ga0247826_106272112 | 3300030336 | Soil | QEGLDVIRAMLVVGLIFLGVIVLGELTHWLRHRRH |
| Ga0268241_100616452 | 3300030511 | Soil | VPLAGLIPLAAKTSAQEGLDVIRAMLIVGLVFLGVILLGELSKWLRHRR |
| Ga0310886_106145781 | 3300031562 | Soil | MLPLAAKTAAQEGKEVIEAMLVVGLIFLAVILLGEFSKWLRHR |
| Ga0310813_105302373 | 3300031716 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFLAVIVLGELTHWLRHRHR |
| Ga0310884_107893471 | 3300031944 | Soil | MLPLAAKTAAQEGLDVIRAMLVVGLIFLGVIVVGELTHWLRSRRH |
| Ga0307479_106903732 | 3300031962 | Hardwood Forest Soil | MLNVLAETAAQEGKKVIFAMLIVGLIFLSVIAVGELAHWLRHRR |
| Ga0307470_103307322 | 3300032174 | Hardwood Forest Soil | MAPLGFLLPLAAKTAAEEGKSVITAMLVVGLIFLGVIV |
| Ga0335072_108441052 | 3300032898 | Soil | AADGLHVITAMLIVGLIFLSVIGLGELTHWLNSRRHARKRSLRPY |
| Ga0335077_107988342 | 3300033158 | Soil | VIPLAVKTAAQEGKEVITAMLVVGLIFVGVIAIGQTLHWLRHRRRSRST |
| Ga0372946_0068377_1398_1532 | 3300034384 | Soil | VLHVLAATAADEGKKVVFAMLITGLIFVSVIVLGELTHWLRHRR |
| ⦗Top⦘ |