| Basic Information | |
|---|---|
| Family ID | F045058 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 46 residues |
| Representative Sequence | GLDPQALSPLTFNIGTGSIEKVSRIRDKYNLTESYTSDYEPTGYTGR |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 3.29 % |
| % of genes near scaffold ends (potentially truncated) | 95.42 % |
| % of genes from short scaffolds (< 2000 bps) | 90.20 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (57.516 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (18.954 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.405 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.477 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.67% β-sheet: 0.00% Coil/Unstructured: 85.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.16 % |
| Unclassified | root | N/A | 24.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002161|JGI24766J26685_10117913 | Not Available | 561 | Open in IMG/M |
| 3300002387|B570J29608_1005312 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 834 | Open in IMG/M |
| 3300003412|JGI25912J50252_10053187 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1102 | Open in IMG/M |
| 3300003413|JGI25922J50271_10051295 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 926 | Open in IMG/M |
| 3300003430|JGI25921J50272_10027049 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1464 | Open in IMG/M |
| 3300003430|JGI25921J50272_10080392 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 703 | Open in IMG/M |
| 3300003650|SLW30_106225 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1019 | Open in IMG/M |
| 3300004054|Ga0063232_10065800 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 978 | Open in IMG/M |
| 3300004096|Ga0066177_10313406 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 668 | Open in IMG/M |
| 3300004096|Ga0066177_10521833 | Not Available | 527 | Open in IMG/M |
| 3300004124|Ga0066178_10048944 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
| 3300004124|Ga0066178_10196353 | Not Available | 578 | Open in IMG/M |
| 3300004126|Ga0066179_10043776 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1022 | Open in IMG/M |
| 3300004240|Ga0007787_10451555 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 642 | Open in IMG/M |
| 3300004795|Ga0007756_11386520 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 731 | Open in IMG/M |
| 3300004797|Ga0007764_11447769 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1007 | Open in IMG/M |
| 3300005517|Ga0070374_10206090 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1011 | Open in IMG/M |
| 3300005517|Ga0070374_10580814 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 557 | Open in IMG/M |
| 3300005517|Ga0070374_10684917 | Not Available | 507 | Open in IMG/M |
| 3300005525|Ga0068877_10162385 | All Organisms → Viruses → Predicted Viral | 1359 | Open in IMG/M |
| 3300005581|Ga0049081_10255787 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 613 | Open in IMG/M |
| 3300005584|Ga0049082_10145603 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 822 | Open in IMG/M |
| 3300005584|Ga0049082_10165725 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 763 | Open in IMG/M |
| 3300005662|Ga0078894_11723388 | Not Available | 513 | Open in IMG/M |
| 3300005805|Ga0079957_1136766 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1268 | Open in IMG/M |
| 3300006639|Ga0079301_1067328 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1133 | Open in IMG/M |
| 3300006639|Ga0079301_1080902 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300006875|Ga0075473_10066591 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1405 | Open in IMG/M |
| 3300006917|Ga0075472_10369590 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 709 | Open in IMG/M |
| 3300007545|Ga0102873_1126884 | Not Available | 769 | Open in IMG/M |
| 3300007559|Ga0102828_1172721 | Not Available | 547 | Open in IMG/M |
| 3300007561|Ga0102914_1083326 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1001 | Open in IMG/M |
| 3300007562|Ga0102915_1074398 | Not Available | 1116 | Open in IMG/M |
| 3300007585|Ga0102916_1157161 | Not Available | 615 | Open in IMG/M |
| 3300007627|Ga0102869_1167616 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 591 | Open in IMG/M |
| 3300007642|Ga0102876_1041704 | Not Available | 1289 | Open in IMG/M |
| 3300007692|Ga0102823_1096758 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 783 | Open in IMG/M |
| 3300007706|Ga0102899_1169266 | Not Available | 546 | Open in IMG/M |
| 3300007860|Ga0105735_1001693 | All Organisms → Viruses → Predicted Viral | 2691 | Open in IMG/M |
| 3300007972|Ga0105745_1024774 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1533 | Open in IMG/M |
| 3300007974|Ga0105747_1302960 | Not Available | 541 | Open in IMG/M |
| 3300008108|Ga0114341_10467663 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 581 | Open in IMG/M |
| 3300008108|Ga0114341_10537066 | Not Available | 519 | Open in IMG/M |
| 3300008110|Ga0114343_1228183 | Not Available | 515 | Open in IMG/M |
| 3300008113|Ga0114346_1128475 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1116 | Open in IMG/M |
| 3300008116|Ga0114350_1179446 | Not Available | 546 | Open in IMG/M |
| 3300008120|Ga0114355_1034819 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2458 | Open in IMG/M |
| 3300008120|Ga0114355_1113166 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300008120|Ga0114355_1203174 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 635 | Open in IMG/M |
| 3300008261|Ga0114336_1035715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3459 | Open in IMG/M |
| 3300008261|Ga0114336_1215077 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 796 | Open in IMG/M |
| 3300009026|Ga0102829_1150658 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 744 | Open in IMG/M |
| 3300009080|Ga0102815_10604026 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 617 | Open in IMG/M |
| 3300009159|Ga0114978_10306473 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 971 | Open in IMG/M |
| 3300009180|Ga0114979_10198280 | All Organisms → Viruses → Predicted Viral | 1216 | Open in IMG/M |
| 3300009181|Ga0114969_10347304 | Not Available | 863 | Open in IMG/M |
| 3300009419|Ga0114982_1009224 | All Organisms → Viruses → Predicted Viral | 3540 | Open in IMG/M |
| 3300009419|Ga0114982_1112532 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 840 | Open in IMG/M |
| 3300010312|Ga0102883_1029608 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1646 | Open in IMG/M |
| 3300010354|Ga0129333_10679270 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 887 | Open in IMG/M |
| 3300011010|Ga0139557_1062210 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 627 | Open in IMG/M |
| 3300011184|Ga0136709_1011945 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1226 | Open in IMG/M |
| 3300011268|Ga0151620_1009783 | All Organisms → Viruses → Predicted Viral | 3452 | Open in IMG/M |
| 3300011268|Ga0151620_1200152 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 604 | Open in IMG/M |
| 3300012000|Ga0119951_1043803 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1331 | Open in IMG/M |
| 3300012665|Ga0157210_1017548 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1178 | Open in IMG/M |
| 3300012667|Ga0157208_10018208 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 947 | Open in IMG/M |
| 3300012706|Ga0157627_1201992 | Not Available | 570 | Open in IMG/M |
| 3300012719|Ga0157600_1142597 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 922 | Open in IMG/M |
| 3300013004|Ga0164293_10639865 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 687 | Open in IMG/M |
| 3300013092|Ga0163199_1058745 | All Organisms → Viruses → Predicted Viral | 1711 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10292175 | All Organisms → Viruses → Predicted Viral | 1166 | Open in IMG/M |
| 3300014050|Ga0119952_1028741 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1729 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10515599 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 667 | Open in IMG/M |
| 3300017761|Ga0181356_1117742 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 851 | Open in IMG/M |
| 3300017788|Ga0169931_10650100 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 704 | Open in IMG/M |
| 3300020162|Ga0211735_10281410 | All Organisms → Viruses → Predicted Viral | 2520 | Open in IMG/M |
| 3300020205|Ga0211731_10542046 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1306 | Open in IMG/M |
| 3300020220|Ga0194119_10173199 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1567 | Open in IMG/M |
| 3300020549|Ga0207942_1044246 | Not Available | 550 | Open in IMG/M |
| 3300020603|Ga0194126_10181988 | All Organisms → Viruses → Predicted Viral | 1535 | Open in IMG/M |
| 3300021961|Ga0222714_10463324 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 657 | Open in IMG/M |
| 3300021962|Ga0222713_10108254 | All Organisms → Viruses → Predicted Viral | 1979 | Open in IMG/M |
| 3300022748|Ga0228702_1143124 | Not Available | 526 | Open in IMG/M |
| 3300023179|Ga0214923_10099322 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1971 | Open in IMG/M |
| 3300024343|Ga0244777_10183935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1344 | Open in IMG/M |
| 3300024346|Ga0244775_10466018 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1034 | Open in IMG/M |
| 3300024346|Ga0244775_10524010 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 966 | Open in IMG/M |
| 3300024346|Ga0244775_11463094 | Not Available | 523 | Open in IMG/M |
| 3300024355|Ga0255157_1009015 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1816 | Open in IMG/M |
| 3300024514|Ga0255177_1046664 | Not Available | 741 | Open in IMG/M |
| 3300024559|Ga0255284_1049392 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 908 | Open in IMG/M |
| 3300024564|Ga0255237_1111115 | Not Available | 622 | Open in IMG/M |
| 3300024574|Ga0255275_1074507 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 945 | Open in IMG/M |
| 3300024866|Ga0255272_1068800 | Not Available | 893 | Open in IMG/M |
| 3300025091|Ga0209616_1022129 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 644 | Open in IMG/M |
| 3300026455|Ga0255155_1014459 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1443 | Open in IMG/M |
| 3300027114|Ga0208009_1010236 | All Organisms → Viruses → Predicted Viral | 2328 | Open in IMG/M |
| 3300027114|Ga0208009_1021907 | All Organisms → Viruses → Predicted Viral | 1419 | Open in IMG/M |
| 3300027123|Ga0255090_1040615 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 717 | Open in IMG/M |
| 3300027127|Ga0255071_1004269 | All Organisms → Viruses → Predicted Viral | 2521 | Open in IMG/M |
| 3300027141|Ga0255076_1053462 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 685 | Open in IMG/M |
| 3300027216|Ga0208677_1054251 | Not Available | 526 | Open in IMG/M |
| 3300027311|Ga0208812_1001830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4558 | Open in IMG/M |
| 3300027487|Ga0255091_1072339 | Not Available | 508 | Open in IMG/M |
| 3300027489|Ga0255095_1090162 | Not Available | 515 | Open in IMG/M |
| 3300027499|Ga0208788_1017492 | All Organisms → Viruses → Predicted Viral | 2373 | Open in IMG/M |
| 3300027499|Ga0208788_1038674 | All Organisms → Viruses → Predicted Viral | 1346 | Open in IMG/M |
| 3300027563|Ga0209552_1173259 | Not Available | 546 | Open in IMG/M |
| 3300027579|Ga0255068_103231 | All Organisms → Viruses → Predicted Viral | 2149 | Open in IMG/M |
| 3300027586|Ga0208966_1029078 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1614 | Open in IMG/M |
| 3300027627|Ga0208942_1022938 | All Organisms → Viruses → Predicted Viral | 2009 | Open in IMG/M |
| 3300027659|Ga0208975_1201056 | Not Available | 532 | Open in IMG/M |
| 3300027688|Ga0209553_1008520 | All Organisms → Viruses → Predicted Viral | 4654 | Open in IMG/M |
| 3300027688|Ga0209553_1062439 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
| 3300027697|Ga0209033_1075813 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1145 | Open in IMG/M |
| 3300027744|Ga0209355_1092749 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1378 | Open in IMG/M |
| 3300027754|Ga0209596_1158229 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1002 | Open in IMG/M |
| 3300027769|Ga0209770_10076831 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1394 | Open in IMG/M |
| 3300027769|Ga0209770_10134153 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1005 | Open in IMG/M |
| 3300027769|Ga0209770_10311089 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 599 | Open in IMG/M |
| 3300027782|Ga0209500_10030033 | All Organisms → Viruses → Predicted Viral | 3073 | Open in IMG/M |
| 3300027797|Ga0209107_10409004 | Not Available | 617 | Open in IMG/M |
| 3300027805|Ga0209229_10145265 | All Organisms → Viruses → Predicted Viral | 1069 | Open in IMG/M |
| 3300027808|Ga0209354_10215391 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 777 | Open in IMG/M |
| 3300027892|Ga0209550_10808084 | Not Available | 525 | Open in IMG/M |
| 3300028073|Ga0255180_1092241 | Not Available | 540 | Open in IMG/M |
| 3300028178|Ga0265593_1134705 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 641 | Open in IMG/M |
| 3300031758|Ga0315907_11296035 | Not Available | 503 | Open in IMG/M |
| 3300031758|Ga0315907_11299173 | Not Available | 502 | Open in IMG/M |
| 3300031784|Ga0315899_10946193 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 772 | Open in IMG/M |
| 3300031784|Ga0315899_11085067 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 704 | Open in IMG/M |
| 3300031787|Ga0315900_10622033 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 784 | Open in IMG/M |
| 3300031787|Ga0315900_10633425 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 773 | Open in IMG/M |
| 3300031857|Ga0315909_10358373 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1063 | Open in IMG/M |
| 3300031951|Ga0315904_11025578 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 651 | Open in IMG/M |
| 3300031963|Ga0315901_10569046 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 867 | Open in IMG/M |
| 3300031963|Ga0315901_10970377 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 597 | Open in IMG/M |
| 3300031963|Ga0315901_11200967 | Not Available | 514 | Open in IMG/M |
| 3300032050|Ga0315906_10627362 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 879 | Open in IMG/M |
| 3300032050|Ga0315906_11257917 | Not Available | 531 | Open in IMG/M |
| 3300032092|Ga0315905_11255572 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 600 | Open in IMG/M |
| 3300033557|Ga0316617_102639353 | Not Available | 522 | Open in IMG/M |
| 3300034062|Ga0334995_0211855 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1337 | Open in IMG/M |
| 3300034064|Ga0335001_0427058 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 709 | Open in IMG/M |
| 3300034066|Ga0335019_0351775 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 912 | Open in IMG/M |
| 3300034066|Ga0335019_0791890 | Not Available | 536 | Open in IMG/M |
| 3300034092|Ga0335010_0407363 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 741 | Open in IMG/M |
| 3300034101|Ga0335027_0225000 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1314 | Open in IMG/M |
| 3300034122|Ga0335060_0435002 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 687 | Open in IMG/M |
| 3300034167|Ga0335017_0445013 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 695 | Open in IMG/M |
| 3300034283|Ga0335007_0546865 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 682 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.11% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 10.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.15% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 9.15% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.54% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 5.23% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.61% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.96% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.31% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.31% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.31% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.31% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.31% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.65% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.65% |
| Subglacial Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.65% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.65% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002387 | Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003650 | Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 3.0 micron filter | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
| 3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012719 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024355 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300024514 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d | Environmental | Open in IMG/M |
| 3300024559 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024564 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024574 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026455 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027127 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027216 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027311 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027487 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300027489 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027579 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028073 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d | Environmental | Open in IMG/M |
| 3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24766J26685_101179134 | 3300002161 | Freshwater And Sediment | IGSLTFNIGTGSIEKVSNIRDKYNLTETYTSDYEPTGY* |
| B570J29608_10053124 | 3300002387 | Freshwater | DPQALTPLTFNIGTGSIEKVSRIRDKYNLTESYTSDYEPTGYTGR* |
| JGI25912J50252_100531871 | 3300003412 | Freshwater Lake | GLDPTAMSPLTFNVGTGSIEKVSKIRDKHNLIESYTSDYEPTGYMRR* |
| JGI25922J50271_100512952 | 3300003413 | Freshwater Lake | LGCTNHRAEAMSPLTFNIGTGSIEKVSRIRDKYNLTESYWSDKEATGYKER* |
| JGI25921J50272_100270495 | 3300003430 | Freshwater Lake | AYWDAQITGLDPQAMSPLTFNIGTGSIEKVSRIRDKYNLTESYISDYETTGY* |
| JGI25921J50272_100803921 | 3300003430 | Freshwater Lake | TGLDPQRIAPLTFNIGTGSIEKVSRIRDKYNLIESYTSEYEPTGYTGR* |
| SLW30_1062251 | 3300003650 | Subglacial Freshwater | LLTFNIGTGSIEKVSNLRDKHNLTEIYVSEYETTGYTGR* |
| Ga0063232_100658004 | 3300004054 | Freshwater Lake | PTAMSPLTFNVGTGSIEKVSKIRDKYNLIESYTSDYEPTGYTRR* |
| Ga0066177_103134064 | 3300004096 | Freshwater Lake | WDAQIIGLDPTAMSPLTFNVGTGSIEKVSKIRDKHNLIESYTSDYEPTGYMRR* |
| Ga0066177_105218331 | 3300004096 | Freshwater Lake | MTIAPLTFNIGTGSIEKVSRLRDKYNLIESYTSEYEPTGYTGR* |
| Ga0066178_100489441 | 3300004124 | Freshwater Lake | PLTFNIGTGSIEKVSRIRDKYNLTESYTSEYEPTGYTGR* |
| Ga0066178_101963533 | 3300004124 | Freshwater Lake | WDAQIIGLDPTAMSPLTFNVGTGSIEKVSKIRDKYNLTESYTSDYEPTGYTRR* |
| Ga0066179_100437764 | 3300004126 | Freshwater Lake | WDAQIIGLDPTAMSPLTFNVGTGSIEKVSKIRDKYNLIESYTSDYEPTGYTRR* |
| Ga0007787_104515553 | 3300004240 | Freshwater Lake | MAYWDAQIMGLDPQALSPLTFNIGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTRR* |
| Ga0007756_113865201 | 3300004795 | Freshwater Lake | YWDAQIMGLDPQALTPLTFNIGTGSIEKVSRIRDKYNLTESYTSDYEPTGYTGR* |
| Ga0007764_114477694 | 3300004797 | Freshwater Lake | MGLDPQALTPLTFNIGTGSIEKVSRIRDKYNLTESYTSDYEPTGYTGR* |
| Ga0070374_102060904 | 3300005517 | Freshwater Lake | AYWDAQIIGLDPTAMSPLTFNVGTGSIEKVSKIRDKYNLTESYTSDYEPTGYTRR* |
| Ga0070374_105808141 | 3300005517 | Freshwater Lake | DPMTIAPLTFNIGTGSIEKVSRLRDKYNLIESYTSEYEPTGYTGR* |
| Ga0070374_106849173 | 3300005517 | Freshwater Lake | FNIGTGSIEKVSRIRDKYNLTESYVSDYEPTGYTGR* |
| Ga0068877_101623855 | 3300005525 | Freshwater Lake | LDPQVLSPLTFNIGTGNIEKVSRIRDKYNLIESYTSDYEPTGYTRR* |
| Ga0049081_102557874 | 3300005581 | Freshwater Lentic | ALSPLTFNIGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTGR* |
| Ga0049082_101456034 | 3300005584 | Freshwater Lentic | MSPLTFNVGTGSIEKVSKIRDKHNLIESYTSDYEPTGYMRR* |
| Ga0049082_101657254 | 3300005584 | Freshwater Lentic | DPTAMSPLTFNVGTGNIEKVSRIRDKHNLKETYVSQYEPTGYRC* |
| Ga0078894_117233881 | 3300005662 | Freshwater Lake | TALSPLTFNIGTGSIEKVSRIRDKYNLVESYTSDYEPTGYTRR* |
| Ga0079957_11367664 | 3300005805 | Lake | MGLDPQALSPLTFNIGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTRR* |
| Ga0079301_10673281 | 3300006639 | Deep Subsurface | YWDAQIIGLDPVAMSPLTFNIGTGSIEKVSKIRDKYNLVESYVSDYEPTGYTGR* |
| Ga0079301_10809021 | 3300006639 | Deep Subsurface | YWDAQIIGLDPVAMSPLTFNIGTGSIEKVSKIRDKYNLVESYISDYEPTGYTGR* |
| Ga0075473_100665911 | 3300006875 | Aqueous | PLTFNIGTGSIEKVSRIRDKFNLVESYVSDYEPTGYIRS* |
| Ga0075472_103695901 | 3300006917 | Aqueous | YWDAQVMGLDPQALTPLTFNIGTGSIEKVSRIRDKYNLKETYISDYEPTGYTGR* |
| Ga0102873_11268841 | 3300007545 | Estuarine | PQALTPLTFNIGTGSIEKVSRIRDKYNLTESYTSDYEPTGYTGR* |
| Ga0102828_11727213 | 3300007559 | Estuarine | AEINGLDPQRMAPLTFNIGTGSIEKVSRLRDKYNLTESYISDYETTGY* |
| Ga0102914_10833264 | 3300007561 | Estuarine | IKNGSIEKVSRIRDKYNLTESYVSDYEPTGYTGR* |
| Ga0102915_10743981 | 3300007562 | Estuarine | TPLTFNIGTGSIEKVSRIRDKYNLSESYVSEYEATGYTGR* |
| Ga0102916_11571611 | 3300007585 | Estuarine | DPEQCGPLTFNIGTGSIEKVSRIRDKYNLIESYVSDSKVTGY* |
| Ga0102869_10909974 | 3300007627 | Estuarine | PLTFNIGTGSIEKVSRIRDKFNLKETYLADYEPNHPYQKE* |
| Ga0102869_11676164 | 3300007627 | Estuarine | GLDPEAMSALTFNIGTGSIEKVSRIRDKYNLIESYVSDSKVTGY* |
| Ga0102876_10417045 | 3300007642 | Estuarine | TGLDPQALTPLTFNIGTGSIEKVSRIRDKYNLTESYTSDYEPTGYTGR* |
| Ga0102823_10967584 | 3300007692 | Estuarine | TIAPLTFNIGTGSIEKVSRIRDKYNLTESYVSDYEPTGYTGR* |
| Ga0102899_11692663 | 3300007706 | Estuarine | LTFNIGTGSIEKVSRIRDKYNLIESYTSEYESTGY* |
| Ga0105735_10016939 | 3300007860 | Estuary Water | LTFNIGTGSIEKVSRLRDKYNLIESYVSDSKVTGY* |
| Ga0105745_10247745 | 3300007972 | Estuary Water | PTAMSPLTFNVGTGNIEKVSRIRDKHNLKETYVSQYEPTGYRC* |
| Ga0105747_13029601 | 3300007974 | Estuary Water | AQMIGLDPTALSPLTFNIGTGSIEKVSRIRDKYNLVESYTSDYEPTGYTRR* |
| Ga0114341_104676633 | 3300008108 | Freshwater, Plankton | APLTFNIGTGSIEKVSRIRDKYNLIESYTSDYEPTGYTGR* |
| Ga0114341_105370661 | 3300008108 | Freshwater, Plankton | AIGPLTFNIGTGSIEKVSNLRDKHNLTESYTSQYENTGY* |
| Ga0114343_12281831 | 3300008110 | Freshwater, Plankton | WDAQVLGLDPVALTPLTFNIGTGNIEKVSRLRDKYNLIESYTSDYEPTGYTRR* |
| Ga0114346_11284751 | 3300008113 | Freshwater, Plankton | VAIAPLTFNIGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTGR* |
| Ga0114350_11794461 | 3300008116 | Freshwater, Plankton | TFNIGTGSIEKVSSIRDTYNLKETYVSDYEPTGYTRR* |
| Ga0114355_10348197 | 3300008120 | Freshwater, Plankton | FWSAEMMGLDPMLIAPLTFNIGTGSIEKVSSIRDTYNLKETYVSDYEPTGYTRR* |
| Ga0114355_11131664 | 3300008120 | Freshwater, Plankton | SPLTFNVGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTRR* |
| Ga0114355_12031741 | 3300008120 | Freshwater, Plankton | SPLTFNVGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTGR* |
| Ga0114336_10357151 | 3300008261 | Freshwater, Plankton | TFNIGTGSIEKVSRIRDKYNLTESYISDYEPTGYTGR* |
| Ga0114336_12150774 | 3300008261 | Freshwater, Plankton | AQITGLDPEFMPPLTFNVGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTRR* |
| Ga0102829_11506581 | 3300009026 | Estuarine | QRMAPLTFNIGTGSIEKVSRLRDKYNLTESYISDYETTGY* |
| Ga0102815_106040261 | 3300009080 | Estuarine | AMSPLTFNIGTGSIEKVSKIRDKYNLTESYISDYETTGY* |
| Ga0114978_103064731 | 3300009159 | Freshwater Lake | ITGLDPQAMSPLTFNIGTGSIEKVSRLRDKYNLIESYVSDYETTGY* |
| Ga0114979_101982801 | 3300009180 | Freshwater Lake | TFNIGTGSIEKVSRIRDKYNLIESYTSDYEPTGYTGR* |
| Ga0114969_103473042 | 3300009181 | Freshwater Lake | MAYWDAQMIGLDPHALTPLTFNIGTGSIEKVSRIRDKYNLTESYISD |
| Ga0114982_100922412 | 3300009419 | Deep Subsurface | MAYWDAQITGLDPEAMSPLTFNIGTGSIEKVSRIRDKYNLTESYWSDREATGYKEK* |
| Ga0114982_11125324 | 3300009419 | Deep Subsurface | LTFNIGTGSIEKVSRIRDKYNLTESYWSEKEATGY* |
| Ga0102883_10296086 | 3300010312 | Estuarine | DPMTIAPLTFNIGTGSIEKVSRIRDKYNLTESYISDYEPTGYTGR* |
| Ga0129333_106792701 | 3300010354 | Freshwater To Marine Saline Gradient | MMGLDPMLIAPLTFNIGTGSIEKVSSIRDTYNLKETYVSDYEPTGYTRS* |
| Ga0139557_10622101 | 3300011010 | Freshwater | GLDPQALSPLTFNIGTGSIEKVSRIRDKYNLTESYTSDYEPTGYTGR* |
| Ga0136709_10119454 | 3300011184 | Freshwater | APLTFNIGTGSIEKVSRIRDKYNLTESYVSDYEPTGYTGR* |
| Ga0151620_100978312 | 3300011268 | Freshwater | PLTFNIGTGSIEKVSRLRDKYNLTESYISDYETTGY* |
| Ga0151620_12001521 | 3300011268 | Freshwater | RMAPLTFNIGTGSIEKVSRLRDKYNLTESYISDYETTGY* |
| Ga0119951_10438031 | 3300012000 | Freshwater | VMGLDPQALTPLTFNIGTGSIEKVSRIRDKYNLTESYVSDYEPTGYTGR* |
| Ga0157210_10175481 | 3300012665 | Freshwater | DAQVMGLDPQALSPLTFNIGTGSIEKVSRIRDKYNLTESYVSDYEPTGYTGR* |
| Ga0157208_100182084 | 3300012667 | Freshwater | EMIGLDPQTIAPLTFNIGTGSIEKVSRIRDKYNLVESYTSDYEPTGYTGR* |
| Ga0157627_12019924 | 3300012706 | Freshwater | IGLDPQAMSALTFNVGTGSIEKVSRIRDKHGLTESYVSNYEPTGYTRR* |
| Ga0157600_11425974 | 3300012719 | Freshwater | AYWDAQMIGLDPQAMSALTFNVGTGSIEKVSRIRDKHGLTESYVSNYEPTGYTRR* |
| Ga0164293_106398651 | 3300013004 | Freshwater | MSPLTFNVGTGSIEKVSKIRDKYNLTESYTSDYEPTGYTRR* |
| Ga0163199_10587455 | 3300013092 | Freshwater | EMAYWDAQITGLDPTFMPPLTFNVGTGSIEKVSRIRDKYNLTESYVSEYETTGY* |
| (restricted) Ga0172372_102921751 | 3300013132 | Freshwater | FNIGTGSIEKVSRIRDKHDLKETYVSDHEPTGYTRR* |
| Ga0119952_10287411 | 3300014050 | Freshwater | YWDAQMMGLDPMALTPLTFNIGTGSIEKVSRIRDKYNLIESYTSDYEPTGYTGR* |
| (restricted) Ga0172376_105155994 | 3300014720 | Freshwater | GALTFNIGTGSIEKVSRIRDKHDLKETYVSDHEPTGYTRR* |
| Ga0181356_11177424 | 3300017761 | Freshwater Lake | IGLDPTAISPLTFNIGTGSIEKVSRIRDKYNLIESYTSDYEPTGYTGR |
| Ga0169931_106501004 | 3300017788 | Freshwater | NIGTGSIEKVSRIRDKHDLKETYVSDHEPTGYTRR |
| Ga0211735_102814101 | 3300020162 | Freshwater | TFNIGTGSIEKVTHLCGKYNLTEAYVSEFEPTGYTRS |
| Ga0211731_105420461 | 3300020205 | Freshwater | QMIGLDPTALSPLTFNIGTGSIEKVSKIRDKHNLIESYVSDYEPTGYTRR |
| Ga0194119_101731995 | 3300020220 | Freshwater Lake | YWDAQIIGLDPNIIGPLTFNVGTGNIEKVSRIRDKFNLTETYTSDYEPTGYTRR |
| Ga0207942_10442464 | 3300020549 | Freshwater | LTFNIGTGSIEKVSKIRDKYNLIESYTSDYEPTGYTRR |
| Ga0194126_101819881 | 3300020603 | Freshwater Lake | AQIIGLDPNIIGPLTFNVGTGNIEKVSRIRDKFNLTETYTSDYEPTGYTRR |
| Ga0222714_104633244 | 3300021961 | Estuarine Water | LDPQALTPLTFNIGTGSIEKVSRLRDKYNLIESYTSDYEPTGYTGR |
| Ga0222713_101082544 | 3300021962 | Estuarine Water | MEMAYWDAQITGLDPVAIAPLTFNIGTGSIEKVSRIRDKFNLKETYVSDYEPTGY |
| Ga0228702_11431241 | 3300022748 | Freshwater | ARATWEAELLGLDPQAMTSLTFNIGTGSIEKVSRLRDKYNLVESYTSEYETTGY |
| Ga0214923_100993221 | 3300023179 | Freshwater | MALTPLTFNIGTGSIEKVSRIRDKYNLIESYTSDYEPTGYTGR |
| Ga0244777_101839354 | 3300024343 | Estuarine | MAYWDAQIVGLDPHVLSALTFNVGTGSIEKVSKIRDKHNLIESYVSDYEP |
| Ga0244775_104660184 | 3300024346 | Estuarine | DAQMIGLDPTALSPLTFNIGTGSIEKVSRIRDKYNLIESYTSDYEPTGYTGR |
| Ga0244775_105240104 | 3300024346 | Estuarine | GLDPTALSPLTFNIGTGSIEKVSRIRDKYNLVESYTSDYEPTGYTRR |
| Ga0244775_114630944 | 3300024346 | Estuarine | NIGTGSIEKVSKIRDKYNLKETYTSDYEPTGYTGR |
| Ga0255157_10090151 | 3300024355 | Freshwater | AYWDAQIMGLDPQAMTPLTFNIGTGSIEKVSRIRDKFNLTETYVSEYEETGYTRR |
| Ga0255177_10466641 | 3300024514 | Freshwater | DPLHIKDTLTFEIGTGSIEKVSRIRDKYNLTESYTSEYEPTGYRR |
| Ga0255284_10493921 | 3300024559 | Freshwater | PLTFNIGTGSIEKVSRIRDKFNLKETYVSDYEPTGYMRR |
| Ga0255237_11111153 | 3300024564 | Freshwater | MGLDPQAIAPLTFNIGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTGR |
| Ga0255275_10745071 | 3300024574 | Freshwater | IIGTGSIEKVSSIRDTYNLKETYVSNYEPTGYTRR |
| Ga0255272_10688001 | 3300024866 | Freshwater | KDTLTFEIGTGSIEKVSRIRDKYNLTESYTSEYEPTGYRR |
| Ga0209616_10221294 | 3300025091 | Freshwater | AYWDAQMIGLDPTALSPLTFNIGTGSIEKVSRIRDKYNLTESYVSDYEPTGYTGR |
| Ga0255155_10144595 | 3300026455 | Freshwater | MGLDPQAMTPLTFNIGTGSIEKVSRIRDKFNLTETYVSEYEETGYTRR |
| Ga0208009_10102369 | 3300027114 | Deep Subsurface | GLDPVAMSPLTFNIGTGSIEKVSKIRDKYNLVESYISDYEPTGYTGR |
| Ga0208009_10219075 | 3300027114 | Deep Subsurface | GLDPVAMSPLTFNIGTGSIEKVSKIRDKYNLVESYVSDYEPTGYTGR |
| Ga0255090_10406154 | 3300027123 | Freshwater | AQIMGLDPQAIAPLTFNIGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTGR |
| Ga0255071_10042691 | 3300027127 | Freshwater | APLTFNIGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTGR |
| Ga0255076_10534624 | 3300027141 | Freshwater | ITGLDPVAIAPLTFNIGTGSIEKVSRIRDKYNLTESYVSDYEPTGYTGR |
| Ga0208677_10542513 | 3300027216 | Estuarine | LDPQAMTPLTFNIGTGSIEKVSRIRDKYNLIESYTSEYESTGY |
| Ga0208812_10018301 | 3300027311 | Estuarine | AELLGLDPMTIAPLTFNIGTGSIEKVSRIRDKYNLTESYISDYEPTGYTGR |
| Ga0255091_10723393 | 3300027487 | Freshwater | VAIAPLTFNIGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTGR |
| Ga0255095_10901621 | 3300027489 | Freshwater | ALSPLTFNIGTGSIEKVSKIRDKYNLTESYISDYEPTGYTGR |
| Ga0208788_10174929 | 3300027499 | Deep Subsurface | RAYWDAQIIGLDPVAMSPLTFNIGTGSIEKVSKIRDKYNLVESYISDYEPTGYTGR |
| Ga0208788_10386741 | 3300027499 | Deep Subsurface | RAYWDAQIIGLDPVAMSPLTFNIGTGSIEKVSKIRDKYNLVESYVSDYEPTGYTGR |
| Ga0209552_11732593 | 3300027563 | Freshwater Lake | MAYWDAQIVGLDPHVLSALTFNVGTGSIEKVSKIRDKHNLIESYVSDYEPTGYTGR |
| Ga0255068_1032316 | 3300027579 | Freshwater | PQAIAPLTFNIGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTGR |
| Ga0208966_10290786 | 3300027586 | Freshwater Lentic | QIIGLDPTAMSPLTFNVGTGNIEKVSRIRDKHNLKETYVSQYEPTGYRC |
| Ga0208942_10229388 | 3300027627 | Freshwater Lentic | TAMSPLTFNVGTGNIEKVSRIRDKHNLKETYVSQYEPTGYRC |
| Ga0208975_12010561 | 3300027659 | Freshwater Lentic | TFNIGTGSIEKVSRIRDKHNLTESYTSDYEPTGYTRR |
| Ga0209553_100852014 | 3300027688 | Freshwater Lake | FNVGTGSIEKVSKIRDKYNLIESYTSDYEPTGYTRR |
| Ga0209553_10624395 | 3300027688 | Freshwater Lake | GLDPQEMDSLTFNIGTGSIEKVSRIRDKYNLKETYLSQFEPTGYSRRK |
| Ga0209033_10758131 | 3300027697 | Freshwater Lake | LTFNIGTGSIEKVSRIRDKYNLKETYISDYEPTGYTGR |
| Ga0209355_10927496 | 3300027744 | Freshwater Lake | YWDAQIIGLDPTAMSPLTFNVGTGSIEKVSKIRDKYNLTESYTSDYEPTGYTRR |
| Ga0209596_11582291 | 3300027754 | Freshwater Lake | MIGLDPHALTPLTFNIGTGSIEKVSRIRDKYNLTESYISDYEPTGYTGR |
| Ga0209770_100768315 | 3300027769 | Freshwater Lake | LTFNIGTGSIEKVSRLRDKYNLTESYVSDYETTGY |
| Ga0209770_101341534 | 3300027769 | Freshwater Lake | PTALSPLTFNIGTGSIEKVSKIRDKYNLIESYTSDYEPTGYTGR |
| Ga0209770_103110891 | 3300027769 | Freshwater Lake | PQAMAPLTFNIGTGSIEKVSRIRDKYNLIESYTSDYEPTGYTGR |
| Ga0209500_100300331 | 3300027782 | Freshwater Lake | PLTFNIGTGSIEKVSRLRDKYNLIESYVSDYETTGY |
| Ga0209107_104090041 | 3300027797 | Freshwater And Sediment | MAYWDAQIVGLDPHVLSALTFNVGTGSIEKVSKIRDKHNLIESYVSDYEPTGYTG |
| Ga0209229_101452654 | 3300027805 | Freshwater And Sediment | QRMAPLTFNIGTGSIEKVSRLRDKYNLTESYISDYETTGY |
| Ga0209354_102153914 | 3300027808 | Freshwater Lake | ETIGLDPTRIAALTFNVGTGSIEKVSRIRDKFNLKETYTSDYEPTGY |
| Ga0209550_108080841 | 3300027892 | Freshwater Lake | YWDAQMMGLDPQALAPLTFNIGTGSIEKVSRIRDKYNLIESYTSDYEPTGYTGR |
| Ga0255180_10922411 | 3300028073 | Freshwater | SFWEAEVMGLDPQYTSQALTFGIGTGSIEKVSSIRDKYNLTETYWSDAEPTGYVRR |
| Ga0265593_11347051 | 3300028178 | Saline Water | LTFNVGTGSIEKVSRIRDKYNLTESYVSEYETTGY |
| Ga0315907_112960353 | 3300031758 | Freshwater | YWDAQVMGLDPQAISALTFNIGTGSIEKVSKIRDKHNLIESYVSEYEPTGYTGR |
| Ga0315907_112991731 | 3300031758 | Freshwater | GLDPQALTPLTFNIGTGSIEKVSRIRDKYNLTESYTSDYEPTGYTGR |
| Ga0315899_109461931 | 3300031784 | Freshwater | WDAELNGLDPEKMNSLTFNIGTGSIEKVSRLRDKFNLTESYVSEFEPTGYQRS |
| Ga0315899_110850674 | 3300031784 | Freshwater | ALSPLTFNIGTGSIEKVSRIRDKYNLIESYTSDYEPTGYTGR |
| Ga0315900_106220331 | 3300031787 | Freshwater | RAFWSAEMMGLDPMLIAPLTFNIGTGSIEKVSSIRDTYNLKETYVSDYEPTGYTRR |
| Ga0315900_106334254 | 3300031787 | Freshwater | SPLTFNIGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTGR |
| Ga0315909_103583735 | 3300031857 | Freshwater | RAYWDAEMTGLDPQKIAPLTFNIGTGSIEKVSRIRDKYNLIESYTSDYEPTGYTGR |
| Ga0315904_110255784 | 3300031951 | Freshwater | KRAFWEASITGLDPQVIGPLTFDIGTGNIEKVSLIRDKHNLSEYFSDYEPTGYRR |
| Ga0315901_105690464 | 3300031963 | Freshwater | DPQALSPLTFNVGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTGR |
| Ga0315901_109703771 | 3300031963 | Freshwater | ISPLTFNIGTGSIEKVSSIRDTYNLKETYVSDYEPTGYTRR |
| Ga0315901_112009673 | 3300031963 | Freshwater | AYWDAQIIGLDPQAMSPLTFNIGTGSIEKVSKIRDKYNLTESYTSDYEPTGYIRR |
| Ga0315906_106273621 | 3300032050 | Freshwater | IAPLTFNIGTGSIEKVSSIRDTYNLKETYVSDYEPTGYTRR |
| Ga0315906_112579173 | 3300032050 | Freshwater | DPELIRPLTFNIGTGSIEKVSSIRDTYNLKETYVSEYEPTGYIRR |
| Ga0315905_112555724 | 3300032092 | Freshwater | FNIGTGSIEKVSSIRDTYNLTETYVSDYEPTGYTGR |
| Ga0316617_1026393533 | 3300033557 | Soil | TGLDPVAIAPLTFNIGTGSIEKVSRIRDKYNLTESYVSDYEPTGYTGR |
| Ga0334995_0211855_16_183 | 3300034062 | Freshwater | MEMAYWDAQIIGLDPQAMSPLTFNIGTGSIEKVSRIRNKYNLTESYISDYETTGY |
| Ga0335001_0427058_580_708 | 3300034064 | Freshwater | AMSPLTFNVGTGSIEKVSKIRDKYNLTESYTSDYEPTGYTRR |
| Ga0335019_0351775_749_910 | 3300034066 | Freshwater | WEAEMIGLDPMTIAPLTFNIGTGSIEKVSRIRDKYNLVESYTSDYEPTGYTGR |
| Ga0335019_0791890_39_170 | 3300034066 | Freshwater | MTIAPLTFNIGTGSIEKVSRLRDKYNLIESYTSDYEPTGYTGR |
| Ga0335010_0407363_582_731 | 3300034092 | Freshwater | MIGLDPQAMSALTFNVGTGSIEKVSRIRDKHGLTESYVSDYEPTGYIRR |
| Ga0335027_0225000_1144_1314 | 3300034101 | Freshwater | RAYWDAQIMGLDPQALTPLTFNIGTGSIEKVSRIRDKYNLTESYTSDYEPTGYTGR |
| Ga0335060_0435002_562_687 | 3300034122 | Freshwater | MSPLTFNVGTGSIEKVSKIRDKYNLTESYTSDYEPTGYTRR |
| Ga0335017_0445013_542_694 | 3300034167 | Freshwater | QITGLDPEFMPPLTFNVGTGSIEKVSKIRDKYNLTESYTSDYEPTGYTRR |
| Ga0335007_0546865_527_682 | 3300034283 | Freshwater | AQTIGLDPTALSPLTFNIGTGSIEKVSRIRDKYNLTESYTSDYEPTGYTRR |
| ⦗Top⦘ |