| Basic Information | |
|---|---|
| Family ID | F045044 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LLFGFAVLWTWVRFMRRLPHLLSHHMAPRASEEHAAIAAAD |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.31 % |
| % of genes near scaffold ends (potentially truncated) | 72.55 % |
| % of genes from short scaffolds (< 2000 bps) | 71.90 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.085 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.144 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.484 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.020 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF00877 | NLPC_P60 | 37.25 |
| PF00166 | Cpn10 | 2.61 |
| PF00118 | Cpn60_TCP1 | 1.31 |
| PF01966 | HD | 0.65 |
| PF07729 | FCD | 0.65 |
| PF01040 | UbiA | 0.65 |
| PF03309 | Pan_kinase | 0.65 |
| PF02567 | PhzC-PhzF | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 37.25 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 2.61 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 1.31 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.65 |
| COG1521 | Pantothenate kinase type III | Coenzyme transport and metabolism [H] | 0.65 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.65 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.08 % |
| Unclassified | root | N/A | 20.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002562|JGI25382J37095_10147972 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 769 | Open in IMG/M |
| 3300002907|JGI25613J43889_10223940 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
| 3300002908|JGI25382J43887_10399943 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 580 | Open in IMG/M |
| 3300005166|Ga0066674_10518329 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 534 | Open in IMG/M |
| 3300005174|Ga0066680_10512623 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 754 | Open in IMG/M |
| 3300005177|Ga0066690_10689109 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 677 | Open in IMG/M |
| 3300005179|Ga0066684_10741029 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 654 | Open in IMG/M |
| 3300005186|Ga0066676_10229392 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1205 | Open in IMG/M |
| 3300005440|Ga0070705_100349607 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1077 | Open in IMG/M |
| 3300005444|Ga0070694_101017945 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 688 | Open in IMG/M |
| 3300005451|Ga0066681_10654387 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 643 | Open in IMG/M |
| 3300005468|Ga0070707_100286430 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1601 | Open in IMG/M |
| 3300005471|Ga0070698_101137956 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 729 | Open in IMG/M |
| 3300005530|Ga0070679_101179381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 711 | Open in IMG/M |
| 3300005553|Ga0066695_10770538 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 557 | Open in IMG/M |
| 3300005558|Ga0066698_10643186 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 708 | Open in IMG/M |
| 3300005558|Ga0066698_11103139 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 502 | Open in IMG/M |
| 3300005569|Ga0066705_10374131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 895 | Open in IMG/M |
| 3300005569|Ga0066705_10829622 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 550 | Open in IMG/M |
| 3300005587|Ga0066654_10225875 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 981 | Open in IMG/M |
| 3300005598|Ga0066706_10113869 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1986 | Open in IMG/M |
| 3300005842|Ga0068858_100524779 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1145 | Open in IMG/M |
| 3300005895|Ga0075277_1034127 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 750 | Open in IMG/M |
| 3300006755|Ga0079222_10677206 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 810 | Open in IMG/M |
| 3300006796|Ga0066665_10115630 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1990 | Open in IMG/M |
| 3300006797|Ga0066659_10330279 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1175 | Open in IMG/M |
| 3300006847|Ga0075431_100447211 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300006847|Ga0075431_100741542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 958 | Open in IMG/M |
| 3300006854|Ga0075425_102854774 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 531 | Open in IMG/M |
| 3300006903|Ga0075426_10992911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 634 | Open in IMG/M |
| 3300009012|Ga0066710_103272278 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 620 | Open in IMG/M |
| 3300009012|Ga0066710_104365237 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 528 | Open in IMG/M |
| 3300009038|Ga0099829_10761066 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 805 | Open in IMG/M |
| 3300009089|Ga0099828_10229004 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1662 | Open in IMG/M |
| 3300009090|Ga0099827_10950833 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 745 | Open in IMG/M |
| 3300009137|Ga0066709_100122241 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3256 | Open in IMG/M |
| 3300009137|Ga0066709_101854795 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 842 | Open in IMG/M |
| 3300009147|Ga0114129_12949275 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 561 | Open in IMG/M |
| 3300009156|Ga0111538_10736011 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1249 | Open in IMG/M |
| 3300009162|Ga0075423_11319681 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 771 | Open in IMG/M |
| 3300010323|Ga0134086_10034541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1677 | Open in IMG/M |
| 3300010335|Ga0134063_10688641 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
| 3300010337|Ga0134062_10276920 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 788 | Open in IMG/M |
| 3300010403|Ga0134123_11636810 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 693 | Open in IMG/M |
| 3300011269|Ga0137392_11560868 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 519 | Open in IMG/M |
| 3300012096|Ga0137389_10116891 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2143 | Open in IMG/M |
| 3300012172|Ga0137320_1112550 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 580 | Open in IMG/M |
| 3300012201|Ga0137365_10170407 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1632 | Open in IMG/M |
| 3300012201|Ga0137365_11034542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 594 | Open in IMG/M |
| 3300012202|Ga0137363_10573137 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 952 | Open in IMG/M |
| 3300012203|Ga0137399_10271406 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1395 | Open in IMG/M |
| 3300012204|Ga0137374_10138514 | All Organisms → cellular organisms → Bacteria | 2200 | Open in IMG/M |
| 3300012206|Ga0137380_10036662 | All Organisms → cellular organisms → Bacteria | 4520 | Open in IMG/M |
| 3300012206|Ga0137380_11647745 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300012208|Ga0137376_10067006 | All Organisms → cellular organisms → Bacteria | 2977 | Open in IMG/M |
| 3300012208|Ga0137376_10735630 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 850 | Open in IMG/M |
| 3300012208|Ga0137376_11809372 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
| 3300012285|Ga0137370_10900009 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
| 3300012350|Ga0137372_11012530 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 578 | Open in IMG/M |
| 3300012350|Ga0137372_11058677 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 560 | Open in IMG/M |
| 3300012356|Ga0137371_10823072 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 707 | Open in IMG/M |
| 3300012357|Ga0137384_10930351 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 700 | Open in IMG/M |
| 3300012359|Ga0137385_10055089 | All Organisms → cellular organisms → Bacteria | 3551 | Open in IMG/M |
| 3300012359|Ga0137385_10217776 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1662 | Open in IMG/M |
| 3300012360|Ga0137375_10571338 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 947 | Open in IMG/M |
| 3300012360|Ga0137375_11301231 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 549 | Open in IMG/M |
| 3300012362|Ga0137361_11506931 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 594 | Open in IMG/M |
| 3300012685|Ga0137397_10148368 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1737 | Open in IMG/M |
| 3300012685|Ga0137397_11241195 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 534 | Open in IMG/M |
| 3300012922|Ga0137394_10090449 | All Organisms → cellular organisms → Bacteria | 2569 | Open in IMG/M |
| 3300012922|Ga0137394_11391574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 562 | Open in IMG/M |
| 3300012927|Ga0137416_10189037 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1644 | Open in IMG/M |
| 3300012977|Ga0134087_10724742 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 530 | Open in IMG/M |
| 3300014150|Ga0134081_10300306 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 576 | Open in IMG/M |
| 3300014154|Ga0134075_10295182 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 705 | Open in IMG/M |
| 3300014154|Ga0134075_10574535 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300014872|Ga0180087_1103157 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 546 | Open in IMG/M |
| 3300015241|Ga0137418_11243007 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 522 | Open in IMG/M |
| 3300017654|Ga0134069_1180209 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 715 | Open in IMG/M |
| 3300018071|Ga0184618_10114537 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1072 | Open in IMG/M |
| 3300018433|Ga0066667_10471264 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1029 | Open in IMG/M |
| 3300018468|Ga0066662_12342185 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 561 | Open in IMG/M |
| 3300019255|Ga0184643_1181187 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 570 | Open in IMG/M |
| 3300020022|Ga0193733_1141719 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 655 | Open in IMG/M |
| 3300020170|Ga0179594_10212774 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 726 | Open in IMG/M |
| 3300024224|Ga0247673_1067258 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300025165|Ga0209108_10456067 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 620 | Open in IMG/M |
| 3300025318|Ga0209519_10751396 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
| 3300025322|Ga0209641_10197289 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1514 | Open in IMG/M |
| 3300025885|Ga0207653_10194961 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300025922|Ga0207646_10529358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1061 | Open in IMG/M |
| 3300025988|Ga0208141_1012524 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 750 | Open in IMG/M |
| 3300026297|Ga0209237_1014621 | All Organisms → cellular organisms → Bacteria | 4618 | Open in IMG/M |
| 3300026298|Ga0209236_1024712 | All Organisms → cellular organisms → Bacteria | 3295 | Open in IMG/M |
| 3300026300|Ga0209027_1131129 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 866 | Open in IMG/M |
| 3300026301|Ga0209238_1062396 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1321 | Open in IMG/M |
| 3300026304|Ga0209240_1025190 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
| 3300026306|Ga0209468_1092088 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 993 | Open in IMG/M |
| 3300026312|Ga0209153_1158755 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 835 | Open in IMG/M |
| 3300026313|Ga0209761_1254225 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 676 | Open in IMG/M |
| 3300026320|Ga0209131_1413136 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 506 | Open in IMG/M |
| 3300026325|Ga0209152_10096015 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1111 | Open in IMG/M |
| 3300026327|Ga0209266_1006322 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 7077 | Open in IMG/M |
| 3300026328|Ga0209802_1305442 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
| 3300026523|Ga0209808_1247454 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 569 | Open in IMG/M |
| 3300026551|Ga0209648_10535125 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 661 | Open in IMG/M |
| 3300027633|Ga0208988_1169798 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 517 | Open in IMG/M |
| 3300027738|Ga0208989_10139284 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 818 | Open in IMG/M |
| 3300027775|Ga0209177_10398613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 551 | Open in IMG/M |
| 3300027787|Ga0209074_10458963 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 545 | Open in IMG/M |
| 3300027843|Ga0209798_10479622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 571 | Open in IMG/M |
| 3300027880|Ga0209481_10517554 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 616 | Open in IMG/M |
| 3300027882|Ga0209590_10543102 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 749 | Open in IMG/M |
| 3300027909|Ga0209382_10302229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1804 | Open in IMG/M |
| 3300030903|Ga0308206_1188201 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 517 | Open in IMG/M |
| 3300031708|Ga0310686_113020003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 883 | Open in IMG/M |
| 3300031720|Ga0307469_11635714 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 619 | Open in IMG/M |
| 3300032180|Ga0307471_101339410 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 877 | Open in IMG/M |
| 3300032205|Ga0307472_101193537 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 726 | Open in IMG/M |
| 3300033813|Ga0364928_0124897 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 619 | Open in IMG/M |
| 3300034164|Ga0364940_0186974 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 604 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 16.99% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.31% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.31% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.31% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.65% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025988 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25382J37095_101479722 | 3300002562 | Grasslands Soil | LTMLAVAGLGAASFGFSALALWVRFMRRVPHLLSHHMAPRPSQEQAAVAAAD* |
| JGI25613J43889_102239401 | 3300002907 | Grasslands Soil | LAGFTALFLWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| JGI25382J43887_103999432 | 3300002908 | Grasslands Soil | MLVVAAAVATLSGFTALFLWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| JGI25388J43891_10443701 | 3300002909 | Grasslands Soil | AGLGAALFGFAALAMWVRFMRRAPHLLSHHMAPRPSQEQAAVAAAD* |
| Ga0066674_105183291 | 3300005166 | Soil | LCGFTALFIWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0066680_101918981 | 3300005174 | Soil | AGAAAALSGFTSLALWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0066680_105126231 | 3300005174 | Soil | TAACGALLGFTALWTWVRLMRRAPHILSHLMAPRASQEQPRVAAGD* |
| Ga0066690_104563551 | 3300005177 | Soil | TLCGFTALFIWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0066690_106891092 | 3300005177 | Soil | VAGATAVLCGFTSLALWVRFMRRLPHLLSHHMAPRASEEHRAVAAAD* |
| Ga0066684_101555141 | 3300005179 | Soil | GAALFGFAALAMWVRFMRRAPHLLSHHMAPRPSQEQAAVAAAD* |
| Ga0066684_102100802 | 3300005179 | Soil | IAAAVAAVCGFTALFIWVRFMRRVPHLLSHHMAPRTSEEHRAVAAAD* |
| Ga0066684_107410291 | 3300005179 | Soil | MLVVAGATAVLCGFTSLALWVRFMRRLPHLLSHHMAPRASEEHRAVAAAD* |
| Ga0066676_102293922 | 3300005186 | Soil | VGALLFGFAVLWTWVRFMRRLPHLLSHHMAPRASEEHAAIAAAD* |
| Ga0070705_1003496071 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | FAVLWTWVRFMRRLPHLLSHHMAPRGGAGIETGAKASAGATVPGRSEEHAAIAAAD* |
| Ga0070694_1010179452 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | FTVLWIWVRFMRRLPHILSHQMAPREGSTEEHAAIAAAD* |
| Ga0066681_106543871 | 3300005451 | Soil | ALGLVCGFATLWVWVHLMRRVPHLLSHLMAPRASEQHDALPAAD* |
| Ga0070707_1002864301 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | IAGAGAALCGVATLITWLRFMRKLPHLLSHHMAPRASEEHRAVAAAD* |
| Ga0070698_1011379562 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GAVLVGFVVLWAWVRFMRRVPHLLSHLMAPRASEEQAAIAAAD* |
| Ga0070679_1011793811 | 3300005530 | Corn Rhizosphere | AALGALLFGFAVLWGWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD* |
| Ga0066695_107705382 | 3300005553 | Soil | LFIWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0066698_106431861 | 3300005558 | Soil | LVLWVRFMRRVPHLLSHHMAPRPSQEQAAVAAAD* |
| Ga0066698_111031391 | 3300005558 | Soil | VCGFGTLWAWVRLMRRVPHLLSHLMAPRASEEEAALPAAD* |
| Ga0066670_104996291 | 3300005560 | Soil | FAALAMWVRFMRRAPHLLSHHMAPRPSQEQAAVAAAD* |
| Ga0066705_103741312 | 3300005569 | Soil | MLAVAGAAAAVCGFATLAIWVRFMRRLPHLLSHHMAPRTSEEHPAVAAAD* |
| Ga0066705_108296222 | 3300005569 | Soil | AGALGLVCGFATLWVWVHLMRRVPHLLSHLMAPRASEQHDALPAAD* |
| Ga0066654_102258752 | 3300005587 | Soil | TMLVVAGATAVLCGFTSLALWVRFMRRLPHLLSHHMAPRASEEHRAVAAAD* |
| Ga0066706_101138691 | 3300005598 | Soil | LAVAGAAAAVCGFTTLAIWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0068858_1005247791 | 3300005842 | Switchgrass Rhizosphere | IAIAGAGAFVFGFTVLWIWITFMRRLPHLLSHHMAAREGTSEEHAAIAAAD* |
| Ga0075277_10341272 | 3300005895 | Rice Paddy Soil | MLAIAGLGAFVSGFAVLWTWVRFMRRLPHLLSHHMAPRASEEHAAIAAAD* |
| Ga0066652_1005215811 | 3300006046 | Soil | VAGIGAALFGFAALAMWVRFMRRAPHLLSHHMAPRPSQEQAAVAAAD* |
| Ga0079222_106772061 | 3300006755 | Agricultural Soil | NPVTMLAVAGATAALSGFSSLALWVRFMRRLPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0066665_101156304 | 3300006796 | Soil | GFGALWAWVRVMRRVPHLLSHHMAPRASEERTAIAAAD* |
| Ga0066659_103302791 | 3300006797 | Soil | NPVTMLVVAGATAVLCGFTSLALWVRFMRRLPHLLSHHMARRASEEHRAVAAAD* |
| Ga0075431_1004472113 | 3300006847 | Populus Rhizosphere | WIRFMKYLPHLLSHHMAPREGEGTSEERTAIAAAD* |
| Ga0075431_1007415422 | 3300006847 | Populus Rhizosphere | PVAMLVVAGLGAVLVGFVVLWAWVRFMRRLPHLLSHLMAPRASEEHSAVAAAD* |
| Ga0075425_1028547741 | 3300006854 | Populus Rhizosphere | VMLIVAGLGAVLVGFVVLWAWVRFMRRFPHLLSHLMAPRASEEHAAIAAAD* |
| Ga0075434_1000918095 | 3300006871 | Populus Rhizosphere | AIATLSGFTALFLWVRFMHRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0075426_109929112 | 3300006903 | Populus Rhizosphere | FTALFIWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0075436_1001028614 | 3300006914 | Populus Rhizosphere | CGFTALFIWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0066710_1032722781 | 3300009012 | Grasslands Soil | AGAGALVFGFAVLWTWVRFMRRLPHLLSHHMAPREGTGTGAAAGAGAEEHAAIAAAD |
| Ga0066710_1043652371 | 3300009012 | Grasslands Soil | LFGFAVLWGWVRFMRHLPHLLSHHMAPRESEEHAAVAAAD |
| Ga0099829_107610661 | 3300009038 | Vadose Zone Soil | IAGAGALLFGFAVLWTWVRFMRHLPHLLSHHMAPRASEEQAAIAAAD* |
| Ga0099828_102290042 | 3300009089 | Vadose Zone Soil | MLVVAAAVATLTGFTALFLWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0099827_109508331 | 3300009090 | Vadose Zone Soil | AGAGALVCGFAVLWTWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD* |
| Ga0066709_1001222412 | 3300009137 | Grasslands Soil | MLVVAGAAAAVCGFVALTVWVRFMRRVPHLLSHHMAPRASEEQRAIAAAD* |
| Ga0066709_1003892834 | 3300009137 | Grasslands Soil | FATLAIWVRFMRRLPHLLSHHMAPRTSEEHPAVAAAD* |
| Ga0066709_1018547952 | 3300009137 | Grasslands Soil | FGTLWAWVLLMRRVPHLLSHLMAPRASEEQAALPAAD* |
| Ga0066709_1025098562 | 3300009137 | Grasslands Soil | VCGLAALAIWVRFMRRVPHLLSHLMAARTSEEPRAAAAAD* |
| Ga0114129_129492752 | 3300009147 | Populus Rhizosphere | PLVMLIVAGLGAVLVGFVVLWVWVRFMRRLPHLLSHLMAPRASEEHTAIAAAD* |
| Ga0111538_107360113 | 3300009156 | Populus Rhizosphere | MIAIAGAGAFVFGFTVLWIWITFMRRLPHLLSHHMAPREGTSEEHAAIAAAD* |
| Ga0075423_113196811 | 3300009162 | Populus Rhizosphere | AGAFLFGFAVLWTWVRFMRHLPHLLSHHMAPRASEEQAAIAAAD* |
| Ga0134086_100345413 | 3300010323 | Grasslands Soil | MLVVAGLGAALLGFAALWTWVRFMRRLPHLLSQHMAPRPSQEYTAVAAAD* |
| Ga0134063_106886412 | 3300010335 | Grasslands Soil | GFAALAMWVRFMRRVPHLLSHHMAPRASEEHRAIAAAD* |
| Ga0134062_101418822 | 3300010337 | Grasslands Soil | GFTALFIWVRFMRRVPHLLSHHMAPRTSEEHRAVAAAD* |
| Ga0134062_102769201 | 3300010337 | Grasslands Soil | LTMLGVAGAAAALCGFTSLAIWVRFMRRVPHLLSHHMAPRASEEHRAVAAAD* |
| Ga0134123_116368102 | 3300010403 | Terrestrial Soil | SPLAMLVLAGLGAVLVGFVVLWAWVRFMRRLPHLLSHLMAPRASEEQTVIAAAD* |
| Ga0137392_115608682 | 3300011269 | Vadose Zone Soil | AGALLFGFAVLWTWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD* |
| Ga0137389_101168913 | 3300012096 | Vadose Zone Soil | MLVVAAAVATLAGFTALFLWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0137320_11125502 | 3300012172 | Soil | TVLWIWVRFMRRLPHLLSHHMAPREGSSEEHAAIAAAD* |
| Ga0137365_101704071 | 3300012201 | Vadose Zone Soil | VLWTWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD* |
| Ga0137365_110345422 | 3300012201 | Vadose Zone Soil | FGFAVLWTWVRFMRHLPHLLSHHMAPRASEEQAAIAAAD* |
| Ga0137363_105731372 | 3300012202 | Vadose Zone Soil | PVVMLAIAAAGALLFGFAVLWTWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD* |
| Ga0137399_102714063 | 3300012203 | Vadose Zone Soil | VLWVWVRFMRRLPHLLSHHMAPRASEEPAAIAAAD* |
| Ga0137374_101385142 | 3300012204 | Vadose Zone Soil | MLVIAGLGALVLGFGVLWAWVRFMRRLPHLLSHLMAPRAPEEHTAIAAAD* |
| Ga0137380_100366626 | 3300012206 | Vadose Zone Soil | TGPLAMLAVAGLGAALFGFTALAMWVRFMRRAPHLLSHHMAPRPSQEQAAVAAAD* |
| Ga0137380_116477453 | 3300012206 | Vadose Zone Soil | FGFAVLWTWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD* |
| Ga0137381_107389532 | 3300012207 | Vadose Zone Soil | GFTALFIWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0137376_100670061 | 3300012208 | Vadose Zone Soil | MLAIAGAGALLFGFAVLWTWVRFMRHLPHLISHHMAPRESEEHAAIAAAD* |
| Ga0137376_107356301 | 3300012208 | Vadose Zone Soil | LVFGFAVLWTWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD* |
| Ga0137376_118093721 | 3300012208 | Vadose Zone Soil | TALFIWVRFMRRVPHLLSHHMAPRTSEEHRVVAAAD* |
| Ga0137370_109000092 | 3300012285 | Vadose Zone Soil | TALFIWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0137387_103150742 | 3300012349 | Vadose Zone Soil | TLITWLRFMRKVPHLLSHHMAPRTSEEHRAVAAAD* |
| Ga0137387_112366321 | 3300012349 | Vadose Zone Soil | GLAALAIWVRFMRRVPHLLSHLMAARTSEEPRAAAAAD* |
| Ga0137372_110125301 | 3300012350 | Vadose Zone Soil | AIAGTGALLSGFAVLWTWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD* |
| Ga0137372_110586771 | 3300012350 | Vadose Zone Soil | AIAGTGALLSGFAVLWTWVRFMRHLPHLLSHHMAPRASEEQAAIAAAD* |
| Ga0137371_108230722 | 3300012356 | Vadose Zone Soil | LATWLRFMHRVPHLLSHHMAARSSQEQPTVAAAD* |
| Ga0137384_109303512 | 3300012357 | Vadose Zone Soil | GFAVLWTWVRFMRHLPHLLSHHMAPRASEEQAAIAAAD* |
| Ga0137385_100550891 | 3300012359 | Vadose Zone Soil | VAGAAAAVCGFATLAIWVRFMRRLPHLLSHHMAPRTSEEHPAVAAAD* |
| Ga0137385_102177761 | 3300012359 | Vadose Zone Soil | IAGSGALVFGFAVLWTWVRLMRRLPHLLSHHMAPRASEENAAIAAAD* |
| Ga0137375_105713382 | 3300012360 | Vadose Zone Soil | MGRPRTFSVAGAAAALSGFTALAIWVRFMRRVPHLLSHLMAPRASEEQRAIAAAD* |
| Ga0137375_113012312 | 3300012360 | Vadose Zone Soil | GVAGALGLLCGFATLWAWVRLMRRLPHLLSHLMAPRAAEQDVVLPAGD* |
| Ga0137361_115069312 | 3300012362 | Vadose Zone Soil | VAGLGAASFGFAALAMWVRFMRRVPHLLSHHMAPRASQEQAAVAAAD* |
| Ga0137398_103310621 | 3300012683 | Vadose Zone Soil | LSGFTALFLWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0137397_101483681 | 3300012685 | Vadose Zone Soil | MLVVAGLGAVLVGFVVLWAWVRFMRRVPHLLSHLMAPRASEEQTAIAAAD* |
| Ga0137397_112411951 | 3300012685 | Vadose Zone Soil | VMLAIAGAGALLFGFVVLWTWVRFMRHLPHLLSHHMAPRATEEHAAIAAAD* |
| Ga0137394_100904495 | 3300012922 | Vadose Zone Soil | ATLSGFTALFLWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0137394_113915742 | 3300012922 | Vadose Zone Soil | GAVLVGFVVLWAWVRFMRRVPHLLSHLMAPRASEEQTAIAAD* |
| Ga0137416_101890371 | 3300012927 | Vadose Zone Soil | PLLMLGTAGGVAALSGFSALWAWVRFMRRVPHLLSHHMAPRASEERAAVSAAD* |
| Ga0137407_108730442 | 3300012930 | Vadose Zone Soil | LFLWVRFMRRVPHLLSHHMAPRTSEEHRAVAAAD* |
| Ga0134110_102231522 | 3300012975 | Grasslands Soil | FTALFIWVRFMRRVPHLLSHHMAPRTSEEHRAVAAAD* |
| Ga0134087_107247422 | 3300012977 | Grasslands Soil | VFGFAVLWTWVRLMRRLPHLLSHHMAPRASGEHAAIAAAD* |
| Ga0134081_103003062 | 3300014150 | Grasslands Soil | LAVAAAVAALWGFTALFVWVRFMRRVPHLLSHLMAPRTSEEHRAVAAAD* |
| Ga0134075_102951821 | 3300014154 | Grasslands Soil | AVCGFTALFIWVRFMRRVPHLLSHHMAPRTSEEHRAVAAAD* |
| Ga0134075_105745352 | 3300014154 | Grasslands Soil | MRFANPLTMLAIAGAGAALFGVATLVTWLRFMRKVPHLLSHHMAPRTSEEHRAVA |
| Ga0180087_11031572 | 3300014872 | Soil | GTGAFLFGFTVLWIWVRFMRRLPHLLSHHMAPREGSSEEHAAIAAAD* |
| Ga0137418_103835062 | 3300015241 | Vadose Zone Soil | LSGFTALFLWVRFMRRVPHLLSHHMAPRTSEEQRVVAAAD* |
| Ga0137418_112430071 | 3300015241 | Vadose Zone Soil | ATLAGFTALFLWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD* |
| Ga0134069_11802092 | 3300017654 | Grasslands Soil | FAVLWTWVRLMRRLPHLLSHHMAPRASEEHAAIAAAD |
| Ga0187825_103755972 | 3300017930 | Freshwater Sediment | IAGVVSAGCGLTALALWVRFMRRVPHLLSHLMAPRASEDSGAVAAAD |
| Ga0187776_102474672 | 3300017966 | Tropical Peatland | VAALAGLGALAVWVRFMRRVPHLLSHHMAPRPSEEHRAAAAVD |
| Ga0184618_101145372 | 3300018071 | Groundwater Sediment | GAGALLFGFAVLWTWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD |
| Ga0066667_102180063 | 3300018433 | Grasslands Soil | GAAAAVCGFTTLAIWVRFMRRVPHLLSHHMAPRTSEEQRAIAAAD |
| Ga0066667_104712641 | 3300018433 | Grasslands Soil | MLAVAGLGAALFGFTALAMWVRFMRRAPHLLSHHMAPRPSQEQAAVAAAD |
| Ga0066667_107201902 | 3300018433 | Grasslands Soil | ATCGGFPALFIWVRFMRRVPHLLSHHMAPRTSEEHRAVAAAD |
| Ga0066667_107601952 | 3300018433 | Grasslands Soil | GFAALAMWVRFMRRAPHLLSHHMAPRPSQEQAAVAAAD |
| Ga0066662_123421852 | 3300018468 | Grasslands Soil | SGFGALWGWVRVMRRVPHLLSHHMAPRASEERAAVAAAD |
| Ga0066669_107877582 | 3300018482 | Grasslands Soil | ATAVLCGFTSLALWVRFMRRLPHLLSHHMAPRASEEQRAVAAAD |
| Ga0184643_11811871 | 3300019255 | Groundwater Sediment | LGAVVVGFLVLWAWVRFMRRLPHLLSHLMAPRASEEHSAVAAAD |
| Ga0193733_11417192 | 3300020022 | Soil | AAAGALVFGFAVLWTWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD |
| Ga0179594_102127741 | 3300020170 | Vadose Zone Soil | LLFGFAVLWTWVRFMRRLPHLLSHHMAPRASEEHAAIAAAD |
| Ga0247673_10672582 | 3300024224 | Soil | GAAAAVCAFVVLAIWVRFMRRVPHLLSHHMAPRASEEQRAIAAAD |
| Ga0209108_104560672 | 3300025165 | Soil | LMMLVVAGLGAVLVGFVVLWGWVRFMRRLPHLLSHRMAPRASEEHSAIAAAD |
| Ga0209519_107513961 | 3300025318 | Soil | AAASAALFGFAALAIWVRFMRRVPHLLSHLMAPRASQEHTAIAAAD |
| Ga0209641_101972891 | 3300025322 | Soil | MLAVAAASAALFGFAALAIWVRFMRRVPHLLSHLMAPRASQEHTAIAAAD |
| Ga0207653_101949613 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAIAGAGALLCGFAVLWTWVRFMRRLPHLLSHHMAPRGGAGIETGAKASAGATVPGRSEEHAAIAAAD |
| Ga0207646_105293582 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVVAGLGAVLVGFVVLWAWVRFMRRLPHLLSHLMAPRASEEQTVIAAAD |
| Ga0208141_10125241 | 3300025988 | Rice Paddy Soil | MLAIAGLGAFVSGFAVLWTWVRFMRRLPHLLSHHMAPRASEEHAAIAAAD |
| Ga0209237_10146216 | 3300026297 | Grasslands Soil | GLGAASFGFSALALWVRFMRRVPHLLSHHMAPRPSQEQAAVAAAD |
| Ga0209236_10247125 | 3300026298 | Grasslands Soil | VVAGLGAALLGFAALWTWVRLMRRLPHLLSHHMAPRPSQEYTAVAAAD |
| Ga0209236_12285701 | 3300026298 | Grasslands Soil | LGAALFGFTALAMWVRFMRRAPHLLSHHMAPRPSQEQAAVAAAD |
| Ga0209027_11311291 | 3300026300 | Grasslands Soil | AVLWTWVRFMRRLPHLLSHHMAPRASEEHAAIAAAD |
| Ga0209238_10623963 | 3300026301 | Grasslands Soil | GLVCGFGTLWVWVRLMRRVPHLLSHLMAPRASEEQAALPAAD |
| Ga0209240_10251901 | 3300026304 | Grasslands Soil | LVFGFAVLWTWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD |
| Ga0209468_10920881 | 3300026306 | Soil | TLWAWVRLMRRLPHLLSHLMAPRAAEQDVVLPAGD |
| Ga0209239_12705672 | 3300026310 | Grasslands Soil | GAALFGFTALAMWVRFMRRAPHLLSHHMAPRPSQEQAAVAAAD |
| Ga0209153_11587552 | 3300026312 | Soil | ALVFGFAVLWTWIRFMRRLPHLLSHHMAPRASEEHAAIAAAD |
| Ga0209761_12542251 | 3300026313 | Grasslands Soil | TMLGVAGLVAAVCGLAALAIWVRFMRRVPHLLSHLMAARTSEEPRAATAAD |
| Ga0209154_10240355 | 3300026317 | Soil | FTTLAIWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD |
| Ga0209131_14131361 | 3300026320 | Grasslands Soil | VVMLAIAGAGALLFGFAVLWTWVRFMRRLPHLLSHHMAPRASEEHAAIAAAD |
| Ga0209152_100960152 | 3300026325 | Soil | LSMVFGFATLWVWVHLMRRVPHLLSHLMAPRASEQHDALPAAD |
| Ga0209266_10063221 | 3300026327 | Soil | GLVCGFATLWVWVHLMRRVPHLLSHLMAPRASEQHDALPAAD |
| Ga0209802_13054421 | 3300026328 | Soil | GFTALFIWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD |
| Ga0209804_10589644 | 3300026335 | Soil | AALSGFTSLALWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD |
| Ga0209808_12474541 | 3300026523 | Soil | AAAAACGFTTLAIWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD |
| Ga0209648_105351252 | 3300026551 | Grasslands Soil | VVAAAAATLAGFTALFLWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD |
| Ga0208988_11697982 | 3300027633 | Forest Soil | LFGFAVLWTWVRFMRRLPHLLSHHMAPRATEEHAAIAAAD |
| Ga0209588_10822862 | 3300027671 | Vadose Zone Soil | LVVAAAAATLAGFTALFLWVRFMRRVPHLLSHHMAPRTSEEQRAVAAAD |
| Ga0208989_101392842 | 3300027738 | Forest Soil | AIAGAGALIFGFAVLWTWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD |
| Ga0209177_103986131 | 3300027775 | Agricultural Soil | TMLVVAGAAAAVCAFVALAIWVRFMRRVPHLLSHHMAPRASEEQRAIAAAD |
| Ga0209074_104589632 | 3300027787 | Agricultural Soil | PVTMLAVAGATAALSGFSSLALWVRFMRRLPHLLSHHMAPRTSEEQRAVAAAD |
| Ga0209798_104796221 | 3300027843 | Wetland Sediment | LVMLVVAGLGAVLVGSFVLWAWVRFMRRLPHRLSHRMAPRASEEHAAIAAAD |
| Ga0209481_105175542 | 3300027880 | Populus Rhizosphere | FVMLAIAGAGAFLFGFAVLWTWIRFMRHLPHMLSHHMAPRASEEQAAIAAAD |
| Ga0209590_105431021 | 3300027882 | Vadose Zone Soil | AGAGALVCGFAVLWTWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD |
| Ga0209382_103022291 | 3300027909 | Populus Rhizosphere | GALLFGFAVLWTWIRFMKYLPHLLSHHMAPREGEGTSEERTAIAAAD |
| Ga0307308_100826691 | 3300028884 | Soil | ALCGFTALAIWVRFMRKVPHLLSHHMAPRASDEQRAVAAAD |
| Ga0308206_11882011 | 3300030903 | Soil | FGFAVLWTWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD |
| Ga0310686_1130200031 | 3300031708 | Soil | TGVAVLVAWVRFMRRLPHLLSHHMAPRRSEAQSALPTVD |
| Ga0307469_116357141 | 3300031720 | Hardwood Forest Soil | AMLGVAGALGLVCGFGTLWVWVRLMRRVPHLLSHLMAPRASEEQAAFPAAD |
| Ga0307471_1013394101 | 3300032180 | Hardwood Forest Soil | AGGALVFGFAVLWTWVRFMRRLPHLLSHHMAPREGTGTGAAAGAGAEEHAAIAAAD |
| Ga0307472_1011935371 | 3300032205 | Hardwood Forest Soil | MLAIAAGGALVFGFAVLWTWVRFMRRLPHLLSHHMAPREGTGTGAAAGAGAEEHAAIAAA |
| Ga0335084_121705931 | 3300033004 | Soil | AGLAAAVSGFAALAAWVRFMRRVPHLLSHHMAPRPSEEHRAVAAAD |
| Ga0364928_0124897_453_605 | 3300033813 | Sediment | MLAIAGAGALLFGFAVLWTWVRFMRHLPHLLSHHMAPRASEEHAAIAAAD |
| Ga0364940_0186974_450_602 | 3300034164 | Sediment | MLVVAGLGAVLVGFAVLWGWVRFMRRLPHLLSHLMAPRASEEQAAIAAAD |
| ⦗Top⦘ |