Basic Information | |
---|---|
Family ID | F045001 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 153 |
Average Sequence Length | 37 residues |
Representative Sequence | LRRLTPLSGLQEDILQRLGLGASLYRQLEIQEIGN |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 153 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.66 % |
% of genes near scaffold ends (potentially truncated) | 98.69 % |
% of genes from short scaffolds (< 2000 bps) | 86.93 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.588 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (43.791 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.098 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.248 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.10% β-sheet: 0.00% Coil/Unstructured: 61.90% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 153 Family Scaffolds |
---|---|---|
PF01609 | DDE_Tnp_1 | 2.61 |
PF03050 | DDE_Tnp_IS66 | 1.96 |
PF13546 | DDE_5 | 1.96 |
PF03400 | DDE_Tnp_IS1 | 1.96 |
PF13592 | HTH_33 | 1.31 |
PF01656 | CbiA | 1.31 |
PF14319 | Zn_Tnp_IS91 | 1.31 |
PF13565 | HTH_32 | 1.31 |
PF07592 | DDE_Tnp_ISAZ013 | 1.31 |
PF00881 | Nitroreductase | 1.31 |
PF12697 | Abhydrolase_6 | 0.65 |
PF13613 | HTH_Tnp_4 | 0.65 |
PF03330 | DPBB_1 | 0.65 |
PF08241 | Methyltransf_11 | 0.65 |
PF02518 | HATPase_c | 0.65 |
PF13649 | Methyltransf_25 | 0.65 |
PF01610 | DDE_Tnp_ISL3 | 0.65 |
PF10282 | Lactonase | 0.65 |
PF01526 | DDE_Tnp_Tn3 | 0.65 |
PF05195 | AMP_N | 0.65 |
PF13384 | HTH_23 | 0.65 |
PF06114 | Peptidase_M78 | 0.65 |
PF09969 | DUF2203 | 0.65 |
PF08240 | ADH_N | 0.65 |
PF14261 | DUF4351 | 0.65 |
PF13544 | Obsolete Pfam Family | 0.65 |
PF04014 | MazE_antitoxin | 0.65 |
PF02281 | Dimer_Tnp_Tn5 | 0.65 |
PF01370 | Epimerase | 0.65 |
PF01051 | Rep_3 | 0.65 |
PF13924 | Lipocalin_5 | 0.65 |
PF13419 | HAD_2 | 0.65 |
PF01844 | HNH | 0.65 |
PF01522 | Polysacc_deac_1 | 0.65 |
PF04255 | DUF433 | 0.65 |
PF14690 | zf-ISL3 | 0.65 |
PF04199 | Cyclase | 0.65 |
PF01436 | NHL | 0.65 |
PF04851 | ResIII | 0.65 |
PF00534 | Glycos_transf_1 | 0.65 |
PF13020 | NOV_C | 0.65 |
PF05598 | DUF772 | 0.65 |
PF14104 | DUF4277 | 0.65 |
PF03781 | FGE-sulfatase | 0.65 |
PF05685 | Uma2 | 0.65 |
PF01381 | HTH_3 | 0.65 |
PF13612 | DDE_Tnp_1_3 | 0.65 |
PF06782 | UPF0236 | 0.65 |
PF13401 | AAA_22 | 0.65 |
PF03958 | Secretin_N | 0.65 |
PF06537 | DHOR | 0.65 |
PF00589 | Phage_integrase | 0.65 |
PF13431 | TPR_17 | 0.65 |
PF00528 | BPD_transp_1 | 0.65 |
PF13551 | HTH_29 | 0.65 |
PF00664 | ABC_membrane | 0.65 |
COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
---|---|---|---|
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.61 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.61 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.61 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.61 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.61 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.61 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 1.96 |
COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 1.96 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.65 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.65 |
COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.65 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.65 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.65 |
COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.65 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
COG5527 | Protein involved in initiation of plasmid replication | Mobilome: prophages, transposons [X] | 0.65 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.59 % |
Unclassified | root | N/A | 29.41 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000550|F24TB_10381585 | Not Available | 648 | Open in IMG/M |
3300004016|Ga0058689_10161802 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005178|Ga0066688_11028515 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005574|Ga0066694_10069185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1625 | Open in IMG/M |
3300005576|Ga0066708_10470077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 809 | Open in IMG/M |
3300005598|Ga0066706_10813719 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300005764|Ga0066903_107031525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 583 | Open in IMG/M |
3300006796|Ga0066665_11364507 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300006844|Ga0075428_101326244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 756 | Open in IMG/M |
3300006847|Ga0075431_100972655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
3300006880|Ga0075429_101381846 | Not Available | 613 | Open in IMG/M |
3300006969|Ga0075419_10222622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1254 | Open in IMG/M |
3300007004|Ga0079218_11028887 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300007255|Ga0099791_10023955 | Not Available | 2642 | Open in IMG/M |
3300007255|Ga0099791_10526944 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Doudnabacteria | 575 | Open in IMG/M |
3300007258|Ga0099793_10677108 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
3300009012|Ga0066710_100630063 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
3300009012|Ga0066710_104300091 | Not Available | 532 | Open in IMG/M |
3300009038|Ga0099829_10299145 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
3300009038|Ga0099829_10826161 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300009038|Ga0099829_11713227 | Not Available | 516 | Open in IMG/M |
3300009089|Ga0099828_10028886 | Not Available | 4442 | Open in IMG/M |
3300009089|Ga0099828_10371931 | Not Available | 1288 | Open in IMG/M |
3300009089|Ga0099828_10635530 | Not Available | 960 | Open in IMG/M |
3300009090|Ga0099827_10201659 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
3300009090|Ga0099827_10274683 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
3300009090|Ga0099827_10357412 | Not Available | 1243 | Open in IMG/M |
3300009090|Ga0099827_11319421 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300009090|Ga0099827_11710487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300009090|Ga0099827_11901864 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300009100|Ga0075418_10153220 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
3300009100|Ga0075418_11155841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 838 | Open in IMG/M |
3300009137|Ga0066709_100154822 | All Organisms → cellular organisms → Bacteria | 2939 | Open in IMG/M |
3300009137|Ga0066709_100496657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1717 | Open in IMG/M |
3300009143|Ga0099792_10499309 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 762 | Open in IMG/M |
3300009146|Ga0105091_10094322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1366 | Open in IMG/M |
3300009147|Ga0114129_10346252 | Not Available | 1970 | Open in IMG/M |
3300009156|Ga0111538_12853937 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300009156|Ga0111538_12955915 | Not Available | 594 | Open in IMG/M |
3300009553|Ga0105249_11909085 | Not Available | 666 | Open in IMG/M |
3300009691|Ga0114944_1128528 | Not Available | 983 | Open in IMG/M |
3300009792|Ga0126374_11394554 | Not Available | 570 | Open in IMG/M |
3300009809|Ga0105089_1083551 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300009813|Ga0105057_1078594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Nitrococcus → Nitrococcus mobilis → Nitrococcus mobilis Nb-231 | 583 | Open in IMG/M |
3300009815|Ga0105070_1119732 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300009815|Ga0105070_1121405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
3300010046|Ga0126384_12060586 | Not Available | 547 | Open in IMG/M |
3300010360|Ga0126372_11436289 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300010362|Ga0126377_10476593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocaldum → unclassified Methylocaldum → Methylocaldum sp. | 1275 | Open in IMG/M |
3300010398|Ga0126383_11338107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
3300011269|Ga0137392_10937524 | Not Available | 712 | Open in IMG/M |
3300011270|Ga0137391_11117559 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300011270|Ga0137391_11385838 | Not Available | 549 | Open in IMG/M |
3300011422|Ga0137425_1037537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1066 | Open in IMG/M |
3300012189|Ga0137388_11444852 | Not Available | 626 | Open in IMG/M |
3300012199|Ga0137383_10137797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1784 | Open in IMG/M |
3300012199|Ga0137383_11317155 | Not Available | 514 | Open in IMG/M |
3300012201|Ga0137365_10087280 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
3300012201|Ga0137365_11211957 | Not Available | 539 | Open in IMG/M |
3300012204|Ga0137374_10191783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 1770 | Open in IMG/M |
3300012205|Ga0137362_10261036 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300012206|Ga0137380_11475781 | Not Available | 565 | Open in IMG/M |
3300012209|Ga0137379_10235540 | Not Available | 1744 | Open in IMG/M |
3300012209|Ga0137379_10406737 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300012209|Ga0137379_11211939 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300012210|Ga0137378_10423146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1235 | Open in IMG/M |
3300012210|Ga0137378_10494674 | Not Available | 1130 | Open in IMG/M |
3300012210|Ga0137378_11418686 | Not Available | 607 | Open in IMG/M |
3300012210|Ga0137378_11670381 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300012211|Ga0137377_10738138 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300012211|Ga0137377_10896915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Desulfuromonas → unclassified Desulfuromonas → Desulfuromonas sp. | 818 | Open in IMG/M |
3300012349|Ga0137387_10079642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2249 | Open in IMG/M |
3300012359|Ga0137385_10908198 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Jacksonbacteria → Candidatus Jacksonbacteria bacterium | 728 | Open in IMG/M |
3300012359|Ga0137385_11486446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
3300012359|Ga0137385_11525421 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 532 | Open in IMG/M |
3300012361|Ga0137360_10663652 | Not Available | 894 | Open in IMG/M |
3300012362|Ga0137361_10470865 | Not Available | 1154 | Open in IMG/M |
3300012362|Ga0137361_10526440 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300012363|Ga0137390_10956341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 810 | Open in IMG/M |
3300012582|Ga0137358_11018580 | Not Available | 534 | Open in IMG/M |
3300012685|Ga0137397_11286495 | Not Available | 521 | Open in IMG/M |
3300012917|Ga0137395_10271508 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
3300012918|Ga0137396_10020780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4211 | Open in IMG/M |
3300012922|Ga0137394_10797336 | Not Available | 792 | Open in IMG/M |
3300012923|Ga0137359_10135451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2192 | Open in IMG/M |
3300012929|Ga0137404_10001899 | All Organisms → cellular organisms → Bacteria | 13755 | Open in IMG/M |
3300012929|Ga0137404_10955105 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 783 | Open in IMG/M |
3300012948|Ga0126375_11150520 | Not Available | 642 | Open in IMG/M |
3300012971|Ga0126369_10046042 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 3697 | Open in IMG/M |
3300012971|Ga0126369_10557663 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
3300012971|Ga0126369_13602545 | Not Available | 507 | Open in IMG/M |
3300013306|Ga0163162_12658696 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 576 | Open in IMG/M |
3300014154|Ga0134075_10433268 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300018063|Ga0184637_10104380 | Not Available | 1745 | Open in IMG/M |
3300018071|Ga0184618_10022838 | Not Available | 2071 | Open in IMG/M |
3300021073|Ga0210378_10342439 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300021086|Ga0179596_10250781 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300021476|Ga0187846_10366154 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300025910|Ga0207684_10060761 | All Organisms → cellular organisms → Bacteria | 3210 | Open in IMG/M |
3300025916|Ga0207663_11534546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 536 | Open in IMG/M |
3300025922|Ga0207646_10073392 | Not Available | 3056 | Open in IMG/M |
3300025961|Ga0207712_10833424 | Not Available | 812 | Open in IMG/M |
3300026296|Ga0209235_1244370 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300026310|Ga0209239_1055610 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1770 | Open in IMG/M |
3300026325|Ga0209152_10505816 | Not Available | 500 | Open in IMG/M |
3300026333|Ga0209158_1331037 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300026358|Ga0257166_1041361 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300026528|Ga0209378_1086581 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 1405 | Open in IMG/M |
3300026537|Ga0209157_1386509 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300027655|Ga0209388_1094348 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300027655|Ga0209388_1184474 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300027655|Ga0209388_1232308 | Not Available | 505 | Open in IMG/M |
3300027675|Ga0209077_1159853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300027875|Ga0209283_10617210 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 686 | Open in IMG/M |
3300027875|Ga0209283_10630040 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 677 | Open in IMG/M |
3300027875|Ga0209283_10686955 | Not Available | 641 | Open in IMG/M |
3300027882|Ga0209590_10052122 | All Organisms → cellular organisms → Bacteria | 2285 | Open in IMG/M |
3300027882|Ga0209590_10106858 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
3300027882|Ga0209590_10421178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Okeania → unclassified Okeania → Okeania sp. SIO3B3 | 863 | Open in IMG/M |
3300027882|Ga0209590_10547860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 746 | Open in IMG/M |
3300027882|Ga0209590_10605538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium crusticola | 705 | Open in IMG/M |
3300027882|Ga0209590_10721507 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300027882|Ga0209590_10787487 | Not Available | 605 | Open in IMG/M |
3300027882|Ga0209590_10946832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 540 | Open in IMG/M |
3300027909|Ga0209382_10007192 | All Organisms → cellular organisms → Bacteria | 14231 | Open in IMG/M |
3300027961|Ga0209853_1153506 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 555 | Open in IMG/M |
3300028587|Ga0247828_10019959 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2613 | Open in IMG/M |
3300028717|Ga0307298_10021801 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
3300028814|Ga0307302_10127209 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
3300028828|Ga0307312_11136351 | Not Available | 517 | Open in IMG/M |
3300030006|Ga0299907_10782943 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300030619|Ga0268386_11013055 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300030905|Ga0308200_1062254 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 723 | Open in IMG/M |
3300031094|Ga0308199_1034379 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300031547|Ga0310887_10035004 | All Organisms → cellular organisms → Bacteria | 2138 | Open in IMG/M |
3300031573|Ga0310915_10179647 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
3300031890|Ga0306925_11160628 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300031901|Ga0307406_10687943 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300031912|Ga0306921_10361396 | Not Available | 1697 | Open in IMG/M |
3300032001|Ga0306922_10253096 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
3300032004|Ga0307414_11674995 | Not Available | 593 | Open in IMG/M |
3300032075|Ga0310890_10533429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
3300032180|Ga0307471_102112731 | Not Available | 708 | Open in IMG/M |
3300032180|Ga0307471_103050906 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300032261|Ga0306920_103905879 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300033289|Ga0310914_11388027 | Not Available | 605 | Open in IMG/M |
3300033289|Ga0310914_11469536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Thiothrix → Thiothrix nivea | 585 | Open in IMG/M |
3300033407|Ga0214472_10000291 | All Organisms → cellular organisms → Bacteria | 64544 | Open in IMG/M |
3300033407|Ga0214472_10050476 | All Organisms → cellular organisms → Bacteria | 4213 | Open in IMG/M |
3300033550|Ga0247829_11145927 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300033551|Ga0247830_10610620 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 863 | Open in IMG/M |
3300034176|Ga0364931_0341247 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 43.79% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.54% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.23% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.27% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.31% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.31% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.31% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.31% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.31% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.65% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.65% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.65% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.65% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F24TB_103815851 | 3300000550 | Soil | EEILRRLTPLSGVQEDILQRQGLGTSLYGQLEIQVMGN* |
Ga0058689_101618022 | 3300004016 | Agave | TGEDILRRLTPLSGLQEDILQRLGLGAALYGQLEIQGMGT* |
Ga0066688_110285152 | 3300005178 | Soil | TGEDILRRLTPLSALQKDILQRLGLGASLYGQLEIQEMRN* |
Ga0066694_100691851 | 3300005574 | Soil | EILRRLTPLSALQEDILQRLGFGASLYGQLEIQEMGN* |
Ga0066708_104700771 | 3300005576 | Soil | AGEDMLRRLTPLSGLQADILQRLGLGATLYGQLEIQATGT* |
Ga0066706_108137191 | 3300005598 | Soil | EEILRRLTSLSGLQEDILQRLGLGASLYGQLEIQEMRN* |
Ga0066903_1070315251 | 3300005764 | Tropical Forest Soil | RRLTPLSGLQEDILQRLGLGASLYGQLEIQEMGN* |
Ga0066665_113645072 | 3300006796 | Soil | RRLTPLSGLQEDILQRLGLGATLYGQLEIQTIGI* |
Ga0075428_1013262441 | 3300006844 | Populus Rhizosphere | EEILRRLTPLSRVQEAILQRLGLGTNLYRQLEIQNMES* |
Ga0075431_1009726551 | 3300006847 | Populus Rhizosphere | LRRLTPLSGLQEEILQRLGLGVTLYRQLEIQAIGT* |
Ga0075429_1013818462 | 3300006880 | Populus Rhizosphere | TNAAGENIIRRLTPLSGLQEDILQRLGLGTALYRQLEI* |
Ga0075419_102226221 | 3300006969 | Populus Rhizosphere | RRLTPLSGVQEDILQRLGLGAALYGQLEIPAIGT* |
Ga0079218_110288872 | 3300007004 | Agricultural Soil | RRMTPLAGGQETILQRLGLGTQLYRQLAIPHMGS* |
Ga0099791_100239551 | 3300007255 | Vadose Zone Soil | DILRRLTPLSGLQEDILQRLGLGAALYEQLEIQGIGT* |
Ga0099791_105269441 | 3300007255 | Vadose Zone Soil | AAGEDILRYLTPLSGLQEDILQRLGLGAALYGQLEIQTIGN* |
Ga0099793_106771081 | 3300007258 | Vadose Zone Soil | DILRRLTPLPGVQEAFLQRLGLGTNLYRQLEIQNMKS* |
Ga0066710_1006300631 | 3300009012 | Grasslands Soil | LRRLTPLSGLQADILQRLGLGATLYGQLEIQATGT |
Ga0066710_1043000911 | 3300009012 | Grasslands Soil | AAGEDILRRLTPLSGLQEDILQRLGLGAALYEQLEIQAIGH |
Ga0099829_102991451 | 3300009038 | Vadose Zone Soil | NAAGEEILRRLTPLSGVQEDILQRLGLGTALYRQLEIQEMGN* |
Ga0099829_108261612 | 3300009038 | Vadose Zone Soil | RRLTPLSGLQEEILQRLGLGTSLYRQLEIQEIGN* |
Ga0099829_117132271 | 3300009038 | Vadose Zone Soil | RRLTPLSGVQEDILQRLGLGTALYRQLEIQDIGN* |
Ga0099828_100288866 | 3300009089 | Vadose Zone Soil | RRLTPRSALQEDILQRLGLGASLYRQLEIQEMGN* |
Ga0099828_103719312 | 3300009089 | Vadose Zone Soil | RRLTPLSGLQEDILQRLGLGAALYGQLEIEGIRN* |
Ga0099828_106355301 | 3300009089 | Vadose Zone Soil | TAGEEILRRLTPLSGLQEEILQRLGLGTSLYRQLEIQEIGN* |
Ga0099827_102016593 | 3300009090 | Vadose Zone Soil | RRLTPRSAIKEDILQRLGSGASLYRQLEIQEMGN* |
Ga0099827_102746833 | 3300009090 | Vadose Zone Soil | LRRLTPLSGLQEDILQRLGLGATLYAQLEMQAIGT* |
Ga0099827_103574124 | 3300009090 | Vadose Zone Soil | LRRLTPLSGLQEDILQRLGLGTTLYRQLEIQVIGT* |
Ga0099827_113194211 | 3300009090 | Vadose Zone Soil | RRLTPLSGVQEAILQRLGLGAALYGQLAIQNMRS* |
Ga0099827_117104871 | 3300009090 | Vadose Zone Soil | NAAGEEILRRLTPLSGVQEDILQRLGLGTALYRQLEIQEMDN* |
Ga0099827_119018642 | 3300009090 | Vadose Zone Soil | LRRLTPLSGVQETILQCLGLGTSLYRQLEIQGIGN* |
Ga0075418_101532204 | 3300009100 | Populus Rhizosphere | RRLTPLSSLQQEVLRRLGLETSLYRQLEIHDMGN* |
Ga0075418_111558412 | 3300009100 | Populus Rhizosphere | ILRRLTPLSALQEDILQRLGLGVTLYRQLEIQTIEV* |
Ga0066709_1001548224 | 3300009137 | Grasslands Soil | GEDILRRLTPLSGLQEDILQRLGLGAALYGQLEMQAIGN* |
Ga0066709_1004966571 | 3300009137 | Grasslands Soil | RRLTPLSGLQEAILQRLGLGTHLYRQLEIQNMRS* |
Ga0099792_104993091 | 3300009143 | Vadose Zone Soil | LRRLTPLAWLQEDILQRLGLGATLYAQLEIQAMGN* |
Ga0105091_100943224 | 3300009146 | Freshwater Sediment | RRLTPLSGVQEDILQRLGLGATLYGQLEIQAIEA* |
Ga0114129_103462525 | 3300009147 | Populus Rhizosphere | RRLTSLSGLQEDILQRLGLDASLYGQLEIQEMGN* |
Ga0111538_128539371 | 3300009156 | Populus Rhizosphere | GEEILRRLTPLSRVQEAILQRLGLGTNLYRQLEIQNMES* |
Ga0111538_129559151 | 3300009156 | Populus Rhizosphere | DILRRLTPLSGVQEDLLQRLGCGALLYGQLAIQTIGI* |
Ga0105249_119090851 | 3300009553 | Switchgrass Rhizosphere | QRLTPLSALQQDILQRLGLDPFLYQQLEIHDTGN* |
Ga0114944_11285281 | 3300009691 | Thermal Springs | IIKTATGEDILRRLTPLSALQQDILRRLGLGTSLY* |
Ga0126374_113945542 | 3300009792 | Tropical Forest Soil | AGEDILRRLTPLSGLQEDILQRLGWGAALYRQLEMQVIGT* |
Ga0105089_10835511 | 3300009809 | Groundwater Sand | RRLTPLSRVQEAILQRLGLGTTLYRQLEMQNMES* |
Ga0105057_10785941 | 3300009813 | Groundwater Sand | LRRLPPLARVQEDILHRLGLGASLYRQLDIQEMGS* |
Ga0105070_11197321 | 3300009815 | Groundwater Sand | RRLTPLSGLQEDILQRLGLGAALYGQLEIQTIGN* |
Ga0105070_11214051 | 3300009815 | Groundwater Sand | TGEDILRRLTPLSGVQEDILQRLGLGTALYRQLEIQEIGN* |
Ga0126384_120605861 | 3300010046 | Tropical Forest Soil | AAGEDILRRLTPLAGLQEDILQRLGLGAALYRQLEIQASGT* |
Ga0126372_114362892 | 3300010360 | Tropical Forest Soil | RRLTPLSGLQEDILQRLGLGVALYGQLEIQGSGT* |
Ga0126377_104765933 | 3300010362 | Tropical Forest Soil | AAGEEILRRLTSLSGLQAHILQRLGLGAALYGQLEIQEMGN* |
Ga0126383_113381071 | 3300010398 | Tropical Forest Soil | ILRRLTPLSGVQEDILQRLGLGTVLYRQLEIQAIGN* |
Ga0137392_109375242 | 3300011269 | Vadose Zone Soil | RRLTPLSKLQEDILQRLGLGTSLYGQLEIQEIEN* |
Ga0137391_111175593 | 3300011270 | Vadose Zone Soil | RRLTPLSRVQEAILQRLGLGTNLYRQLEIQNMES* |
Ga0137391_113858382 | 3300011270 | Vadose Zone Soil | ATGEEVLRRLTPLSGLQEDILQRLGLSASLYRQLEIQEIGN* |
Ga0137425_10375372 | 3300011422 | Soil | RRLTPLSGLQEDILQRLGLGAALYRQLEIQAIGH* |
Ga0137388_114448521 | 3300012189 | Vadose Zone Soil | AGEEILRRLIPLSGLQEEILQRLGLGASLYGQLEIQEIGN* |
Ga0137383_101377971 | 3300012199 | Vadose Zone Soil | RRLTPLSGLQEDILQRQGCGTALYRQLEMQNMSN* |
Ga0137383_113171552 | 3300012199 | Vadose Zone Soil | RWLTPLSALQQAILYRLGLATSLYQQLERQNSGN* |
Ga0137365_100872805 | 3300012201 | Vadose Zone Soil | GEEILRRLTPLSGLQKDILQRLGVGTNLYRQLEIQNMGS* |
Ga0137365_112119571 | 3300012201 | Vadose Zone Soil | EDILRRLTPLSTLQQEILRRLGLGASLYRQLEIDDIGNG* |
Ga0137374_101917833 | 3300012204 | Vadose Zone Soil | WRLTPLSALQEDILQRLGLGATLYGQLEIQAIGT* |
Ga0137362_102610362 | 3300012205 | Vadose Zone Soil | AGEEILRRLTPLSRVQEAILQRLGLGTNLYRQLEIQNMES* |
Ga0137380_114757811 | 3300012206 | Vadose Zone Soil | RRLTSLSRLQEDILQRLGLGVTLYAQLEIQAMGT* |
Ga0137379_102355403 | 3300012209 | Vadose Zone Soil | RWLTPLSALQQEILHRLGLATSLYRQLEIQNGGN* |
Ga0137379_104067371 | 3300012209 | Vadose Zone Soil | DILRRLTPLSGLQEDILQRLGLGATLYRQLEIQAIGT* |
Ga0137379_112119392 | 3300012209 | Vadose Zone Soil | RRLTPLSAVQEDILQRLGLGAALYRQLEIQEMGN* |
Ga0137378_104231461 | 3300012210 | Vadose Zone Soil | QRLTPLSALQQDILQRLGLGVSLYQQLEIQNMRG* |
Ga0137378_104946742 | 3300012210 | Vadose Zone Soil | GEEILRRLTPLSGLQEDILQRQGLSTALYGQLEIQEIGN* |
Ga0137378_114186861 | 3300012210 | Vadose Zone Soil | AAGDYMLWRLTPLSALQEDILQRLGLGATLYGQLEIQAIGT* |
Ga0137378_116703812 | 3300012210 | Vadose Zone Soil | RRLTPLSGLQEDILQRLGLGATLYGQLEIQTIAI* |
Ga0137377_107381383 | 3300012211 | Vadose Zone Soil | AAGEEILRRLTPLSGLQEELLQRQGLGTSLYRQLEIRDIGN* |
Ga0137377_108969152 | 3300012211 | Vadose Zone Soil | RRLTPLSGLQKDILQRLGLGTNLYRQLEIQNMES* |
Ga0137387_100796421 | 3300012349 | Vadose Zone Soil | AGEEILRRLTPLSGLQEDILQRQGCGTALYRQLEMQNMSN* |
Ga0137385_109081982 | 3300012359 | Vadose Zone Soil | DILRRLTPLSGLQEDILQRLGLGAALYEQLEIQAIGH* |
Ga0137385_114864463 | 3300012359 | Vadose Zone Soil | RRLTPLSGLQEDILQRQGFGTALYRQLEMQNMSN* |
Ga0137385_115254212 | 3300012359 | Vadose Zone Soil | DILRRLTPLSGLQEDILQRLGLGAALYGQLEIQTIGN* |
Ga0137360_106636521 | 3300012361 | Vadose Zone Soil | AAGEDMLRRLTPLTGLQEDILQRLGLGATLYGQLEIPAIGT* |
Ga0137361_104708652 | 3300012362 | Vadose Zone Soil | ATGEEMLRRLTPLSGVQEAILHRLELGTHLYRQLEI* |
Ga0137361_105264401 | 3300012362 | Vadose Zone Soil | GEDILRRLTPLSTLQQEILRRLGLGASLYRQLEIHDIGNG* |
Ga0137390_109563411 | 3300012363 | Vadose Zone Soil | ILRRLTPLSRVQEAILQRLGLGTNLYRQLEIQNMEG* |
Ga0137358_110185801 | 3300012582 | Vadose Zone Soil | VRRLTPLSACQEDILQRLGLGTALYGQLEIQNIEK* |
Ga0137397_112864951 | 3300012685 | Vadose Zone Soil | ILRRLTPLSGVQETILQCLGLDTSLYRQLEIQGIGN* |
Ga0137395_102715083 | 3300012917 | Vadose Zone Soil | AAGEEILRRLTPLSKLQEEILQRLGLDTSLYGQLEIQEIEN* |
Ga0137396_100207801 | 3300012918 | Vadose Zone Soil | EILRRLTPLSGLQEDILQRLGLGATLYAQLEIQAIGD* |
Ga0137394_107973362 | 3300012922 | Vadose Zone Soil | RRLTPLTGLQEDILQRLGLGATLYGQLEIPAIGT* |
Ga0137359_101354513 | 3300012923 | Vadose Zone Soil | GEEILRRLTPLSGVQEAILQRLGLGTNLYRQLEIQNIEK* |
Ga0137404_1000189917 | 3300012929 | Vadose Zone Soil | HRLTPLSGVQEDILQRLGVGATLDGQLEIQAIEA* |
Ga0137404_109551051 | 3300012929 | Vadose Zone Soil | RRLTPLSGVQEAILQRLGLGTNLYRQLEIQNMKN* |
Ga0126375_111505202 | 3300012948 | Tropical Forest Soil | AGEDILRRLTSLSRLQEDILQRLGLGATLYTQLEIQAMGT* |
Ga0126369_100460421 | 3300012971 | Tropical Forest Soil | EDILRRLTPLSGVQEDILQRLGLGTALYGQLEIQTMGT* |
Ga0126369_105576633 | 3300012971 | Tropical Forest Soil | AAGEDILRRLTPLSELQEDILQRLGLGVTLSRQLEMQTMEV* |
Ga0126369_136025452 | 3300012971 | Tropical Forest Soil | RRLTPLSGLQEDILQRLGLGASLYEQLEIQEMGN* |
Ga0163162_126586961 | 3300013306 | Switchgrass Rhizosphere | RRITPLSGVQEAILQRLGLGTNLYRQLEIQNMGS* |
Ga0134075_104332681 | 3300014154 | Grasslands Soil | AGEDILRRLTPLSGFQEDILQRLGLGATLYGQLEIQTIGI* |
Ga0184637_101043804 | 3300018063 | Groundwater Sediment | RRLTPLSGLQEDILQRQGLGVSLYGQLAIQEIGNG |
Ga0184618_100228382 | 3300018071 | Groundwater Sediment | MLRRLTPLTGLQEDILQRLGLGATLYGQLEIPAIGT |
Ga0210378_103424391 | 3300021073 | Groundwater Sediment | GEEILRWLTPLAGLQEDIQRRLGLDTALYRQLEIHDIGN |
Ga0179596_102507812 | 3300021086 | Vadose Zone Soil | LRRLTPLSGVQEDILQRLGLGTALYRQLEIQEMEN |
Ga0187846_103661542 | 3300021476 | Biofilm | LRRLTSLSGLQKDILQRLGLGASLYGQLEIQEMGN |
Ga0207684_100607616 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ANLWVKRQTPLSGLQEELLQRQGLGTSLYRQLEIRDIGN |
Ga0207663_115345462 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LRRLTPLSGVQEAILQRLGLGTNLYRQLEIQNMKS |
Ga0207646_100733921 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LRRLTPLSGLQEDILQRLGLGASLYRQLEIQEMGN |
Ga0207712_108334243 | 3300025961 | Switchgrass Rhizosphere | LRRLTPLSTLQQEVLRRLGLETSLYRQLEIHDMGN |
Ga0209235_12443701 | 3300026296 | Grasslands Soil | LRRLTPLSGLQEDILQRLGLGATLYGQLEIQTIAI |
Ga0209239_10556103 | 3300026310 | Grasslands Soil | LRRLTPLSGGQEAILQRLGLGANLYQQLEIQNIEK |
Ga0209152_105058161 | 3300026325 | Soil | ILRRLTPLSWLQEDILQRLGLGATLYRQLEIQAIGT |
Ga0209158_13310372 | 3300026333 | Soil | LRRLTPLSGLQEDILQRLGLGATFYGQLEIQAMST |
Ga0257166_10413611 | 3300026358 | Soil | MRRLTPLSAVQEAIVQRLGLGTNLYRQLEIQNMKN |
Ga0209378_10865813 | 3300026528 | Soil | AGGEEILRRITPLSGVQEAILQRLGLSTHLYRQLEIQNMGS |
Ga0209157_13865091 | 3300026537 | Soil | GEEILRRLTPLSAVQEDILQRLGLGAALYRQLEIQEMGN |
Ga0209388_10943482 | 3300027655 | Vadose Zone Soil | LRRLTPLTGLQEDILQRLGLGATLYGQLEIPAIGT |
Ga0209388_11844742 | 3300027655 | Vadose Zone Soil | LRRITPLSGVQEAILQRLGLGTHLYRQLEIQNMGS |
Ga0209388_12323082 | 3300027655 | Vadose Zone Soil | RRWLTPLSALQQAILYGLGLTPSLYQQLEMQNSGN |
Ga0209077_11598533 | 3300027675 | Freshwater Sediment | LRRLTPLSGVQEDILQRLGLGATLYGQLEIQAIEA |
Ga0209283_106172102 | 3300027875 | Vadose Zone Soil | LRRLTPLSGVQEAILQRLGLGVSLYGQLEIHDSGN |
Ga0209283_106300402 | 3300027875 | Vadose Zone Soil | LRRLTPRSALQEDILQRLGLGASLYRQLEIQEMGN |
Ga0209283_106869552 | 3300027875 | Vadose Zone Soil | ILRRLTPLSGLQEEILQRLGLGTSLYRQLEIQEIGN |
Ga0209590_100521221 | 3300027882 | Vadose Zone Soil | LQRLTPLSTLPQDILQRLGLDPSLSQQLDMHDTGN |
Ga0209590_101068582 | 3300027882 | Vadose Zone Soil | LRRLTPLSGLQEDILRRLGLSAALYEQLEIQAIGH |
Ga0209590_104211782 | 3300027882 | Vadose Zone Soil | MRRLTPLSGLQEEILQRQGLGTSLYGQLEIQEIGN |
Ga0209590_105478602 | 3300027882 | Vadose Zone Soil | LRRLTPLSELQEDILQRLGLGVTLYRQLEIQTIEV |
Ga0209590_106055382 | 3300027882 | Vadose Zone Soil | LRRLTPLSGLQEDILQRLGLGAALYGQLEIQTIGN |
Ga0209590_107215071 | 3300027882 | Vadose Zone Soil | LRRLTPLSGLQEDILQRQGLGPALYRQLEIQNMSN |
Ga0209590_107874871 | 3300027882 | Vadose Zone Soil | LRRLTPLSELQKDILQRLGLDAALYEQLEIQTIGN |
Ga0209590_109468322 | 3300027882 | Vadose Zone Soil | LRWLTPLSVLQEEILQRQGFGIALYRQLAIQHIRN |
Ga0209382_100071921 | 3300027909 | Populus Rhizosphere | LRRLTPLSGVQEDILQRLGLGAALYGQLEIPAIGT |
Ga0209853_11535062 | 3300027961 | Groundwater Sand | HAAGEDILRRLTPLSGLQEDLLQRLGLGATLYGQLEIQTIGI |
Ga0247828_100199591 | 3300028587 | Soil | LRRITPLSGVQEAILQRLGLGTNLYRQLEIQNMGS |
Ga0307298_100218011 | 3300028717 | Soil | LRRLTPLSTLQQESLRRLGLGASLYRQLAIHDIGNG |
Ga0307504_101698531 | 3300028792 | Soil | RRWLTPLSALQQAILSRLGLATALYQQLEIQNSGN |
Ga0307302_101272091 | 3300028814 | Soil | LQRLTPLSTLQQAILQRLGLDMSLYQQLEIHYTGKGLGEW |
Ga0307312_111363511 | 3300028828 | Soil | LRRLTPLSGLQEDILQRLGLGAALYRQLEIQAIGH |
Ga0299907_107829431 | 3300030006 | Soil | LRRLTPLSGLQEDILQRLGLGASLYRQLEIQEIGN |
Ga0268386_110130551 | 3300030619 | Soil | LRRLTPLSEVQQDILRRLGLGVSLYRQLEIQDIRNG |
Ga0308200_10622542 | 3300030905 | Soil | DILRRLTPLSGLQEEILQRLGLGATLYRQLEIQAIGT |
Ga0308199_10343793 | 3300031094 | Soil | AAGEEILRRLTPLSGLQEEILQRQGLGTSLYRQLEIRDIGN |
Ga0310887_100350041 | 3300031547 | Soil | LRRLTPLSGLQEDILQRLGLGATLYMQLEIQAIGI |
Ga0310915_101796471 | 3300031573 | Soil | LRRLTPLSGLQEDILQRLGLDAALYGQLEIQAIGH |
Ga0306925_111606282 | 3300031890 | Soil | LRRLTSLSGLQEDILQRLGLGASLYGQLEIQEMGN |
Ga0307406_106879432 | 3300031901 | Rhizosphere | LRRLTPLSGLQEDILQRLGLGASLYGQLEIQEMGT |
Ga0306921_103613961 | 3300031912 | Soil | VRRLTPLSALQEDILQRLGLGTSLYRQLEMQDIGQ |
Ga0306922_102530961 | 3300032001 | Soil | LRRLTPLSGLQEDILQRLGLGAALYRQLEIQEMVN |
Ga0307414_116749951 | 3300032004 | Rhizosphere | DILRRLTPLSGVQETILQCLGLGTSLYRQLEIQGIGH |
Ga0310890_105334293 | 3300032075 | Soil | SAAGEDILRRLTPLSGVQEDILQRLGLGTALYGQLEIQTMGT |
Ga0307471_1021127312 | 3300032180 | Hardwood Forest Soil | LRRLTPLSGLQEDILQRLGLGAVLYGQLEIQAIGH |
Ga0307471_1030509061 | 3300032180 | Hardwood Forest Soil | GEEILRRMTPLSGGQETILQRLGLGTQLYRQLAIQHMGS |
Ga0306920_1039058791 | 3300032261 | Soil | LRRITPLSGVQEAILQRLGLGTTLYRQLEIQNMGS |
Ga0310914_113880271 | 3300033289 | Soil | MRRLTPLSALQQDILHRLGLGTALYRQLEMHNIGNG |
Ga0310914_114695361 | 3300033289 | Soil | EILRRLTPLSGVQEDILQRLGLGTVLYRQLEIQAIGN |
Ga0214472_100002911 | 3300033407 | Soil | LRQVTPLSAVQEEILKRLGLSLSLYRQLEIQETRN |
Ga0214472_100504766 | 3300033407 | Soil | ILRQVTPLSAVQEEILKRLGLSLSLYRQLEIQETRN |
Ga0247829_111459272 | 3300033550 | Soil | ATGEGILRRLTPLSGVQETILQCLGLGTSLYRQLETYISRE |
Ga0247830_106106201 | 3300033551 | Soil | LRRLTPLSGLQEDILQRLGWGAALYGQLEIQGIGT |
Ga0364931_0341247_3_116 | 3300034176 | Sediment | EIVRRLTPLSELQQDILRRLGLGTSLYRQLEIQDSGN |
⦗Top⦘ |