| Basic Information | |
|---|---|
| Family ID | F044990 |
| Family Type | Metagenome |
| Number of Sequences | 153 |
| Average Sequence Length | 40 residues |
| Representative Sequence | KSICKEIALQRPKTGKFDYLSGPNHPAHSIAFKFFTDDY |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.65 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.58 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.895 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.680 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.516 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (68.627 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.87% β-sheet: 0.00% Coil/Unstructured: 73.13% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 5.88 |
| PF11453 | DUF2950 | 5.23 |
| PF00211 | Guanylate_cyc | 1.96 |
| PF13467 | RHH_4 | 1.96 |
| PF03401 | TctC | 1.31 |
| PF00816 | Histone_HNS | 1.31 |
| PF01965 | DJ-1_PfpI | 1.31 |
| PF03636 | Glyco_hydro_65N | 1.31 |
| PF02357 | NusG | 0.65 |
| PF13817 | DDE_Tnp_IS66_C | 0.65 |
| PF02530 | Porin_2 | 0.65 |
| PF00512 | HisKA | 0.65 |
| PF02518 | HATPase_c | 0.65 |
| PF16861 | Carbam_trans_C | 0.65 |
| PF13531 | SBP_bac_11 | 0.65 |
| PF05711 | TylF | 0.65 |
| PF07883 | Cupin_2 | 0.65 |
| PF12697 | Abhydrolase_6 | 0.65 |
| PF07813 | LTXXQ | 0.65 |
| PF13281 | MAP3K_TRAF_bd | 0.65 |
| PF08734 | GYD | 0.65 |
| PF00724 | Oxidored_FMN | 0.65 |
| PF00884 | Sulfatase | 0.65 |
| PF04545 | Sigma70_r4 | 0.65 |
| PF14707 | Sulfatase_C | 0.65 |
| PF07045 | DUF1330 | 0.65 |
| PF05532 | CsbD | 0.65 |
| PF07452 | CHRD | 0.65 |
| PF16254 | DUF4910 | 0.65 |
| PF00534 | Glycos_transf_1 | 0.65 |
| PF05362 | Lon_C | 0.65 |
| PF13493 | DUF4118 | 0.65 |
| PF05598 | DUF772 | 0.65 |
| PF01138 | RNase_PH | 0.65 |
| PF13751 | DDE_Tnp_1_6 | 0.65 |
| PF05050 | Methyltransf_21 | 0.65 |
| PF01315 | Ald_Xan_dh_C | 0.65 |
| PF12728 | HTH_17 | 0.65 |
| PF00589 | Phage_integrase | 0.65 |
| PF07536 | HWE_HK | 0.65 |
| PF01809 | YidD | 0.65 |
| PF01757 | Acyl_transf_3 | 0.65 |
| PF02735 | Ku | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 5.88 |
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 2.61 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.96 |
| COG1554 | Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamily | Carbohydrate transport and metabolism [G] | 1.31 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.31 |
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 1.31 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.65 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.65 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.65 |
| COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 0.65 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.65 |
| COG3637 | Opacity protein LomR and related surface antigens | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 0.65 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.65 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.65 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 0.65 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.65 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG0759 | Membrane-anchored protein YidD, putatitve component of membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.90 % |
| Unclassified | root | N/A | 28.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000651|AP72_2010_repI_A10DRAFT_1008087 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300000956|JGI10216J12902_108602615 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300004633|Ga0066395_10702172 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005332|Ga0066388_102878516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 879 | Open in IMG/M |
| 3300005332|Ga0066388_108006930 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005552|Ga0066701_10584502 | Not Available | 682 | Open in IMG/M |
| 3300005561|Ga0066699_10169994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1501 | Open in IMG/M |
| 3300005713|Ga0066905_100609159 | Not Available | 925 | Open in IMG/M |
| 3300005713|Ga0066905_100887004 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → unclassified Gemmataceae → Gemmataceae bacterium | 779 | Open in IMG/M |
| 3300005764|Ga0066903_100220681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2873 | Open in IMG/M |
| 3300005764|Ga0066903_101731562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1191 | Open in IMG/M |
| 3300005764|Ga0066903_101769217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1179 | Open in IMG/M |
| 3300005764|Ga0066903_102576949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300005764|Ga0066903_103297461 | Not Available | 872 | Open in IMG/M |
| 3300005764|Ga0066903_103549701 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300005764|Ga0066903_104562012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 738 | Open in IMG/M |
| 3300005764|Ga0066903_106552380 | Not Available | 606 | Open in IMG/M |
| 3300005764|Ga0066903_106594673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
| 3300005764|Ga0066903_107052092 | Not Available | 582 | Open in IMG/M |
| 3300005764|Ga0066903_107322834 | Not Available | 570 | Open in IMG/M |
| 3300005764|Ga0066903_108103598 | Not Available | 538 | Open in IMG/M |
| 3300005764|Ga0066903_108258994 | Not Available | 532 | Open in IMG/M |
| 3300005764|Ga0066903_108722089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300005764|Ga0066903_108891703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d | 509 | Open in IMG/M |
| 3300005764|Ga0066903_109035457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300006800|Ga0066660_10457061 | Not Available | 1068 | Open in IMG/M |
| 3300007255|Ga0099791_10189377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 968 | Open in IMG/M |
| 3300007258|Ga0099793_10131023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1179 | Open in IMG/M |
| 3300009012|Ga0066710_100735417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1507 | Open in IMG/M |
| 3300010046|Ga0126384_11654004 | Not Available | 604 | Open in IMG/M |
| 3300010048|Ga0126373_12418870 | Not Available | 585 | Open in IMG/M |
| 3300010358|Ga0126370_11410653 | Not Available | 658 | Open in IMG/M |
| 3300010361|Ga0126378_10484235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1352 | Open in IMG/M |
| 3300010361|Ga0126378_10788650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1060 | Open in IMG/M |
| 3300010361|Ga0126378_12470147 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300010361|Ga0126378_12693024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 568 | Open in IMG/M |
| 3300010366|Ga0126379_10431272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1374 | Open in IMG/M |
| 3300010366|Ga0126379_12012559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300010366|Ga0126379_13251330 | Not Available | 544 | Open in IMG/M |
| 3300010366|Ga0126379_13874371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300010376|Ga0126381_100870550 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300010376|Ga0126381_101014497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1197 | Open in IMG/M |
| 3300010396|Ga0134126_10430903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1528 | Open in IMG/M |
| 3300010398|Ga0126383_10171152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2051 | Open in IMG/M |
| 3300010398|Ga0126383_11792620 | Not Available | 702 | Open in IMG/M |
| 3300011120|Ga0150983_15837971 | Not Available | 579 | Open in IMG/M |
| 3300011270|Ga0137391_11419790 | Not Available | 540 | Open in IMG/M |
| 3300012209|Ga0137379_10999632 | Not Available | 741 | Open in IMG/M |
| 3300012362|Ga0137361_10287466 | Not Available | 1503 | Open in IMG/M |
| 3300012532|Ga0137373_10752110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 723 | Open in IMG/M |
| 3300012971|Ga0126369_10489654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1286 | Open in IMG/M |
| 3300012971|Ga0126369_10841257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1001 | Open in IMG/M |
| 3300012971|Ga0126369_11113036 | Not Available | 879 | Open in IMG/M |
| 3300012971|Ga0126369_12230603 | Not Available | 635 | Open in IMG/M |
| 3300012971|Ga0126369_12641074 | Not Available | 587 | Open in IMG/M |
| 3300016270|Ga0182036_10088157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2075 | Open in IMG/M |
| 3300016270|Ga0182036_10264980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1293 | Open in IMG/M |
| 3300016270|Ga0182036_10912630 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300016294|Ga0182041_10141589 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300016294|Ga0182041_10287156 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300016294|Ga0182041_10325290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3324 | 1284 | Open in IMG/M |
| 3300016294|Ga0182041_10723599 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300016319|Ga0182033_10362130 | Not Available | 1216 | Open in IMG/M |
| 3300016319|Ga0182033_10394467 | Not Available | 1168 | Open in IMG/M |
| 3300016357|Ga0182032_10206974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1497 | Open in IMG/M |
| 3300016357|Ga0182032_10234518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1417 | Open in IMG/M |
| 3300016357|Ga0182032_10475171 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300016357|Ga0182032_10522137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 979 | Open in IMG/M |
| 3300016357|Ga0182032_10904767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300016371|Ga0182034_11355639 | Not Available | 621 | Open in IMG/M |
| 3300016387|Ga0182040_10373139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1112 | Open in IMG/M |
| 3300016387|Ga0182040_11023808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 689 | Open in IMG/M |
| 3300016404|Ga0182037_10445945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1075 | Open in IMG/M |
| 3300016404|Ga0182037_11026418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300016422|Ga0182039_11173582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter appositus | 693 | Open in IMG/M |
| 3300016445|Ga0182038_10104209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2069 | Open in IMG/M |
| 3300018468|Ga0066662_11320824 | Not Available | 740 | Open in IMG/M |
| 3300021560|Ga0126371_12084091 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300021560|Ga0126371_12260235 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300021560|Ga0126371_12913547 | Not Available | 580 | Open in IMG/M |
| 3300021560|Ga0126371_13801567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300026557|Ga0179587_10921788 | Not Available | 576 | Open in IMG/M |
| 3300027654|Ga0209799_1003275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3283 | Open in IMG/M |
| 3300027846|Ga0209180_10405249 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300027903|Ga0209488_10311906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1174 | Open in IMG/M |
| 3300031545|Ga0318541_10285314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 919 | Open in IMG/M |
| 3300031545|Ga0318541_10370451 | Not Available | 800 | Open in IMG/M |
| 3300031572|Ga0318515_10071851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1779 | Open in IMG/M |
| 3300031573|Ga0310915_10088960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2067 | Open in IMG/M |
| 3300031573|Ga0310915_10971305 | Not Available | 593 | Open in IMG/M |
| 3300031640|Ga0318555_10103306 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300031679|Ga0318561_10437234 | Not Available | 719 | Open in IMG/M |
| 3300031681|Ga0318572_10765804 | Not Available | 574 | Open in IMG/M |
| 3300031682|Ga0318560_10021695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2946 | Open in IMG/M |
| 3300031719|Ga0306917_10049160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2828 | Open in IMG/M |
| 3300031719|Ga0306917_10098479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2092 | Open in IMG/M |
| 3300031719|Ga0306917_10451850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1006 | Open in IMG/M |
| 3300031719|Ga0306917_10572909 | Not Available | 887 | Open in IMG/M |
| 3300031719|Ga0306917_11282353 | Not Available | 567 | Open in IMG/M |
| 3300031719|Ga0306917_11564406 | Not Available | 506 | Open in IMG/M |
| 3300031723|Ga0318493_10572765 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300031736|Ga0318501_10056041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1860 | Open in IMG/M |
| 3300031744|Ga0306918_10112074 | Not Available | 1962 | Open in IMG/M |
| 3300031744|Ga0306918_11133010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300031795|Ga0318557_10381906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300031795|Ga0318557_10402303 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300031796|Ga0318576_10406324 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300031796|Ga0318576_10466506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 596 | Open in IMG/M |
| 3300031797|Ga0318550_10243705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 872 | Open in IMG/M |
| 3300031798|Ga0318523_10157597 | Not Available | 1130 | Open in IMG/M |
| 3300031805|Ga0318497_10102105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1539 | Open in IMG/M |
| 3300031833|Ga0310917_10010073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5137 | Open in IMG/M |
| 3300031833|Ga0310917_10076282 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300031833|Ga0310917_10929961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 584 | Open in IMG/M |
| 3300031879|Ga0306919_10101878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2021 | Open in IMG/M |
| 3300031890|Ga0306925_10173499 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
| 3300031890|Ga0306925_10975069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium meliloti | 866 | Open in IMG/M |
| 3300031890|Ga0306925_12134427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300031897|Ga0318520_10230470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1100 | Open in IMG/M |
| 3300031910|Ga0306923_10123014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2945 | Open in IMG/M |
| 3300031910|Ga0306923_10209633 | All Organisms → cellular organisms → Bacteria | 2228 | Open in IMG/M |
| 3300031912|Ga0306921_10225598 | All Organisms → cellular organisms → Bacteria | 2195 | Open in IMG/M |
| 3300031912|Ga0306921_12043999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Brevibacillus | 609 | Open in IMG/M |
| 3300031941|Ga0310912_10050634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2917 | Open in IMG/M |
| 3300031942|Ga0310916_10526398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1007 | Open in IMG/M |
| 3300031942|Ga0310916_10636054 | Not Available | 905 | Open in IMG/M |
| 3300031942|Ga0310916_10688390 | Not Available | 865 | Open in IMG/M |
| 3300031945|Ga0310913_10531845 | Not Available | 834 | Open in IMG/M |
| 3300031947|Ga0310909_10004804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8705 | Open in IMG/M |
| 3300031947|Ga0310909_10263699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1441 | Open in IMG/M |
| 3300031954|Ga0306926_11146529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 916 | Open in IMG/M |
| 3300031954|Ga0306926_11483632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 783 | Open in IMG/M |
| 3300031954|Ga0306926_12366526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300032042|Ga0318545_10032229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1723 | Open in IMG/M |
| 3300032044|Ga0318558_10333620 | Not Available | 751 | Open in IMG/M |
| 3300032051|Ga0318532_10088737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1085 | Open in IMG/M |
| 3300032052|Ga0318506_10319992 | Not Available | 688 | Open in IMG/M |
| 3300032059|Ga0318533_10064906 | All Organisms → cellular organisms → Bacteria | 2462 | Open in IMG/M |
| 3300032063|Ga0318504_10165570 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300032076|Ga0306924_10437030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Gha | 1496 | Open in IMG/M |
| 3300032076|Ga0306924_11020811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 907 | Open in IMG/M |
| 3300032076|Ga0306924_11116252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300032076|Ga0306924_11452399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 729 | Open in IMG/M |
| 3300032094|Ga0318540_10070235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1607 | Open in IMG/M |
| 3300032159|Ga0268251_10591856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 509 | Open in IMG/M |
| 3300032261|Ga0306920_100417032 | Not Available | 1995 | Open in IMG/M |
| 3300032261|Ga0306920_100501471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11 | 1801 | Open in IMG/M |
| 3300032261|Ga0306920_100927938 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300032261|Ga0306920_101159137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1118 | Open in IMG/M |
| 3300032261|Ga0306920_102890307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300032261|Ga0306920_103212254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300033289|Ga0310914_10438943 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300033289|Ga0310914_10545634 | Not Available | 1047 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 14.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.31% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.65% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A10DRAFT_10080871 | 3300000651 | Forest Soil | LRFGGILKSICKEIALQGPKTGKFDYLSGLNHPAHSMAFKFFTDDA |
| JGI10216J12902_1086026151 | 3300000956 | Soil | KEIALQRPKTGKFDYLGMPNRSAHSMAFVFFTDD* |
| Ga0066395_107021723 | 3300004633 | Tropical Forest Soil | SSKSICKEIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDD* |
| Ga0066388_1028785161 | 3300005332 | Tropical Forest Soil | SKSICKEIALQRPKTGKFDYLSVPNHPAHSTAFEFFTDDKLVANTG* |
| Ga0066388_1080069301 | 3300005332 | Tropical Forest Soil | HNRICKKIALQQPKTGKFDYLSEPNHPAHSMAFKFFTDDDL* |
| Ga0066701_105845021 | 3300005552 | Soil | IRGNPQNRICKEIALQRPKTGKFGYLSVHNHPAHSMAFEFFTDD* |
| Ga0066699_101699943 | 3300005561 | Soil | KEIALQRSKTGKFDYFSTPNQPARSRDSEFFTDD* |
| Ga0066905_1006091591 | 3300005713 | Tropical Forest Soil | CKKIALQRPKTGKFDYLSEPNHPAHSMAFKFFTDDEYPRGGQL* |
| Ga0066905_1008870041 | 3300005713 | Tropical Forest Soil | RESSKSICKEIALQRPKTGKFDYLSGPNHPAHSIAFKFFTDDDLLTA* |
| Ga0066903_1002206811 | 3300005764 | Tropical Forest Soil | RKSICKEIALQRPKTGKFDYLSEPNHSAHSIAFKFFTDDSE* |
| Ga0066903_1017315621 | 3300005764 | Tropical Forest Soil | SKSICKEIALQRPKTGKFDYLSGPNHPAHSIAFKFFTNDDLEAMSGSEAP* |
| Ga0066903_1017692171 | 3300005764 | Tropical Forest Soil | SKSICKEIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDDKFVTQ* |
| Ga0066903_1025769492 | 3300005764 | Tropical Forest Soil | SKSICKEITLQRPKTGKFDYLSGLNHPAHSIAFKFFTDDCLRGGYGSIVL* |
| Ga0066903_1032974611 | 3300005764 | Tropical Forest Soil | SKSICKEIALQWSKTGKFDYLSGPNHPAHSIALEFFTDDESDS* |
| Ga0066903_1035497012 | 3300005764 | Tropical Forest Soil | SICKEIALQRPKTGKFDYLRGPNHSAHSIGFFTDD* |
| Ga0066903_1045620123 | 3300005764 | Tropical Forest Soil | KSICKEIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDDYL* |
| Ga0066903_1065523801 | 3300005764 | Tropical Forest Soil | NRICKKIALQRPKTGKFDYLSEPNHPAHSMAFKFFTDDYLPYHL* |
| Ga0066903_1065946731 | 3300005764 | Tropical Forest Soil | SKSICKEIALQRPKPGKFDYLSGLNHPAHSIAFKFFTDDYLL* |
| Ga0066903_1070520922 | 3300005764 | Tropical Forest Soil | KSICKEIALQRPKPGKFDYLSGLNHPAHSIAFKFFTDD* |
| Ga0066903_1073228341 | 3300005764 | Tropical Forest Soil | SKLICKGIALQRPKTGKFGYLSEPNHPANSMAFKFFTDD* |
| Ga0066903_1081035982 | 3300005764 | Tropical Forest Soil | RKSICKEIALQRPKTGKFDYLSEPNHSAHSIAFKFFTDD* |
| Ga0066903_1082589941 | 3300005764 | Tropical Forest Soil | SSKSICKEIALQRPKTGKFDYLSEPNHSAYSIAFKFFTDDH* |
| Ga0066903_1087220892 | 3300005764 | Tropical Forest Soil | KSICKEIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDDE* |
| Ga0066903_1088917031 | 3300005764 | Tropical Forest Soil | SKSICKEIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDDLLDSSS* |
| Ga0066903_1090354571 | 3300005764 | Tropical Forest Soil | SKSICKEIALQRPKIGKFDYLSEPNHPAHSIAFKFFTDD* |
| Ga0066660_104570611 | 3300006800 | Soil | EIALQRPKTGKFDYLSQPNHPAHSIAFKFFTDDEDSPDAGG* |
| Ga0099791_101893771 | 3300007255 | Vadose Zone Soil | KEIALQRSKTSKFDYFSTPNQPARPRDSEFFSDDVGTSLKRLL* |
| Ga0099793_101310234 | 3300007258 | Vadose Zone Soil | QNPICKEIALQRSKTGKFDYFRTPNQPARSRDSEFFTDD* |
| Ga0066710_1007354171 | 3300009012 | Grasslands Soil | NPQNRICKEVALQRPKTGKFDYLSAPNHPAHSMAFEFFTDD |
| Ga0126384_116540041 | 3300010046 | Tropical Forest Soil | PQNRICKKIALQRPKTGKFDYLSEPNHPAHSMAFKFFTDDYFN* |
| Ga0126373_124188701 | 3300010048 | Tropical Forest Soil | ICKEIALQWSKTGKFDYLSGPNHPAHSIALEFFTDD* |
| Ga0126370_114106531 | 3300010358 | Tropical Forest Soil | SSKSICKEIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDDKIGRRGQQQ* |
| Ga0126378_104842351 | 3300010361 | Tropical Forest Soil | ITLQRPKTGKFDYLSGLNHPAHSIAFKFFTDDYFGYV* |
| Ga0126378_107886501 | 3300010361 | Tropical Forest Soil | SKSICKEITLQRPKTGKFDYLSGLNHPAHSIAFKFFTDD* |
| Ga0126378_124701471 | 3300010361 | Tropical Forest Soil | KEITLQRPKTGKFDYLSGLNHPAHSIAFKFFTDD* |
| Ga0126378_126930242 | 3300010361 | Tropical Forest Soil | EIALQRPKTGKFDYLSELNHPAHSIAFKFFTDDALKLWAQV* |
| Ga0126379_104312723 | 3300010366 | Tropical Forest Soil | KEIALQRPKNGKFDYLSVPNHPAHSTAFEFFTDD* |
| Ga0126379_120125591 | 3300010366 | Tropical Forest Soil | KEIALQRPKTGKFDYLSGPNHPAHSIAFKFFTDDSLI* |
| Ga0126379_132513301 | 3300010366 | Tropical Forest Soil | KEIALQRPKTGKFDYLSGPNHPAHSIVFKFFTDD* |
| Ga0126379_138743711 | 3300010366 | Tropical Forest Soil | ICKEIALQRPKTGKFDYLSGPNHPAHSIVFKFFTDD* |
| Ga0126381_1008705503 | 3300010376 | Tropical Forest Soil | RVEGILKLVCKEIALQCSKTGKFDYLIGPNHPAHSIALEFFTDD* |
| Ga0126381_1010144971 | 3300010376 | Tropical Forest Soil | ESSKSICKEITLQRPKTGKFDYLSGLNHPAHSIAFKFFTDDE* |
| Ga0134126_104309033 | 3300010396 | Terrestrial Soil | QNRICKEIAFQRSKTSKFDHLSAPNQPAHSMAFEFFTDDGLAN* |
| Ga0126383_101711523 | 3300010398 | Tropical Forest Soil | PQNRICKKIALQRPKTGKFDYLSEPNHPAHSMAFKFFTDDYLYETSTG* |
| Ga0126383_117926201 | 3300010398 | Tropical Forest Soil | ICKGIALQRPKTGKFGYLSEPNHPANSMAFKFFTDD* |
| Ga0150983_158379711 | 3300011120 | Forest Soil | RGNPQNRICKEIALQRPKTGKFGYLSVHNHPAHSMAFEFFTDD* |
| Ga0137391_114197901 | 3300011270 | Vadose Zone Soil | PICKEIALQRSKTGKFDYFRTPNQPARSRDSEFFTDDGGR* |
| Ga0137379_109996321 | 3300012209 | Vadose Zone Soil | KEVDLQRSKTGKFDYFSTPNQPARSRDSEFFTDD* |
| Ga0137361_102874661 | 3300012362 | Vadose Zone Soil | LQRSKTGKFDYFRTPNQPARSRDSEFFTDDKFDA* |
| Ga0137373_107521101 | 3300012532 | Vadose Zone Soil | KEVALQRPKTGKFGYLSVHNHPAHSMAFEFFTDD* |
| Ga0126369_104896543 | 3300012971 | Tropical Forest Soil | SKSICKEIALQRPKTGKFDYLSVPNHPAHSTAFEFFTDG* |
| Ga0126369_108412571 | 3300012971 | Tropical Forest Soil | KEIALQRPKTGKFDYLSVPNHPAHSTAFEFFTND* |
| Ga0126369_111130361 | 3300012971 | Tropical Forest Soil | KSICKEIALQRPKTGKFDYLSGPNHPAHSIVFKFFTDDDIEVILVL* |
| Ga0126369_122306032 | 3300012971 | Tropical Forest Soil | SKSICKEIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDD* |
| Ga0126369_126410741 | 3300012971 | Tropical Forest Soil | SKSICKEIALQRPKTGKFDYLSVPNHPAHSTAFEFFTDD* |
| Ga0182036_100881571 | 3300016270 | Soil | SKSICKEIALQRPKTGKFDYLGRPNYPAHSIAFKFFTND |
| Ga0182036_102649801 | 3300016270 | Soil | EIAVQRPKTGKFDYLSGPNHPAHSIAFKFFTDDDF |
| Ga0182036_109126302 | 3300016270 | Soil | CKEIALQRPKTGKFDYLSVPNHPAHSTAFEFFTDD |
| Ga0182041_101415891 | 3300016294 | Soil | SSKSICKEIALQRPKTGKFDYLSGLNHPAHSMAFKFFTDD |
| Ga0182041_102871561 | 3300016294 | Soil | KEIALQRPKTGKFDYLSGPNHPARSIAFKFFTDDDLIPYRTSYYA |
| Ga0182041_103252904 | 3300016294 | Soil | KSICKEIAVQRPKTGKFDYLSGPNHPAHSIAFKFFTDD |
| Ga0182041_107235991 | 3300016294 | Soil | NRICKKIALQRPKTGKFDYLNEPNHPAHSMAFKFFTDD |
| Ga0182033_103621301 | 3300016319 | Soil | RESSKSICREIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDD |
| Ga0182033_103944671 | 3300016319 | Soil | SSKSICKEIALQRPKTVKFDYLTGLNHPAHSMAFKFFTDDSIN |
| Ga0182032_102069741 | 3300016357 | Soil | SKSICKEIALQRPKTGKFDYLSVPNHPAHSTAFEFFTDD |
| Ga0182032_102345184 | 3300016357 | Soil | SKSICKEIALQRPKTGKFDYLSGPNHPIHSVAFKFFTDD |
| Ga0182032_104751711 | 3300016357 | Soil | ICKEIAFQRSKTSKFDYLSAPNQPAHSMAFEFFTDDFDS |
| Ga0182032_105221371 | 3300016357 | Soil | SSKSICKEIAVQRPKTGKFDYLSGPNHPAHSIAFKFFTDDYIF |
| Ga0182032_109047671 | 3300016357 | Soil | NPQNRICKEIAFQRSKTSKFDYLSAPNQPAHSMAFEFFTDDDL |
| Ga0182034_113556391 | 3300016371 | Soil | DSRQNRICKEIAFQRSKTSKFDYLSAPNQPAHSMAFEFFTDDFDS |
| Ga0182040_103731391 | 3300016387 | Soil | WKLHCKEIALQRPKTGKFDNLSEPNHPAHSIAFEFFTDD |
| Ga0182040_110238081 | 3300016387 | Soil | ICKEIALQQPKAGKFDYLSAPGHSAHSMASEFFTDD |
| Ga0182037_104459451 | 3300016404 | Soil | IAVQRPKTGKFDYLSGPNHPAHSIAFKFFTDDYIF |
| Ga0182037_110264181 | 3300016404 | Soil | DSGFVQSSKSICKEIALQRPKTGKFDYLSGPNHPARSIAFKFFTDD |
| Ga0182039_111735822 | 3300016422 | Soil | ESSKSICKEIALQRPKTGKFDYLSGPNYPAHSIAFKFFTDDA |
| Ga0182038_101042091 | 3300016445 | Soil | SKSICKEIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDDDLGW |
| Ga0066662_113208241 | 3300018468 | Grasslands Soil | NRIRKEIALQRPKTGKFDYLSEPNHPTHSMAFKFFTDD |
| Ga0126371_120840911 | 3300021560 | Tropical Forest Soil | SSKSICKEIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDD |
| Ga0126371_122602352 | 3300021560 | Tropical Forest Soil | SSKSICKEIALQRPKTGKFDYLSVPNHPAHSTAFEFFTDD |
| Ga0126371_129135471 | 3300021560 | Tropical Forest Soil | ESSKSICKEIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDDHFFWRLAP |
| Ga0126371_138015671 | 3300021560 | Tropical Forest Soil | SSKSICKEITLQRPKTGKFDYLSGLNHPAHSIAFKFFTDDSLSYKA |
| Ga0179587_109217881 | 3300026557 | Vadose Zone Soil | NPQNRIRKEIALQRPKTGKFDYLSQPNHPAHSIAFKFFTDD |
| Ga0209799_10032751 | 3300027654 | Tropical Forest Soil | PHNRICKKIALQQPKTGKFDYLSEPNHPAHSMAFKFFTDD |
| Ga0209180_104052491 | 3300027846 | Vadose Zone Soil | ICKEIALQRSKTGKFDYFRTPNQPARSRDSEFFTDD |
| Ga0209488_103119061 | 3300027903 | Vadose Zone Soil | QNRICKEIALQRLKTGKFGYLSVHNHPAHSMAFEFFTDDYS |
| Ga0318541_102853141 | 3300031545 | Soil | KSICKEIALQRPKTGKFDYLGRPNYPAHSIAFKFFTNDWKNEII |
| Ga0318541_103704511 | 3300031545 | Soil | ESSKVICKEIALQRSKTGKFDYLSEPNHPAHSMAFKFFTGD |
| Ga0318515_100718511 | 3300031572 | Soil | CKEIALQGPKTGKFDYLSGPNHPAHSIAFKFFTDD |
| Ga0310915_100889604 | 3300031573 | Soil | ESSKSICKEIALQRPKTGKFDYLGRPNYPAHSIAFKFFTNDWKNEII |
| Ga0310915_109713051 | 3300031573 | Soil | KEIALQGPKTGKFDYLSGPNHPAHSIAFKFFTDDYLVARYEQ |
| Ga0318555_101033063 | 3300031640 | Soil | ESSKSICKEIALQRPKTGKFDYLSGLNHPAHSMAFKFFTDD |
| Ga0318561_104372343 | 3300031679 | Soil | IALQRPKTGKFDYLGRPNYPAHSIAFKFFTNDWKNEII |
| Ga0318572_107658041 | 3300031681 | Soil | QRPKTGKFDYLGRPNYPAHSIAFKFFTNDWKNEII |
| Ga0318560_100216951 | 3300031682 | Soil | SICKEIALQRPKTGKFDYLGRPNYPAHSIAFKFFTND |
| Ga0306917_100491601 | 3300031719 | Soil | NPQNRICKEIALQKPKTGKFDYFSTPNQPARSRDLEFFTDD |
| Ga0306917_100984794 | 3300031719 | Soil | RESSKSICKEIALQRPKTGKFDYLGRPNYPAHSIAFKFFTNDWKNEII |
| Ga0306917_104518501 | 3300031719 | Soil | KSICKEIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDD |
| Ga0306917_105729092 | 3300031719 | Soil | ICKEIALQRPKTVKFDYLTGLNHPAHSMAFKFFTDDSIN |
| Ga0306917_112823532 | 3300031719 | Soil | NRICKEIAFQRSKTSKFDYLSAPNQPAHSMAFEFFTDD |
| Ga0306917_115644061 | 3300031719 | Soil | FKEIAVQRPKTGKFDYLSGPNHPAHSIAFKFFTDD |
| Ga0318493_105727651 | 3300031723 | Soil | ESSKSICKEIALQRPKTGKFDYLSGPNHPIHSVAFKFFTDD |
| Ga0318501_100560415 | 3300031736 | Soil | CKEIALQRPKTGKFDYLGRPNYPAHSIAFKFFTND |
| Ga0306918_101120741 | 3300031744 | Soil | VICKEIALQGPKTGKFDYLSGPNHPAHSIAFKFFTDD |
| Ga0306918_111330102 | 3300031744 | Soil | NRICKEIAFQRSKTSKFDYLSAPNQPAHSMAFEFFTDDDL |
| Ga0318557_103819061 | 3300031795 | Soil | SICKEIAVQRPKTGKFDYLSGPNHPAHSIAFKFFTDDYIF |
| Ga0318557_104023032 | 3300031795 | Soil | CKEIALQRPKTGKFDYLSGPNHPIHSVAFKFFTDD |
| Ga0318576_104063241 | 3300031796 | Soil | SSKSICKEIALQRPKTGKFDYLSGPNHPIHSVAFKFFTDD |
| Ga0318576_104665061 | 3300031796 | Soil | NPQNRICKEIAFQRSKTSKFDYLSAPNQPAHSMAFEFFTDDFDS |
| Ga0318550_102437052 | 3300031797 | Soil | ESLNRICKEIALQRPEAGKFDYLSAPNHPAHSTASEFFTDD |
| Ga0318523_101575971 | 3300031798 | Soil | EIALQGPKTGKFDYLSGPNHPAHSIAFKFFTDDYAR |
| Ga0318497_101021053 | 3300031805 | Soil | PQNRICKEIALQKPKTGKFDYFSTPNQPARSRDLEFFTDD |
| Ga0310917_100100737 | 3300031833 | Soil | SSKSICKEIALQRPKTGKFDYLGRPNYPAHSIAFKFFTNDWKNEII |
| Ga0310917_100762823 | 3300031833 | Soil | RQNRICKEIAFQRSKTSKFDYLSAPNQPAHSMAFEFFTDDFDS |
| Ga0310917_109299611 | 3300031833 | Soil | EIALQGPKTGKFDYLSGPNHPAHSIAFKFFTDDCVAICRSV |
| Ga0306919_101018784 | 3300031879 | Soil | SKSICKEIALQRPKTGKFDYLGRPNYPAHSIAFKFFTNDWKNEII |
| Ga0306925_101734993 | 3300031890 | Soil | NRICKEIAFQRSKTSKFDYLSAPNQPAHSMAFEFFTDDFDS |
| Ga0306925_109750692 | 3300031890 | Soil | KSICKEIALQRPKTGKFDYLSGPNHPAHSIAFKFFTDDY |
| Ga0306925_121344272 | 3300031890 | Soil | ESSKSICKEIALQRPKTGKFDYLGRPNYPAHSIAFKFFTND |
| Ga0318520_102304702 | 3300031897 | Soil | ESSKSICKEIAVQRPKTGKFDYLSGPNHPAHSIAFKFFTDDYIF |
| Ga0306923_101230141 | 3300031910 | Soil | RESSKSICKEIALQRPKTGKFDYLGRPNYPAHSIAFKFFTND |
| Ga0306923_102096331 | 3300031910 | Soil | ITASDSRQNRICKEIAFQRSKTSKFDYLSAPNQPAHSMAFEFFTDDFDS |
| Ga0306921_102255981 | 3300031912 | Soil | ASDSRQNRICKEIAFQRSKTSKFDYLSAPNQPAHSMAFEFFTDDFDS |
| Ga0306921_120439991 | 3300031912 | Soil | KSICKEIAVQRPKTGKFDYLSGPNHPAHSIAFKFFTDDKVLYQT |
| Ga0310912_100506341 | 3300031941 | Soil | ICKEIALQRPKTGKFDYLGRPNYPAHSIAFKFFTND |
| Ga0310916_105263981 | 3300031942 | Soil | SSKLICKEIALQRPKTGKFDYLSAPGHSVHSMASEFFTDD |
| Ga0310916_106360543 | 3300031942 | Soil | SICKEIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDDDLGW |
| Ga0310916_106883902 | 3300031942 | Soil | KVICKEIALQGPKTGKFDYLSGPNHPAHSIAFKFFTDD |
| Ga0310913_105318452 | 3300031945 | Soil | SKVICKEIALQGPKTGKFDYLSGPNHPAHSIAFKFFTDD |
| Ga0310909_1000480410 | 3300031947 | Soil | NPQNKICKEIALQRPKTGKFDYFNPPNRPAHSVGSEFFTDDSLHWY |
| Ga0310909_102636991 | 3300031947 | Soil | CKEIALQQPKAGKFDYLSAPGHSAHSMASEFFTDD |
| Ga0306926_111465291 | 3300031954 | Soil | SSKSICKEIALQRPKTGKFDYLSGPNHPARSIAFKFFTDD |
| Ga0306926_114836321 | 3300031954 | Soil | SKSICKEIALQQPKAGKFDYLSAPGHSAHSMASEFFTDD |
| Ga0306926_123665262 | 3300031954 | Soil | ESSKSICKEIALQRPKTGKFDYLSAPGHSAHSMASEFFTDD |
| Ga0318545_100322295 | 3300032042 | Soil | KVICKEIALQGPKTGKFDYLSGPNHPAHSIAFKLFTDD |
| Ga0318558_103336202 | 3300032044 | Soil | LQRPKTGKFDYLGRPNYPAHSIAFKFFTNDWKNEII |
| Ga0318532_100887373 | 3300032051 | Soil | QTPKTGKFDYLGRPNYPAHSIAFKFFTNDWKNEII |
| Ga0318506_103199922 | 3300032052 | Soil | QNRICKKIALQRPKTGKFDYLNEPNHPAHSMAFKFFTDD |
| Ga0318533_100649064 | 3300032059 | Soil | EIAFQRSKTSKFDYLSAPNQPAHSMAFEFFTDDFDS |
| Ga0318504_101655702 | 3300032063 | Soil | SKSICKEIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDD |
| Ga0306924_104370301 | 3300032076 | Soil | CKEIAFQRSKTSKFDYLSAPNQPAHSMAFEFFTDD |
| Ga0306924_110208111 | 3300032076 | Soil | PQNRICKEIAFQRSKTSKFDYLSAPNQPAHSMAFEFFTDD |
| Ga0306924_111162521 | 3300032076 | Soil | ESSKSICKEIAVQRPKTGKFDYLSGPNHPAHSIAFKFFTDD |
| Ga0306924_114523991 | 3300032076 | Soil | ESSKSICKEIALQQPKAGKFDYLSAPGHSAHSMASEFFTDD |
| Ga0318540_100702351 | 3300032094 | Soil | NPQNRICKEIAFQRSKTSKFDYLSAPNQPAHSMAFEFFTDDS |
| Ga0268251_105918561 | 3300032159 | Agave | RESSNQICKEIAFQRSKTGKFDYLSAPNQPAHSMAFEFFTDDG |
| Ga0306920_1004170324 | 3300032261 | Soil | CKEIALQRPKTGKFDYLGRPNYPAHSIAFKFFTNDWKNEII |
| Ga0306920_1005014713 | 3300032261 | Soil | SKSICKEIALQRPKTGKFDYLSGPNYPAHSIAFKFFTDDA |
| Ga0306920_1009279381 | 3300032261 | Soil | ESSKSICKEIALQRPKTGKFDYLSGLNHPAHSIAFKFFTDD |
| Ga0306920_1011591371 | 3300032261 | Soil | ESSKSICKEIALQRPKTVKFDYLSGLNHPAHSMAFKFFTDDSIN |
| Ga0306920_1028903073 | 3300032261 | Soil | SKSICKEIALQRPKTGKFDYLSAPGHSAHSMASEFFTDD |
| Ga0306920_1032122543 | 3300032261 | Soil | CKEIAVQRPKTGKFDYLSGPNHPAHSIAFKFFTDDDF |
| Ga0310914_104389433 | 3300033289 | Soil | KVICKEIALQGPKTGKFDYLSGPNHPAHSIAFKFFTDDQRA |
| Ga0310914_105456341 | 3300033289 | Soil | SSKSICKEIAVQRPKTGKFDYLSGPNHPAHSIAFKFFTDD |
| ⦗Top⦘ |