| Basic Information | |
|---|---|
| Family ID | F044953 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 46 residues |
| Representative Sequence | KAIKLDHTPTVYIVSSRNPSRPYVEVKDNNQLYSTIDAMMKE |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.31 % |
| % of genes near scaffold ends (potentially truncated) | 96.08 % |
| % of genes from short scaffolds (< 2000 bps) | 92.81 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.693 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.379 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.144 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.784 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.57% β-sheet: 11.43% Coil/Unstructured: 70.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF16916 | ZT_dimer | 23.53 |
| PF00365 | PFK | 18.30 |
| PF02368 | Big_2 | 7.19 |
| PF13472 | Lipase_GDSL_2 | 5.23 |
| PF01545 | Cation_efflux | 3.27 |
| PF02604 | PhdYeFM_antitox | 1.96 |
| PF13505 | OMP_b-brl | 1.96 |
| PF04237 | YjbR | 1.96 |
| PF01850 | PIN | 1.96 |
| PF13462 | Thioredoxin_4 | 1.31 |
| PF00106 | adh_short | 0.65 |
| PF00535 | Glycos_transf_2 | 0.65 |
| PF02874 | ATP-synt_ab_N | 0.65 |
| PF00657 | Lipase_GDSL | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 18.30 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 3.27 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 3.27 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 3.27 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.96 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 1.96 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.69 % |
| Unclassified | root | N/A | 1.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_11771428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300001166|JGI12694J13545_1003290 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101212848 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300002917|JGI25616J43925_10061477 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10467464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300004082|Ga0062384_101360277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300004092|Ga0062389_101960290 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300004092|Ga0062389_102508904 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300004114|Ga0062593_100744118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter kilaueensis | 965 | Open in IMG/M |
| 3300004157|Ga0062590_102052074 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300004633|Ga0066395_10207894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1028 | Open in IMG/M |
| 3300005332|Ga0066388_108588040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 508 | Open in IMG/M |
| 3300005526|Ga0073909_10345614 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300005537|Ga0070730_10710251 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005538|Ga0070731_11088566 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005541|Ga0070733_10622962 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005541|Ga0070733_11111340 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005542|Ga0070732_10111913 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300005555|Ga0066692_10187177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1289 | Open in IMG/M |
| 3300005610|Ga0070763_10852412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300005764|Ga0066903_102801961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 946 | Open in IMG/M |
| 3300005921|Ga0070766_10021376 | All Organisms → cellular organisms → Bacteria | 3444 | Open in IMG/M |
| 3300006854|Ga0075425_100996230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 956 | Open in IMG/M |
| 3300006893|Ga0073928_10213109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1503 | Open in IMG/M |
| 3300006893|Ga0073928_10729923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300009088|Ga0099830_11029011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300009090|Ga0099827_10353132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1251 | Open in IMG/M |
| 3300009520|Ga0116214_1304363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 612 | Open in IMG/M |
| 3300009522|Ga0116218_1204554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 891 | Open in IMG/M |
| 3300009522|Ga0116218_1343944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 667 | Open in IMG/M |
| 3300009522|Ga0116218_1482552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 553 | Open in IMG/M |
| 3300009523|Ga0116221_1165066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 963 | Open in IMG/M |
| 3300009792|Ga0126374_10778900 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300009839|Ga0116223_10631814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 617 | Open in IMG/M |
| 3300010048|Ga0126373_10800212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300010360|Ga0126372_12508263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300010361|Ga0126378_10174688 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
| 3300010379|Ga0136449_100146253 | All Organisms → cellular organisms → Bacteria | 4654 | Open in IMG/M |
| 3300010398|Ga0126383_11756944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 709 | Open in IMG/M |
| 3300011070|Ga0138567_1121553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 507 | Open in IMG/M |
| 3300011270|Ga0137391_10031382 | All Organisms → cellular organisms → Bacteria | 4459 | Open in IMG/M |
| 3300012350|Ga0137372_10773979 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012354|Ga0137366_10904700 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300012469|Ga0150984_108930796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 515 | Open in IMG/M |
| 3300012517|Ga0157354_1089704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 512 | Open in IMG/M |
| 3300012683|Ga0137398_10055685 | All Organisms → cellular organisms → Bacteria | 2360 | Open in IMG/M |
| 3300012923|Ga0137359_11529546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300012924|Ga0137413_11738301 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012960|Ga0164301_10138856 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300014158|Ga0181521_10004912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 15083 | Open in IMG/M |
| 3300014159|Ga0181530_10003649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 16979 | Open in IMG/M |
| 3300014164|Ga0181532_10274897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300014164|Ga0181532_10756461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 522 | Open in IMG/M |
| 3300014169|Ga0181531_10354806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium | 900 | Open in IMG/M |
| 3300016270|Ga0182036_11871716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300017924|Ga0187820_1009725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2297 | Open in IMG/M |
| 3300017927|Ga0187824_10051235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1272 | Open in IMG/M |
| 3300017933|Ga0187801_10522420 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300017959|Ga0187779_10641413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 714 | Open in IMG/M |
| 3300017970|Ga0187783_11238562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300017972|Ga0187781_10256613 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300017972|Ga0187781_10362198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
| 3300017995|Ga0187816_10348991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300018043|Ga0187887_10796562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 559 | Open in IMG/M |
| 3300018044|Ga0187890_10618935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 610 | Open in IMG/M |
| 3300018058|Ga0187766_11363653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 519 | Open in IMG/M |
| 3300018085|Ga0187772_10510094 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300018086|Ga0187769_10816715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 705 | Open in IMG/M |
| 3300018088|Ga0187771_10242687 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300018090|Ga0187770_10668546 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300020579|Ga0210407_10705651 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300020580|Ga0210403_10936002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 681 | Open in IMG/M |
| 3300020581|Ga0210399_10142198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1981 | Open in IMG/M |
| 3300021088|Ga0210404_10230597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1002 | Open in IMG/M |
| 3300021170|Ga0210400_10174374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1741 | Open in IMG/M |
| 3300021171|Ga0210405_11283253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 538 | Open in IMG/M |
| 3300021401|Ga0210393_10779858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300021404|Ga0210389_10125712 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300021405|Ga0210387_10316906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1374 | Open in IMG/M |
| 3300021407|Ga0210383_10548180 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300021432|Ga0210384_10190768 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300021475|Ga0210392_11236541 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300021478|Ga0210402_10859537 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300021479|Ga0210410_10291761 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300021479|Ga0210410_10476577 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300021861|Ga0213853_10182485 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300022531|Ga0242660_1009158 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300022532|Ga0242655_10049902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300022532|Ga0242655_10203427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300023056|Ga0233357_1059330 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300023250|Ga0224544_1008578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1381 | Open in IMG/M |
| 3300025905|Ga0207685_10476987 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300025939|Ga0207665_11473583 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300025939|Ga0207665_11506001 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300027439|Ga0209332_1067673 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300027565|Ga0209219_1068243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300027604|Ga0208324_1112167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 757 | Open in IMG/M |
| 3300027604|Ga0208324_1142675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 655 | Open in IMG/M |
| 3300027684|Ga0209626_1202514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300027737|Ga0209038_10036546 | Not Available | 1464 | Open in IMG/M |
| 3300027768|Ga0209772_10200257 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300027824|Ga0209040_10531013 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300027825|Ga0209039_10332886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 593 | Open in IMG/M |
| 3300027855|Ga0209693_10542206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → Acidipila rosea | 553 | Open in IMG/M |
| 3300027857|Ga0209166_10490076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 632 | Open in IMG/M |
| 3300027867|Ga0209167_10487865 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300027905|Ga0209415_11011890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 551 | Open in IMG/M |
| 3300028566|Ga0302147_10334788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 501 | Open in IMG/M |
| 3300028747|Ga0302219_10023322 | All Organisms → cellular organisms → Bacteria | 2307 | Open in IMG/M |
| 3300028747|Ga0302219_10344412 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300028906|Ga0308309_11418332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 595 | Open in IMG/M |
| 3300029636|Ga0222749_10394193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 733 | Open in IMG/M |
| 3300029944|Ga0311352_10247403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1501 | Open in IMG/M |
| 3300030013|Ga0302178_10527183 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300030041|Ga0302274_10087093 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300030580|Ga0311355_10092170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3397 | Open in IMG/M |
| 3300030617|Ga0311356_11680388 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300031057|Ga0170834_104021011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 550 | Open in IMG/M |
| 3300031231|Ga0170824_100550390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 599 | Open in IMG/M |
| 3300031231|Ga0170824_105128920 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031236|Ga0302324_102700299 | Not Available | 600 | Open in IMG/M |
| 3300031469|Ga0170819_11194234 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031708|Ga0310686_108746874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 897 | Open in IMG/M |
| 3300031708|Ga0310686_119024502 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300031715|Ga0307476_10292127 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300031715|Ga0307476_10649247 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300031715|Ga0307476_11243755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300031718|Ga0307474_10147350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1775 | Open in IMG/M |
| 3300031720|Ga0307469_11851470 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300031754|Ga0307475_10285531 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300031823|Ga0307478_10227307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1509 | Open in IMG/M |
| 3300031837|Ga0302315_10498906 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300031890|Ga0306925_11766148 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031946|Ga0310910_10593924 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300031962|Ga0307479_11622133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300032001|Ga0306922_11564094 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300032035|Ga0310911_10699129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 587 | Open in IMG/M |
| 3300032160|Ga0311301_11260006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 940 | Open in IMG/M |
| 3300032160|Ga0311301_11747763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 745 | Open in IMG/M |
| 3300032174|Ga0307470_11547807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300032770|Ga0335085_10608829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1228 | Open in IMG/M |
| 3300032782|Ga0335082_11391176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300032783|Ga0335079_10423450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1432 | Open in IMG/M |
| 3300032805|Ga0335078_12598328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 519 | Open in IMG/M |
| 3300032805|Ga0335078_12667823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 510 | Open in IMG/M |
| 3300032829|Ga0335070_11477638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300032893|Ga0335069_11161865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300032893|Ga0335069_11521825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300032896|Ga0335075_11282961 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300032897|Ga0335071_11266835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 682 | Open in IMG/M |
| 3300032898|Ga0335072_11803770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 504 | Open in IMG/M |
| 3300033547|Ga0316212_1070211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 509 | Open in IMG/M |
| 3300034130|Ga0370494_039192 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.23% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.23% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.23% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.92% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.31% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.31% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.31% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.65% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.65% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.65% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.65% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.65% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011070 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_117714282 | 3300000789 | Soil | PTVYIVSSRNPSRPYVEVKDNNQLYSTIDAMMKE* |
| JGI12694J13545_10032904 | 3300001166 | Forest Soil | VNADRDLGKAIKLDHTPTVYVVSSRHPERPFVEMKDSSQLYALIDAMLKE* |
| JGIcombinedJ26739_1012128482 | 3300002245 | Forest Soil | RDLGKAIKLDHTPTVYIVSSRNPGRPYVEVKDNSQLYVTIDSMMKE* |
| JGI25616J43925_100614772 | 3300002917 | Grasslands Soil | GKLSALVNADRDLGKEIKLDHTPTVYIVSNRHPNKPFVEVKDNSQLYSAIDAMMKD* |
| JGIcombinedJ51221_104674642 | 3300003505 | Forest Soil | ALVNADRDLGKAIKIDHTPTVYIVSSRNPNHPYVEVKEPASQLYSTIDAVMKE* |
| Ga0062384_1013602772 | 3300004082 | Bog Forest Soil | DPQGKFAAEVNADRDTGKAIQLDHTPTVFVVSSRHPDRPYKEIDPRQIDSQLYALIDVMMKE* |
| Ga0062389_1019602902 | 3300004092 | Bog Forest Soil | QVNADRDLGTAIKLSHTPTVYIVSSRNPSKPYIEVKDNTQLYSTIDAMMRD* |
| Ga0062389_1025089041 | 3300004092 | Bog Forest Soil | NLNHTPTVYVVSSRHPEKPYVEVDPTQISNQLYSLIDAMMKE* |
| Ga0062593_1007441181 | 3300004114 | Soil | RDLGKAIKLDHTPTVYIVTSRNSSKPYVEVKDNNQLYSTIDAMMKE* |
| Ga0062590_1020520742 | 3300004157 | Soil | EVNADRDLGKAIKLDHTPTVYIVTSRNSSKPYVEVKDNNQLYSTIDAMMKE* |
| Ga0066395_102078941 | 3300004633 | Tropical Forest Soil | NADRDLGKAIKLDHTPTVYIVSSRNPNKPYIEVKDNNQLYSTIDAMMKD* |
| Ga0066388_1085880401 | 3300005332 | Tropical Forest Soil | RDLGKAIKLDHTPTVYIVSSRNPNRPYIEVKDNSQLYSTIDAMMKD* |
| Ga0073909_103456141 | 3300005526 | Surface Soil | KLAAQVNADRDLGKAIKLDHTPTVYIVSSRNPNKPYVEVKDNNQLYSTIDAMMKE* |
| Ga0070730_107102512 | 3300005537 | Surface Soil | LGKAIKLDHTPTVYIVSSRNPSKPYVEVKDNSQLYLTIDNMMKE* |
| Ga0070731_110885661 | 3300005538 | Surface Soil | NAIKLNHTPTVYVVSSRTPGKPYMEVKDNTQLYSTIDAMMKD* |
| Ga0070733_106229621 | 3300005541 | Surface Soil | GKAIKLDHTPTVYVVSSRNPGRPYVEVKDNNQLYSTIDAMMKE* |
| Ga0070733_111113401 | 3300005541 | Surface Soil | GRAIKLDHTPTVYIVSSRNPSKPYVEVKDNSQLYLTIDAVMKD* |
| Ga0070732_101119133 | 3300005542 | Surface Soil | SQVNADRDLGTAIKLSHTPTVYIVSSRNPSKPYIEVKDNTQLYSTIDAMMKD* |
| Ga0066692_101871771 | 3300005555 | Soil | QVNADRDLGKAIKLDHTPTVYIVSSRNPSKPYVEVKDNNQLYSTIDAMMKE* |
| Ga0070763_108524121 | 3300005610 | Soil | QVNADRDLGKAIKLDHTPTVYIVSSRNPNKPYVEVKDNNQLYSTIDAMMKE* |
| Ga0066903_1028019612 | 3300005764 | Tropical Forest Soil | IKLDHTPTVYIVSSRNPSHPYIEVKDNNQLYSMIDAMMKE* |
| Ga0070766_100213761 | 3300005921 | Soil | HTPTVYIVSSRNPSRPYAEVKEISQLYSTIDAVMKN* |
| Ga0075425_1009962302 | 3300006854 | Populus Rhizosphere | KLAAQVNADRDLGKAIKLDHTPTVYIVGSRNPNKPYVEVKDNNQLYSTIDAMMKE* |
| Ga0073928_102131091 | 3300006893 | Iron-Sulfur Acid Spring | NLDHTPTVYVVSSRHPDKPYVEVDPRQIESRLYALIDAMMKE* |
| Ga0073928_107299231 | 3300006893 | Iron-Sulfur Acid Spring | EVNADRDIGKAIKLEHTPTVYIVGNRHPDKPYVEMKDASQLYSLIDAMMKQ* |
| Ga0099830_110290111 | 3300009088 | Vadose Zone Soil | GKYAAEVNADRDLGKAIKLEHTPTVYIVSSRHPDRPYVEMKDASQLYALIDAMMKE* |
| Ga0099827_103531321 | 3300009090 | Vadose Zone Soil | PTVYIVSSRHPDRPYVEMKDASQLYALIDAMMKE* |
| Ga0116214_13043631 | 3300009520 | Peatlands Soil | LDYTPTVYIVSSRNPSRPYVEVRDNSQLYSTIDAVMKE* |
| Ga0116218_12045541 | 3300009522 | Peatlands Soil | ELGKAIKLDHTPTVYIVSSRNPSRPYVEVRDNSQLYSTIDAVMKE* |
| Ga0116218_13439442 | 3300009522 | Peatlands Soil | GRAIKLEHTPTVYVVSSRNPSRPYVEVKEPTSQLYSTIDAVMKE* |
| Ga0116218_14825521 | 3300009522 | Peatlands Soil | ADRDLGKAMKLDDTPTVYIVSSRNPSRPYVEVKDKSQLYSTIDAVMKE* |
| Ga0116221_11650662 | 3300009523 | Peatlands Soil | LVNADRDLGRAIKLEHTPTVYVVSSRNPSRPYVEVKEPTSQLYSTIDAVMKE* |
| Ga0126374_107789001 | 3300009792 | Tropical Forest Soil | KAIKLDHTPTVYIVSNRNPNKPYIEVKDNNQLYSTIDAMMKD* |
| Ga0116223_106318141 | 3300009839 | Peatlands Soil | NADRDLGKAIKLDHTPTVYIVSNRNPNRPYVEVKEPSSQLYATIDAVMKD* |
| Ga0126373_108002123 | 3300010048 | Tropical Forest Soil | ADRDLGKAINLDHTPTVYIVSSRNPSRPYVEVKDNSQLYSTIDAMMKE* |
| Ga0126372_125082631 | 3300010360 | Tropical Forest Soil | TPTVYIVSSRNPNKPYIEVKDNNQLYSTIDAMMKD* |
| Ga0126378_101746885 | 3300010361 | Tropical Forest Soil | LAAQVNADRDLGKAIKLDHTPTVYVVSSRNPSHPYIEVKDNNQLYSTIDAMMKE* |
| Ga0136449_1001462531 | 3300010379 | Peatlands Soil | DHTPTVYVVSSRHPDKPYVEVDPRQVDSRLYALIDSMMKE* |
| Ga0126383_117569441 | 3300010398 | Tropical Forest Soil | NADRDLGKAIKLDHTPTVYIVSNRNPNKPYIEVKDNNQLYSTIDAMMKD* |
| Ga0138567_11215532 | 3300011070 | Peatlands Soil | AIKLDHTPTVYIVSSRNPSRPYVEVRDNSQLYSTIDAVMKE* |
| Ga0137391_100313821 | 3300011270 | Vadose Zone Soil | QGKYAAEVNADRDLGKGIKLEHTPTVYIVSSRHPDRPYVEMKDASQLYALIDAMMKE* |
| Ga0137372_107739791 | 3300012350 | Vadose Zone Soil | HTPTVYIVSSRNPSKPYVEVKDSNQLYSTIDAVMKE* |
| Ga0137366_109047002 | 3300012354 | Vadose Zone Soil | LGKAIKLDHTPTVYIVSNRNPSKPYVEVKDSSQLYLTIDTMMKE* |
| Ga0150984_1089307961 | 3300012469 | Avena Fatua Rhizosphere | AEVNADRDLGKAIKLDHTPTVYIVSSRNPSKPYVEVKDNNQLYSTIDAMMKE* |
| Ga0157354_10897042 | 3300012517 | Unplanted Soil | LGKAIKLEHTPTVYIVSSKNPSRPYVEVKEPASQLYSTIDAMMKE* |
| Ga0137398_100556855 | 3300012683 | Vadose Zone Soil | RDQGKAIKLEHTPTVYIVSSRHPDRPYVEMKDASQLYSLIDAMMKE* |
| Ga0137359_115295461 | 3300012923 | Vadose Zone Soil | KAIKLEHTPTVYVVSSRHPDKPYVEMKEVSQLYALIDTMMKE* |
| Ga0137413_117383012 | 3300012924 | Vadose Zone Soil | AAEVNADRDMGKAIKLEHTPTVYIVSSRHPDKPYVEMKDASQLYALIDTMMKN* |
| Ga0164301_101388562 | 3300012960 | Soil | VAAQVNADRDLGKAIKLDHTPTVYIVSSRNPSRPYVEVKDNNQLYSTIDAMMKE* |
| Ga0181521_100049128 | 3300014158 | Bog | LGKAIKLDHTPTVYIVSNRNPNKPYVEVKEPSSQLYATIDAVMKD* |
| Ga0181530_1000364914 | 3300014159 | Bog | LGKAIKLDHTPTVYIVSNRNPNKPYVEVKEPSSQLYATIDAVMKD |
| Ga0181532_102748972 | 3300014164 | Bog | VKADRDLGKAIKLDHTPTVYIVSTRDPNRPYVEVKEPGSQLYATIDAVMKE* |
| Ga0181532_107564611 | 3300014164 | Bog | HTPTVYIVSSRNPKRPYVEVKEPASQLYSTIDAVIKE* |
| Ga0181531_103548061 | 3300014169 | Bog | GKLAAQVDADHELGKVIKLDHTPTVYIVSTRNPSRPYMEVKEPASQLYSTIDAMMKE* |
| Ga0182036_118717162 | 3300016270 | Soil | LGKAIKLDHTPTFYIVSSRNPSRPYVEVKDNNQLYSTIDAMMKE |
| Ga0187820_10097253 | 3300017924 | Freshwater Sediment | NHTPTVYVVSSRTPGKPYMEVKDNTQLYSTIDAMMKD |
| Ga0187824_100512351 | 3300017927 | Freshwater Sediment | RDLGNAIKLRHTPTVYIVSSRNPNKPYIEVPDNTQLYSTIDAMMKD |
| Ga0187801_105224201 | 3300017933 | Freshwater Sediment | GKFAAEVNADRDVGKAIKLDHTPTVYVVSSRHPDKPYVEMKEANQLYSLIDAMMKE |
| Ga0187779_106414131 | 3300017959 | Tropical Peatland | KLEHTPTVYIVSSRNPSKPYVEVKEPASQLYATIDAVMKD |
| Ga0187783_112385621 | 3300017970 | Tropical Peatland | KLDHTPTVYIVSSRNPNRPYVEVKDNNQLYSTIDAMMKE |
| Ga0187781_102566131 | 3300017972 | Tropical Peatland | DPQGKFASEVNADREVGKAIKLEHTPTVYVVSSRHPDKPYVEMKDASQLYALIDAMMKD |
| Ga0187781_103621983 | 3300017972 | Tropical Peatland | AAEVNADRNIGKEIKLDHTPTVFIVSSRNPQKPYVEMKESSQLYALIDAMMKE |
| Ga0187816_103489911 | 3300017995 | Freshwater Sediment | QAIHLDHTPTVYIVSNRNPSKPYIEVKDNSQLYATIDVMMKD |
| Ga0187887_107965621 | 3300018043 | Peatland | RDLGKAINLNHTPTVYVVSNRHPEKPFVEVDARQIDSQLYTLIDAMMK |
| Ga0187890_106189351 | 3300018044 | Peatland | DHTPTVYIVSSRNPNRPYVEVKDNNQLYSTIDAMMKE |
| Ga0187766_113636531 | 3300018058 | Tropical Peatland | LGKAIKLDHTPTVYIVSNRNPNKPYIEVKDNNQLYSTIDAMMKD |
| Ga0187772_105100941 | 3300018085 | Tropical Peatland | DADRDLGKAIKLDHTPTVYIVSNRNPNRPYIEVKDNSQLYSTIDAMLKD |
| Ga0187769_108167151 | 3300018086 | Tropical Peatland | DPQGKFAAEVNADRDVGKAIKLEHTPTVYVVSSRHPDKPYVEIEPRQIDNQLYALIDAMMKE |
| Ga0187771_102426873 | 3300018088 | Tropical Peatland | DHTPTVYVVSNRNPNRPYVEVKDNNQLYSTIDAVMKE |
| Ga0187770_106685461 | 3300018090 | Tropical Peatland | KAIKLAHTPTVYVVSSRNPSKPYVEVKEPTTELYATIDAMMKN |
| Ga0210407_107056511 | 3300020579 | Soil | DLGKAIKLDHTPTVYIVTSRNPNKPFVEVKDNSQLYSTIDAVMKE |
| Ga0210403_109360022 | 3300020580 | Soil | PSGKLAAQVNADRDLGKAIKLDHTPTVYIVSSRNPNKPYVEVKDNNQLYSTIDAMMKE |
| Ga0210399_101421983 | 3300020581 | Soil | AQVNADRDLGKAIKLDHTPTVYIVSSRNPNKPYVEVKDNNQLYSTIDAMMKE |
| Ga0210404_102305972 | 3300021088 | Soil | ADRDLGKAIKLDHTPTVYIVSSRNPNKPYVEVKDNNQLYSTIDAMMKE |
| Ga0210400_101743743 | 3300021170 | Soil | DLVKALKLDHTPTVYIVSSRNPNRPYVEVKDNSQLYSTIDAMMKE |
| Ga0210405_112832532 | 3300021171 | Soil | KAIKLDHTPTVYIVSSRNPSRPYVEVKDNNQLYSTIDAMMKE |
| Ga0210393_107798581 | 3300021401 | Soil | EHTPTVYVVSTRHPEKPYVEMKDASQLYALIDAMMKE |
| Ga0210389_101257121 | 3300021404 | Soil | KTLTVYSRSSRNPNKPYVEVKDNSQLYLTIDNMMKE |
| Ga0210387_103169061 | 3300021405 | Soil | HTPTVYIVSNRHPDRPYIEVKDNNQLYALIDTMMKE |
| Ga0210383_105481803 | 3300021407 | Soil | AIKLEHTPTVYVVSNRNPTRPYVEMKDSNQLYSLIDAMSKD |
| Ga0210384_101907684 | 3300021432 | Soil | KGKEIKLEHTPTVYVVSTRHPDKPYVEMKDASQLYALIDAMMKE |
| Ga0210392_112365412 | 3300021475 | Soil | DPGGKLAGLVNADRDLGKAIKLDHTPTVYIVSNRNPSRPYVEVRDNKDLYTTIDAMMKN |
| Ga0210402_108595371 | 3300021478 | Soil | PFLMDPDGKLTALINADRDLGKAIKLEHTPTVYIVSNRHPDRPYIEVKDNNQLYALIDTMMKD |
| Ga0210410_102917612 | 3300021479 | Soil | PGRKLAAQVNADRDLGKAMKLDHTPTVYIVSSRNPSRPYVEVKDNNQLYSTIDAVMKE |
| Ga0210410_104765773 | 3300021479 | Soil | IKLDHTPTVYIVSSRHPDKPYVEMKDASQLYALIDAMMKE |
| Ga0213853_101824851 | 3300021861 | Watersheds | DLGTAIKLSHTPTVYIVSSRNPSKPYIEVKDNTQLYSTIDAMMKD |
| Ga0242660_10091581 | 3300022531 | Soil | LDPGGKLAAQVNADRDLGKAMKLDHTPTVYIVSSRNPSRPYVEVRDNNQLYSTIDAVMKE |
| Ga0242655_100499021 | 3300022532 | Soil | DRDLGKAMKLDHTPTVYIVSSRNPSRPYVEVRDNNQLYSTIDAVMKE |
| Ga0242655_102034273 | 3300022532 | Soil | LGKAMKLDHTPTVYIVSSRNPSRPYVEVKDNNQLYSTIDAVMKE |
| Ga0233357_10593301 | 3300023056 | Soil | GKAIKLDHTPTVYIVSSRHPDRPYVEMKDASQLYSLIDAMMKE |
| Ga0224544_10085782 | 3300023250 | Soil | IKLDHTPTVYIVSTRHPDKPYVEMKDSSQLYALIDAMMKE |
| Ga0207685_104769872 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPAALTPTVYIVSNRHPNRPYVEVKDNNQLYSTIDAVMKE |
| Ga0207665_114735831 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KAIKLDHTPTVYIVSSRNPNKPYVEVKDSNQLYSTIDAMLKE |
| Ga0207665_115060011 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VNADRDLGKAIKLDHTPTVYIVSNRHPNRPYVEVKDNNQLYSTIDAVMKE |
| Ga0209332_10676731 | 3300027439 | Forest Soil | HTPTVYIVSSRHPERPYVEMKDASQLYALIDAMMKE |
| Ga0209219_10682431 | 3300027565 | Forest Soil | AALVNADRDLGKAIKLDHTPTVYIVSSRNPNKPYVEVKDNNQLYLTIDTMMKE |
| Ga0208324_11121672 | 3300027604 | Peatlands Soil | ELGKAIKLDHTPTVYIVSSRNPSRPYVEVRDNSQLYSTIDAVMKE |
| Ga0208324_11426751 | 3300027604 | Peatlands Soil | AALVNADKSLGQAIKIDHTPTVYVVSSRNPNRPYIEVKDNNMLYVTIDAVMKE |
| Ga0209626_12025141 | 3300027684 | Forest Soil | LEHTPTVYVVSSRHPDRPYVEMKDPSQLYALIDAMMKE |
| Ga0209038_100365461 | 3300027737 | Bog Forest Soil | RDVGKAIKLEHTPTVYVVSTRHPERPYVEMKDASQLYALIDAMMKE |
| Ga0209772_102002572 | 3300027768 | Bog Forest Soil | DVGKAIKLEHTPTVYVVSTRHPERPYVEMKDASQLYALIDAMMKE |
| Ga0209040_105310132 | 3300027824 | Bog Forest Soil | KLAELVDADRDLGKAIKIDHTPTVYIVSSRNPNRPYVEVKEPATQLYSTIDAVLKE |
| Ga0209039_103328862 | 3300027825 | Bog Forest Soil | DHTPTVYIVSNRNPNKPYVEVKEPSSQLYATIDAVMKD |
| Ga0209693_105422061 | 3300027855 | Soil | KLAAQVNADRDLGKAIKLDHTPTVYIVSSRNPNKPYVEVKDNNQLYSTIDAMMKE |
| Ga0209166_104900762 | 3300027857 | Surface Soil | TPTVYIVSSRNPSKPYVEVKDNSQLYLTIDNMMKE |
| Ga0209167_104878652 | 3300027867 | Surface Soil | ADRDLGKAMKLEHTPTVYIVSSRNPNKPYVEVKDNSQLYSTIDAVMKD |
| Ga0209415_110118901 | 3300027905 | Peatlands Soil | GAIKLEHTPTVYIVSSRNPSRPYVEVKEPNSQLYSTIDAVMKD |
| Ga0302147_103347881 | 3300028566 | Bog | TPTVYIVSSRHPDKPYVEMKDSNQLYSLIDAMMKD |
| Ga0302219_100233221 | 3300028747 | Palsa | RDVGHAIKLDHTPTVYVVSSRHPERPYVEMKDSSGLYTLIDAMLKD |
| Ga0302219_103444121 | 3300028747 | Palsa | LNHTPTVYVVSSRHPDKPYVEVDPRQIDSQLYALIDAMMKE |
| Ga0308309_114183321 | 3300028906 | Soil | DHTPTVYIVSSRNPNKPYVEVKDNSQLYLTIDNMMKE |
| Ga0222749_103941931 | 3300029636 | Soil | DPAGKLAAQVNADRDLGKAIKLDHTPTVYIVSSRNPSRPYIEVKDNNQLYSTIDAMMKE |
| Ga0311352_102474031 | 3300029944 | Palsa | HTPTVYVVSSRHPDKPYVEVDPVQINNQLYALIDAMMKQ |
| Ga0302178_105271832 | 3300030013 | Palsa | DLGKAIKLDHTPTVYIVSSRNPSRPYVEVKENSQLYSTIDAVMKE |
| Ga0302274_100870931 | 3300030041 | Bog | LEHTPTVYIVSSRHPDKPYVEMKDSNQLYSLIDAMMKD |
| Ga0311355_100921703 | 3300030580 | Palsa | VGHAIKLDHTPTVYVVSSRHPERPYVEMKDSSGLYTLIDAMLKD |
| Ga0311356_116803882 | 3300030617 | Palsa | NAINLNHTPTVYVVSSRHPDKPYVEVDPRQIDSQLYALIDAMMKE |
| Ga0170834_1040210111 | 3300031057 | Forest Soil | LDPGGKLAAQVNADRDLGKAIKLDHTPTVYIVSSRNPSRPYVEVKDNSQLYSTIDAVMKE |
| Ga0170824_1005503902 | 3300031231 | Forest Soil | VLDPGGKLAAQVNADRDLGKAIKLDHTPTVYIVSSRNPSRPYVEVKDNSQLYSTIDAVMK |
| Ga0170824_1051289201 | 3300031231 | Forest Soil | VLDPGGKFAAQVNADRDLGKAIKLDHTPTVYIVSSRNPSKPYVEVKDNSQLYLTIDAVMK |
| Ga0302324_1027002991 | 3300031236 | Palsa | AINLNHTPTVYVVSNRHPEKPFVEVDARQIDSQLYTLIDAMMK |
| Ga0170819_111942342 | 3300031469 | Forest Soil | VLDPGGKFAAQVNADRDLGKAIKLDHTTTVYIVSSRNPSKPYVEVKDNSQLYLTIDAVMK |
| Ga0310686_1087468742 | 3300031708 | Soil | LDHTPTVYIVSSRNPNKPYVEVKDNSQLYLTIDNMMKE |
| Ga0310686_1190245022 | 3300031708 | Soil | HTPTVYVVSSRHPDKPYVEVDPTQINNRLYALIDAMMKE |
| Ga0307476_102921271 | 3300031715 | Hardwood Forest Soil | GKAIKLEHTPTVYIVSSRHPERPYVEMKDASQLYSLIDAMMKE |
| Ga0307476_106492471 | 3300031715 | Hardwood Forest Soil | ADRDLGKAIKLDHTPTVYVVSSRNPGRPYVEVKDNNQLYSTIDAMMKE |
| Ga0307476_112437551 | 3300031715 | Hardwood Forest Soil | NADRDVGRAIKLDHTPTVYIVSSRHPEKPYVEVDARQIDSQLYAMIDAMMKD |
| Ga0307474_101473504 | 3300031718 | Hardwood Forest Soil | PQGKFAGEVNADRDVGRAIKLDHTPTVYIVSSRHPEKPYVEVDARQIDSQLYAMIDAMMK |
| Ga0307469_118514703 | 3300031720 | Hardwood Forest Soil | IKLEHTPTVYIVSSRHPDRPYVEMKDASQLYSLIDAMMKE |
| Ga0307475_102855311 | 3300031754 | Hardwood Forest Soil | LGKAIKLDHTPTVYVVSSRHPDRPYVEMKDSSQLYALIDSMTKE |
| Ga0307478_102273073 | 3300031823 | Hardwood Forest Soil | LGKAIKIDHTPTVYIVSSRNPNHPYVEVKEPASQLYSTIDAVMKE |
| Ga0302315_104989062 | 3300031837 | Palsa | AEVNADRDLGKAIKLDHTPTVYIVSDRHPGRPFVEMKDSSQLYVLIDAMMKE |
| Ga0306925_117661482 | 3300031890 | Soil | NADRDLGKAIKLDHTPTVYIVSSRNPSKPYIEVKDNNQLYSTIDAMMKD |
| Ga0310910_105939242 | 3300031946 | Soil | AIKLDHTPTVYIVSSRNPNKPYIEVKDNNQLYSTIDAMMKD |
| Ga0307479_116221332 | 3300031962 | Hardwood Forest Soil | VNADRDLGKAIKLDHTPPVYIVSSRNPSKPYVEVKDNSQLYLTIDTMMKD |
| Ga0306922_115640942 | 3300032001 | Soil | KAIKLDHTPTVYIVSSRKPYIEVKDNNQLYSTIDAMMKD |
| Ga0310911_106991291 | 3300032035 | Soil | ADRDLGKAIKLDHTPTVYIVSSRNPNKPYIEVKDNNQLYSTIDAMMKD |
| Ga0311301_112600063 | 3300032160 | Peatlands Soil | AAQVNADRDLGKAIKLDHTPTVYIVSSRNPSRPYVEVKDNSQLYSTIDAVMKE |
| Ga0311301_117477632 | 3300032160 | Peatlands Soil | VIDPNGKLAAQVNADRDLGKAIKLDHTPTVYIVSNRNPNRPYVEVKEPSSQLYATIDAVMKD |
| Ga0307470_115478072 | 3300032174 | Hardwood Forest Soil | AAEVNADRDQGRAIKLEHTPTVYIVSSRHPDRPYVEMKDASQLYSLIDAMMKE |
| Ga0335085_106088291 | 3300032770 | Soil | ADRDLGKAIKLDHTPTVYIVSSRNPSRPYVEVKDNSQLYSTIDAVMKD |
| Ga0335082_113911761 | 3300032782 | Soil | KLDHTPTVYIVSSRNPSRPYVEVKDNNQLYSTIDAMMKE |
| Ga0335079_104234501 | 3300032783 | Soil | AEVNAERDLGTALKLGHTPTVYIVSNRTPGKPYIEVKDNSQLNSTIDAMMKD |
| Ga0335078_125983281 | 3300032805 | Soil | LGTAIKLSHTPTVYIVSSRNPSKPFIEVKDNTQLYSTIDAMMKD |
| Ga0335078_126678232 | 3300032805 | Soil | DHTPTVYIVSSRNPNKPYVEVRDNSQLYSTIDAMMKE |
| Ga0335070_114776381 | 3300032829 | Soil | LDHTPTVYIVSNRNPSKPYIEVKDNNQLYSTIDTMMKE |
| Ga0335069_111618652 | 3300032893 | Soil | IKLDHTPTVYIVSNRNPSKPYIEVKDNNQLYSTIDTMMKE |
| Ga0335069_115218251 | 3300032893 | Soil | VIDPGGKLSAMVNADRDLGKAIKLDHTPTVYIVSNRNPSKPYIEVKDNNQLYSTIDTMMK |
| Ga0335075_112829611 | 3300032896 | Soil | KLDHTPTVYVVSSRNPNRPYVEMKDSSQLYQLIDAMMNQ |
| Ga0335071_112668351 | 3300032897 | Soil | AIKLDHTPTVYIVSSRNPSRPYVEVKDNNQLYSTIDAMMKE |
| Ga0335072_118037701 | 3300032898 | Soil | HTPTVYIVSDRNPSRPYVEVKDNNQLYSTIDAMMKE |
| Ga0316212_10702112 | 3300033547 | Roots | KAIKIDHTPTVYIVSSRNPNRPYVEVKEPASQLYSTIDAVMKE |
| Ga0370494_039192_2_151 | 3300034130 | Untreated Peat Soil | NADRDLGKAIKLDHTPTVYIVSSRNPSHPYVEVRDNSQLYSTIDTMMKE |
| ⦗Top⦘ |