| Basic Information | |
|---|---|
| Family ID | F044941 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFIGSR |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.99 % |
| % of genes near scaffold ends (potentially truncated) | 94.77 % |
| % of genes from short scaffolds (< 2000 bps) | 98.69 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (57.516 % of family members) |
| Environment Ontology (ENVO) | Unclassified (79.085 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (76.471 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.04% β-sheet: 0.00% Coil/Unstructured: 92.96% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 57.52% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 19.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.31% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.65% |
| Fungi-Associated Bovine Rumen | Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen | 0.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017446 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017691 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028147 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028471 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300030772 | Coassembly of Cow X Switchgrass | Host-Associated | Open in IMG/M |
| 3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24035J26624_10412681 | 3300002126 | Corn, Switchgrass And Miscanthus Rhizosphere | VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCIL |
| Ga0070666_108991761 | 3300005335 | Switchgrass Rhizosphere | LATNVVFPRISSIFDPQAIFSVELLPGEGQAHHKMDCALTPAFIGSR* |
| Ga0070666_109803731 | 3300005335 | Switchgrass Rhizosphere | VVFPGISSIFDPQAIFSVELFPGGGQAHHKMDCILTPAFIGSRCGIRGDR* |
| Ga0070666_112861201 | 3300005335 | Switchgrass Rhizosphere | LKNKQLATNVVFPRISSIFDPQAIFSVEFLPDGGQADHKMDCILNRHLFVVDVE* |
| Ga0070669_1006583311 | 3300005353 | Switchgrass Rhizosphere | VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFIGVDEE* |
| Ga0070671_1007498762 | 3300005355 | Switchgrass Rhizosphere | MVFPWISSIFDPLAIFSVELLPGGGQAHHKMDCTLTPEFIGSR* |
| Ga0070671_1016446862 | 3300005355 | Switchgrass Rhizosphere | VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFIGVDAE* |
| Ga0070671_1019873781 | 3300005355 | Switchgrass Rhizosphere | VVFPRISSIIDPQAIFSVELLPGGGQAHHKMDCILTPAFIGSRCRIR |
| Ga0070686_1016288431 | 3300005544 | Switchgrass Rhizosphere | TNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDYALTPAFIHSK* |
| Ga0068864_1017837801 | 3300005618 | Switchgrass Rhizosphere | MVFPRISSIFDPQTIFSVELLPGGGQAHHKMDCILTP |
| Ga0068863_1007075762 | 3300005841 | Switchgrass Rhizosphere | VVFPRISLIFDPQVIFSVELLPGGGQAHHKMDCALTPAFMGS* |
| Ga0068863_1015008611 | 3300005841 | Switchgrass Rhizosphere | VVFPRISSIFDPQAIFKVKLIPGGGQAHHKMDCILTPAFIGSRCIISGA |
| Ga0068860_1004395841 | 3300005843 | Switchgrass Rhizosphere | MNVVFPRISSIFDPQAIFSVELLPGGDQAHHKIDCALTPAFMDS* |
| Ga0068860_1004632333 | 3300005843 | Switchgrass Rhizosphere | MNVVFPRISSIFDPQSIFSVELLPGGGQAHHKMDYALTPAFIGSR*RIGGARQ |
| Ga0068860_1011260962 | 3300005843 | Switchgrass Rhizosphere | MNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCT |
| Ga0068860_1018092992 | 3300005843 | Switchgrass Rhizosphere | VVFLRISSIFDPQAIFSVELLLGGGQAHHKMDCILTPAF |
| Ga0068860_1026663182 | 3300005843 | Switchgrass Rhizosphere | MVFTRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFIGS |
| Ga0097620_1021598282 | 3300006931 | Switchgrass Rhizosphere | NVVFPRISSIFDPQAIFNVELLPGGGQAHHKKDCTLTPAFIGSR* |
| Ga0105126_10099971 | 3300009994 | Switchgrass Associated | TNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPAFIGSR* |
| Ga0134125_128641091 | 3300010371 | Terrestrial Soil | MNMVFPWISPIFDPQAIFNVELLPGGGQAHHKMDCTLTPA |
| Ga0134128_131936941 | 3300010373 | Terrestrial Soil | MVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFI |
| Ga0134124_121883671 | 3300010397 | Terrestrial Soil | ATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCALTPAFIGSR* |
| Ga0134127_115140511 | 3300010399 | Terrestrial Soil | VVFPWISSIFDPKAIFSVELLPGGGQAHHKMDCILTPAFIGSR |
| Ga0134127_133768781 | 3300010399 | Terrestrial Soil | MVFPRISSIFDPQSIFSVELLPGGGQAHHKMDSILTPAFIGSR |
| Ga0134122_108756401 | 3300010400 | Terrestrial Soil | VVFPQISSIFDPQAIFSVELLPDGGQAHHKMDCILTPAFIGS |
| Ga0134121_124142691 | 3300010401 | Terrestrial Soil | RISSIFNPQAISSVELLLGGGQAHHKMVYALTLAFMGS* |
| Ga0134123_121106381 | 3300010403 | Terrestrial Soil | VVFPQISSIFDPQAIFSVELLPGGGQAHHKMDLILTPTFIGSRCGIRGAH |
| Ga0157379_121888821 | 3300014968 | Switchgrass Rhizosphere | VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILALAFIGGRCRIRGA |
| Ga0157379_125290211 | 3300014968 | Switchgrass Rhizosphere | KYKQLATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCALTPTFIGSR* |
| Ga0182183_10706071 | 3300015270 | Switchgrass Phyllosphere | MNVIFPRMSPIFVPQAIFNIELLPGGGQAHHKMDCTLTHAFIG |
| Ga0182183_10900441 | 3300015270 | Switchgrass Phyllosphere | KYKQLATNVVFPRISSIFDPQAIFSIERLPGGGQAHHKMDCALTLAFMDS* |
| Ga0182100_10890641 | 3300015280 | Switchgrass Phyllosphere | PRISSIFDPQAIFSDELLPGGGHAHHNMDCTLTPAFIGSR* |
| Ga0182100_10993351 | 3300015280 | Switchgrass Phyllosphere | VFPWISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPSFIGSR* |
| Ga0182101_10483841 | 3300015284 | Switchgrass Phyllosphere | MIFPQISSIFDPQAFFSVELLPDGGQAHHKMDCILTPAFIGSRC |
| Ga0182101_10501441 | 3300015284 | Switchgrass Phyllosphere | MNMVFPWISPIFDPQAIFNVELLPGGGQAHHKMDCTL |
| Ga0182101_10986301 | 3300015284 | Switchgrass Phyllosphere | KYKQLATNVVFPRISSIFDPQAIFSVELLPGGGQAHRKMDCALTPAFMGS* |
| Ga0182103_10987191 | 3300015293 | Switchgrass Phyllosphere | KQLATNVVFPRISSIFDPQAIFSIELLPGGGQAHHKMDCTLTHAFIGSK* |
| Ga0182103_11022921 | 3300015293 | Switchgrass Phyllosphere | VVFPRISEIFNTQAIFSVELLPGGGQAHHMTDCILTPAFIGSRFRIRGAR |
| Ga0182180_10572142 | 3300015306 | Switchgrass Phyllosphere | MVFPRISSIFDPQAIYSVELLPGGGQAHHKMDCILTSAFIGSRC |
| Ga0182180_10851301 | 3300015306 | Switchgrass Phyllosphere | IFDPQAIFGVELLPGEGQAHHKMDCALTLAFIGSR* |
| Ga0182162_10332861 | 3300015310 | Switchgrass Phyllosphere | MVFPRLSSIFDAQAIFSVELLPGGGQAHHKMDCTLTPAFIGS |
| Ga0182182_10335511 | 3300015311 | Switchgrass Phyllosphere | VFPRISSIFDPQAIFSVELLPGGGQAHHKMDCALTPAFMGS* |
| Ga0182182_10358001 | 3300015311 | Switchgrass Phyllosphere | VVFPRISSIFDPQAIFSVELLAGGGQAHHKMDCSLTPAFIG |
| Ga0182164_11333731 | 3300015313 | Switchgrass Phyllosphere | NVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPACIGST* |
| Ga0182120_11358751 | 3300015315 | Switchgrass Phyllosphere | KYKQLAMNVVFPRISSIFDPQAIFSVELLPGGGHAHHKMDCTLTPTFICSR* |
| Ga0182130_10640541 | 3300015319 | Switchgrass Phyllosphere | MVFPRISLIFDPQAIFSVELLPGGGQAHHKMDCTL |
| Ga0182130_11338591 | 3300015319 | Switchgrass Phyllosphere | KQLATNVVFPRISSIFDPQAIFSVELLPGGGQAQHKMDCPFTPAFIGSR* |
| Ga0182165_10614851 | 3300015320 | Switchgrass Phyllosphere | RISSIFDPQAIFSVELLPGGGQAHHKMDCALTPAFMGS* |
| Ga0182165_11162111 | 3300015320 | Switchgrass Phyllosphere | VVFPQISSIFDPQAIFSVELLPDGGQAHHKMDCILTP |
| Ga0182165_11218531 | 3300015320 | Switchgrass Phyllosphere | MVFPWISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPAF |
| Ga0182134_11475811 | 3300015324 | Switchgrass Phyllosphere | IFDPQAIFSVELLPGEGQAHQKIDCILTPTFIGSR* |
| Ga0182148_10890091 | 3300015325 | Switchgrass Phyllosphere | SSIFDPQAIFSVEPLPGGGQANHKMDYTLTPAFIGSI* |
| Ga0182148_11058641 | 3300015325 | Switchgrass Phyllosphere | MNVVFPRISSIFVPQAIFSVELLPGGGQAHHKMDC |
| Ga0182135_10854631 | 3300015329 | Switchgrass Phyllosphere | NVVFPRISSIFDPQAIFSVELLPGGGQAHHKKDCTLTPVFIGSR* |
| Ga0182135_11484071 | 3300015329 | Switchgrass Phyllosphere | PRISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPAFIGSR* |
| Ga0182135_11489591 | 3300015329 | Switchgrass Phyllosphere | ATNVVFPWISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPSFIGSR* |
| Ga0182152_10734541 | 3300015330 | Switchgrass Phyllosphere | VVFPRISSIFDPQTIFSVELLPGGGQAHHKMDCILTPTFIG |
| Ga0182152_11003181 | 3300015330 | Switchgrass Phyllosphere | TNVVFPQISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPAFIGSR* |
| Ga0182152_11520911 | 3300015330 | Switchgrass Phyllosphere | MVFQRISSIFDPQAIFSVELLAGGDQAHHKMDCILTLAFI |
| Ga0182131_10951802 | 3300015331 | Switchgrass Phyllosphere | MVFPRISSIFNPKAIFSVELLPGGGQAHHKMDCILTPAFIG |
| Ga0182131_11049681 | 3300015331 | Switchgrass Phyllosphere | TNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDGTLTPAFIGSS* |
| Ga0182131_11053891 | 3300015331 | Switchgrass Phyllosphere | KQLATNMVFPRISSIFDPQAIFSVELLPGGGQAHHKKDCTLTPAFIGSI* |
| Ga0182131_11523391 | 3300015331 | Switchgrass Phyllosphere | VVFPRISSIFDPQAIFSIELLPGGGQAHHKMDCILTPAFIGSRCGI* |
| Ga0182131_11575191 | 3300015331 | Switchgrass Phyllosphere | ATNVVFPRISSIFDPQAIFSVELLPGGGQALHKMG* |
| Ga0182117_10533751 | 3300015332 | Switchgrass Phyllosphere | SSIFDPQAIFSVELLPGGGQAHHKIDCALTPAFICSR* |
| Ga0182117_10877531 | 3300015332 | Switchgrass Phyllosphere | KQLATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPAFIGSR* |
| Ga0182117_11588091 | 3300015332 | Switchgrass Phyllosphere | PRISSIFDPQAIFSVELLPGEGQAHHKMDCALTPAFIGSR* |
| Ga0182117_11591202 | 3300015332 | Switchgrass Phyllosphere | VVFPRISSIFDPEAIFSVELLPGGGQADHKMDCILTPAFIVVDVE |
| Ga0182147_11072441 | 3300015333 | Switchgrass Phyllosphere | TILAFPRISSIFDPQAIFGVDLLPGGGQAHHKMDCALTPAFMAS* |
| Ga0182132_11511461 | 3300015334 | Switchgrass Phyllosphere | NLVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCALTPALMGS* |
| Ga0182150_11569591 | 3300015336 | Switchgrass Phyllosphere | MVFLRISSIFDPEAIFSVIFLPGGGQAHHKMDCILTPAFIGSRC |
| Ga0182150_11580901 | 3300015336 | Switchgrass Phyllosphere | KQLATNVVFPRISSIFDPQAIFSVELLSGGGQAHHKMDCALTPAFIGSR* |
| Ga0182150_11580902 | 3300015336 | Switchgrass Phyllosphere | VVFPRISLIFDPQAISIVELLPDGGQAHHKMDCILTPAFIGSR |
| Ga0182137_11647191 | 3300015338 | Switchgrass Phyllosphere | ISSIFDPQAIFSVELLPGGDQAHHKMDCALTPAFMDSC* |
| Ga0182149_11065341 | 3300015339 | Switchgrass Phyllosphere | LATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKRDCTLTPAFIGSR* |
| Ga0182115_12853211 | 3300015348 | Switchgrass Phyllosphere | MVFLRISSIFDPEAIFSVIFLPGGGQAHHKMDCILTPA |
| Ga0182115_12885381 | 3300015348 | Switchgrass Phyllosphere | TNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDYTLTPAFIGSR* |
| Ga0182185_11856801 | 3300015349 | Switchgrass Phyllosphere | NMVFPRISLKFDPQAIFSVELLPGGGQAHDKMDCTLTPAFIGSR* |
| Ga0182185_12175301 | 3300015349 | Switchgrass Phyllosphere | TNVVFPRISSIFDPQAIFSVELLPGRGQAHHKMDSTLTPAFIGSR* |
| Ga0182163_11378451 | 3300015350 | Switchgrass Phyllosphere | KYKHLATNVVFPRISSIFDLQAIFSVELLPCGGQAHHKMDCALTPAFIGSR* |
| Ga0182163_12131161 | 3300015350 | Switchgrass Phyllosphere | SSIFDPQAIFSVELLPDGGQAHHKMDCALSPAFMGS* |
| Ga0182163_12387071 | 3300015350 | Switchgrass Phyllosphere | KYKQLAMNLVFPRISSIFDPQAIFSVELLPGGGQAHHNMVCALTPAFMGS* |
| Ga0182169_11577231 | 3300015352 | Switchgrass Phyllosphere | MVFLRISSIFDPEAIFSVIFLPGGGQAHHKMDCILTPAFI |
| Ga0182169_12149971 | 3300015352 | Switchgrass Phyllosphere | TNVVFPRISSIFDPQAIFSVELLPGGGQAHHKKDCTSTPAFIGSR* |
| Ga0182169_12321201 | 3300015352 | Switchgrass Phyllosphere | MNVVFPRISSIFDPQAIFSVELLPGGDQAHHKIDCALTPAFMDS**RIRGA |
| Ga0182179_11580641 | 3300015353 | Switchgrass Phyllosphere | MNVVFPRISSIFDPQAIFIVELLPGGGQAHHKMDCTL |
| Ga0182179_11786151 | 3300015353 | Switchgrass Phyllosphere | LAMNVVFPRISSIFVPQAIFSVELLPGGGQAHHKMDCALTPAFIGSR* |
| Ga0182179_12278611 | 3300015353 | Switchgrass Phyllosphere | NVVFPRISSIFDPQAIFSIELLPDGGQAHHKMDCTLTPAFIGSR* |
| Ga0182179_12693381 | 3300015353 | Switchgrass Phyllosphere | MNVVLPRISSIFDPQSIFSVELLPGGGQAHHKMDYALTPA |
| Ga0182179_12713181 | 3300015353 | Switchgrass Phyllosphere | RISSIFDPQAIFSVELLPGGGQAHHKMDCALTPALMGS* |
| Ga0182167_13451151 | 3300015354 | Switchgrass Phyllosphere | NVVFPRISSIFDPQSIFSVELLPGGGQAHHKMDYALTPAFIGSR* |
| Ga0182195_10394411 | 3300017414 | Switchgrass Phyllosphere | FPRISSIFDPQAIFSVELLPGGGQAHHKMDCALTPALMGS |
| Ga0182195_10558141 | 3300017414 | Switchgrass Phyllosphere | MVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCTL |
| Ga0182195_12177611 | 3300017414 | Switchgrass Phyllosphere | YKQLATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPAFIGSR |
| Ga0182213_12214311 | 3300017421 | Switchgrass Phyllosphere | FPRISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPAFIGSR |
| Ga0182201_11325051 | 3300017422 | Switchgrass Phyllosphere | VVFPRISPIFEPQAIFNVELLPGGGQAHHEMDCTLTPQIISSR |
| Ga0182196_10105492 | 3300017432 | Switchgrass Phyllosphere | ATNVVFPRISSIFDPQAIFSVELLPGGGQAHLKMDCTLTPSFIGSR |
| Ga0182194_11229351 | 3300017435 | Switchgrass Phyllosphere | MVFPRISSIFDPQAIFCVELLPNGGQADHKIDCVLTPAFIGSSWS |
| Ga0182200_10383201 | 3300017439 | Switchgrass Phyllosphere | YKQLATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMVCALTPAFMGS |
| Ga0182200_11493331 | 3300017439 | Switchgrass Phyllosphere | MVFPRISSIFDLQAIFSVELLPGGGQAHHKMDCILTPAFI |
| Ga0182198_11223141 | 3300017445 | Switchgrass Phyllosphere | MVFPRISLIFDRQAIFSVELLPGGGQAHHKMDCALTPAFMGS |
| Ga0182217_11282881 | 3300017446 | Switchgrass Phyllosphere | MVFPRISTIFDPQAIFSVELFPGGDQAHHKMDCILTLAFIGSKCRI |
| Ga0182212_10679721 | 3300017691 | Switchgrass Phyllosphere | VVFPRISSIFDPQAIFSVELLPGGGQAHLKMDCTLTPSFIGSR |
| Ga0182216_11223681 | 3300017693 | Switchgrass Phyllosphere | MVFPWISSIFDPQAIFSVELLPGGGQAHHKVDCISTPAFIG |
| Ga0182216_11846891 | 3300017693 | Switchgrass Phyllosphere | KYKQLATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCTLTPACIGST |
| Ga0182216_12008561 | 3300017693 | Switchgrass Phyllosphere | NVVFPPISSIFDPQAIFSVELLPGGDQAHHKMDCALTPAFMDS |
| Ga0182211_11236131 | 3300017694 | Switchgrass Phyllosphere | MNMVFPWISPIFDPQAIFNVELLPDEGQAHHKMDC |
| Ga0182211_11539741 | 3300017694 | Switchgrass Phyllosphere | MVFPRISSTFDPQAIFSVELLPGGGQAHHKMDCTLT |
| Ga0182211_11568671 | 3300017694 | Switchgrass Phyllosphere | FPRISSIFDPQAIFSVELLAGGGQAHHKMDCSLTPAFIGSR |
| Ga0182211_11747431 | 3300017694 | Switchgrass Phyllosphere | MVFPRISSIFNLQAIFSVELLPGGGQAQQKMDCIL |
| Ga0182178_10132081 | 3300020023 | Switchgrass Phyllosphere | NMVFPWISPIFDPQAIFNVELLPGGGQAHHKMDCTLTLAFIGSR |
| Ga0182178_10172451 | 3300020023 | Switchgrass Phyllosphere | MNVVFPRISSIFVPQAIFSVELLPGGGQAHHKMDCALTP |
| Ga0182178_10184041 | 3300020023 | Switchgrass Phyllosphere | MVFPRISSIFDPQAIFSVELLPCGGQANRKMDCILTPAFIGSRY |
| Ga0182178_10194261 | 3300020023 | Switchgrass Phyllosphere | VVFPQISSIFDPQAIFSVELLPDGGQAHHMMDCILTPTFIGSR |
| Ga0182118_1037871 | 3300020223 | Switchgrass Phyllosphere | MNVVFPRISSIFDPQSIFSVELLPGGGQAHHKMDYA |
| Ga0207644_106489941 | 3300025931 | Switchgrass Rhizosphere | MVFPRISSIFVPQAIFSVELLPGGGQAHHKMDCTLTPAFIGSR |
| Ga0207644_118665282 | 3300025931 | Switchgrass Rhizosphere | YLATNVVFPRISSIFDPQAIFSVELLPGGDQAHHKMDCALTPAFMDS |
| Ga0207641_114519581 | 3300026088 | Switchgrass Rhizosphere | MWYSPRISSIFDLQAIFSVKLLPGGGQVDHKMDCALTLAFIGS |
| Ga0207676_125155511 | 3300026095 | Switchgrass Rhizosphere | ATNMVFPRISSIFDPQAIFSVELLPGGGQAHHKKDCTLTPAFIGSR |
| Ga0268344_10145131 | 3300028051 | Phyllosphere | MVFPRISLIFDPQAIFSVELLPGGGQAHHKMDFTLTPA |
| Ga0268338_10207611 | 3300028055 | Phyllosphere | TVVFPRISSIYDPQAIFSVELLPGGGQAHHKMDCTLTPSFIGSR |
| Ga0268330_10222501 | 3300028056 | Phyllosphere | MVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCIL |
| Ga0268330_10270671 | 3300028056 | Phyllosphere | KYKQLATNMVFPWISSIFDPQAIFSVELLPGGGQAHHILDYTLTPTFIGSR |
| Ga0268330_10455321 | 3300028056 | Phyllosphere | MVFPRISSIFDPKLFSSVELLPGGGQAHHKMDCILTPAFIVS |
| Ga0268330_10455341 | 3300028056 | Phyllosphere | VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPEFIG |
| Ga0268332_10358951 | 3300028058 | Phyllosphere | IFDPQAIFNVELLPGGGQAHHEMDCTLTPEIISSR |
| Ga0268332_10681721 | 3300028058 | Phyllosphere | KKYKQLATNVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCALIPAFIGSR |
| Ga0268314_10213681 | 3300028061 | Phyllosphere | YSPGYHQFDPQAIFSVELLPGGGQAHHKMDYTLTPTFIGSR |
| Ga0268314_10216362 | 3300028061 | Phyllosphere | YKQLAANVVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCALTPAFIGSR |
| Ga0268342_10410361 | 3300028062 | Phyllosphere | MVFPRISSIFDPQAIFSFELLPGGGQAHHKMDCILTPAFIGS |
| Ga0268342_10416281 | 3300028062 | Phyllosphere | MNVVFPRISSIFDPQSIFSVELLPGGGQAHHKMDYALTPAFIGSR |
| Ga0268340_10342551 | 3300028064 | Phyllosphere | VVFPQISSIFDPQAIFSVELLPGGGQAHHKMDCALAPAFIGSR |
| Ga0268340_10864571 | 3300028064 | Phyllosphere | RISSMFDPQSIFSVELLPGGGQAHHKMDYALTPAFIGSR |
| Ga0268347_10197081 | 3300028142 | Phyllosphere | IFDAQAIFSVELLPGGVQAHRKMDCTLTPTFIGSR |
| Ga0268347_10277671 | 3300028142 | Phyllosphere | RISSIFDPQAIFSVELLPGGDQAHHKMDCALTPAFMDS |
| Ga0268347_10326411 | 3300028142 | Phyllosphere | MVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFIGSR |
| Ga0268348_10067981 | 3300028143 | Phyllosphere | MWYSPRISSIFDPQAIFSVELLPGGDQAHHKMDCALTPAFIGSR |
| Ga0268303_1045771 | 3300028147 | Phyllosphere | LATNVVFPQISSIFDPQAIFSVELLPGGGQAHHKMDFTLTPGFIGSR |
| Ga0268308_10099791 | 3300028151 | Phyllosphere | VVFPRISSIFDPQAIFSVELLAGGGQAHHKMDCFLTPAFI |
| Ga0268308_10223511 | 3300028151 | Phyllosphere | LATNVVFPLISSIFDPQAIFSVELLPGGDQAHHKMDCALTPAFMDSC |
| Ga0268308_10295021 | 3300028151 | Phyllosphere | PIFEPQAIFNVELLPGGGQAHHEMDCTLTPQIISSR |
| Ga0268336_10209081 | 3300028152 | Phyllosphere | MVFPRISSIFDPQAIFCVELLPGGGQAHHKMDCALTPAF |
| Ga0268320_10104091 | 3300028153 | Phyllosphere | VVFPRMSSIFDPQDIFSVELFPGGGQGHHKMDCTLTPAFFLVDEE |
| Ga0268320_10172911 | 3300028153 | Phyllosphere | MNVVFPRISSIFDPQSIFSVELLPGGGQAHHKMDCILTPAVIGS |
| Ga0268310_10286231 | 3300028262 | Phyllosphere | SIFDPQAIFSVELLPDGGQAHHKMDCILTPAFIGSRCGI |
| Ga0268310_10397161 | 3300028262 | Phyllosphere | SIFDPQAIFSVELLPGGGQAHHKMDCALTPAFIGSR |
| Ga0268264_125044131 | 3300028381 | Switchgrass Rhizosphere | VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFI |
| Ga0268307_10020511 | 3300028470 | Phyllosphere | MNVVFPRISSIFDPQPIFSVELLPGAGQAHHKMDYALTPAFIGSR |
| Ga0268323_10142101 | 3300028471 | Phyllosphere | MNVVFPRISSIFDPQSIFSVELLPGGGQAHHKMDYTLTPAFIGSR |
| Ga0268319_10231851 | 3300028473 | Phyllosphere | MEFPRISSIFDPQAIFCVELLPGGGQAHNKMHCILTPAF |
| Ga0061013_100294451 | 3300030772 | Fungi-Associated Bovine Rumen | VVFPQISSIFDSQAIFSVELLPGGGQAHHKMDCILTPAFIGSR |
| Ga0214484_10461461 | 3300032591 | Switchgrass Phyllosphere | VVFPRISSIFDPEVIFSVIFLPGGGQAHHKMDCILTPAFIGSRCRIRGA |
| Ga0314759_11509591 | 3300033535 | Switchgrass Phyllosphere | MVFLRISSIFDPEAIFSVIFLPGGGQAHHKMDCILTPAFIGSRCRIRGA |
| ⦗Top⦘ |