NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F044878

Metagenome Family F044878

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044878
Family Type Metagenome
Number of Sequences 153
Average Sequence Length 47 residues
Representative Sequence MTGEKANFLSLAATQGGSVAFGNGKSGIIVGIGKIGESLSNSIEDVY
Number of Associated Samples 11
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 76.32 %
% of genes near scaffold ends (potentially truncated) 64.05 %
% of genes from short scaffolds (< 2000 bps) 97.39 %
Associated GOLD sequencing projects 6
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (92.810 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave
(96.078 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(100.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 14.67%    β-sheet: 8.00%    Coil/Unstructured: 77.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF00098zf-CCHC 7.84
PF13976gag_pre-integrs 4.58
PF00665rve 2.61
PF14223Retrotran_gag_2 1.31
PF05103DivIVA 1.31
PF07727RVT_2 1.31

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 2.61
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 2.61
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 2.61
COG4584TransposaseMobilome: prophages, transposons [X] 2.61

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.81 %
UnclassifiedrootN/A7.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006020|Ga0058704_10656078All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis618Open in IMG/M
3300006020|Ga0058704_10948354All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha509Open in IMG/M
3300009144|Ga0058702_10030223All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2034Open in IMG/M
3300009144|Ga0058702_10084262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1203Open in IMG/M
3300009144|Ga0058702_10127046All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha979Open in IMG/M
3300009144|Ga0058702_10235751All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana723Open in IMG/M
3300009144|Ga0058702_10236556All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis722Open in IMG/M
3300009144|Ga0058702_10272897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha674Open in IMG/M
3300009144|Ga0058702_10295135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha650Open in IMG/M
3300009144|Ga0058702_10303610All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta641Open in IMG/M
3300009144|Ga0058702_10341809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha606Open in IMG/M
3300009144|Ga0058702_10350939All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha599Open in IMG/M
3300009144|Ga0058702_10360034All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha591Open in IMG/M
3300009144|Ga0058702_10425219All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha547Open in IMG/M
3300009144|Ga0058702_10438755All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis539Open in IMG/M
3300009144|Ga0058702_10445887All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana535Open in IMG/M
3300009144|Ga0058702_10460278All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha528Open in IMG/M
3300009144|Ga0058702_10467814All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha524Open in IMG/M
3300009144|Ga0058702_10489860All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha513Open in IMG/M
3300009144|Ga0058702_10491938All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis512Open in IMG/M
3300009144|Ga0058702_10504103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha506Open in IMG/M
3300010395|Ga0058701_10081753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis2586Open in IMG/M
3300010395|Ga0058701_10090850All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2402Open in IMG/M
3300010395|Ga0058701_10127787All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Chenopodiaceae1881Open in IMG/M
3300010395|Ga0058701_10142212All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1738Open in IMG/M
3300010395|Ga0058701_10152141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales1652Open in IMG/M
3300010395|Ga0058701_10169691All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1523Open in IMG/M
3300010395|Ga0058701_10172536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1505Open in IMG/M
3300010395|Ga0058701_10176998All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1476Open in IMG/M
3300010395|Ga0058701_10181752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1447Open in IMG/M
3300010395|Ga0058701_10183011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1439Open in IMG/M
3300010395|Ga0058701_10184117All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1433Open in IMG/M
3300010395|Ga0058701_10192969All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1383Open in IMG/M
3300010395|Ga0058701_10195590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1369Open in IMG/M
3300010395|Ga0058701_10199479All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1348Open in IMG/M
3300010395|Ga0058701_10199481All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1348Open in IMG/M
3300010395|Ga0058701_10200233All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis1345Open in IMG/M
3300010395|Ga0058701_10222005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1245Open in IMG/M
3300010395|Ga0058701_10236914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1185Open in IMG/M
3300010395|Ga0058701_10253070All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1128Open in IMG/M
3300010395|Ga0058701_10253437All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1127Open in IMG/M
3300010395|Ga0058701_10274970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1059Open in IMG/M
3300010395|Ga0058701_10281144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae1042Open in IMG/M
3300010395|Ga0058701_10284940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1031Open in IMG/M
3300010395|Ga0058701_10298528All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Chenopodiaceae996Open in IMG/M
3300010395|Ga0058701_10308066All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis973Open in IMG/M
3300010395|Ga0058701_10309374All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha970Open in IMG/M
3300010395|Ga0058701_10311143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha965Open in IMG/M
3300010395|Ga0058701_10333005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis919Open in IMG/M
3300010395|Ga0058701_10356196All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis874Open in IMG/M
3300010395|Ga0058701_10360737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha866Open in IMG/M
3300010395|Ga0058701_10386767All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha824Open in IMG/M
3300010395|Ga0058701_10387921All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana822Open in IMG/M
3300010395|Ga0058701_10392470All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha815Open in IMG/M
3300010395|Ga0058701_10394280All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha812Open in IMG/M
3300010395|Ga0058701_10396805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha809Open in IMG/M
3300010395|Ga0058701_10400070All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha804Open in IMG/M
3300010395|Ga0058701_10403115All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana799Open in IMG/M
3300010395|Ga0058701_10406741All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha794Open in IMG/M
3300010395|Ga0058701_10407154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha794Open in IMG/M
3300010395|Ga0058701_10411022All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha788Open in IMG/M
3300010395|Ga0058701_10422699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha773Open in IMG/M
3300010395|Ga0058701_10429932Not Available764Open in IMG/M
3300010395|Ga0058701_10443113All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis748Open in IMG/M
3300010395|Ga0058701_10479059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha708Open in IMG/M
3300010395|Ga0058701_10498973Not Available689Open in IMG/M
3300010395|Ga0058701_10509445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha679Open in IMG/M
3300010395|Ga0058701_10517936All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha672Open in IMG/M
3300010395|Ga0058701_10531439All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis661Open in IMG/M
3300010395|Ga0058701_10532497All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis660Open in IMG/M
3300010395|Ga0058701_10533118All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha660Open in IMG/M
3300010395|Ga0058701_10588493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha619Open in IMG/M
3300010395|Ga0058701_10596592All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis613Open in IMG/M
3300010395|Ga0058701_10597359All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha613Open in IMG/M
3300010395|Ga0058701_10599505All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha612Open in IMG/M
3300010395|Ga0058701_10599974All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis611Open in IMG/M
3300010395|Ga0058701_10659393All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha577Open in IMG/M
3300010395|Ga0058701_10662429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha575Open in IMG/M
3300010395|Ga0058701_10686355All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha563Open in IMG/M
3300010395|Ga0058701_10692005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha560Open in IMG/M
3300010395|Ga0058701_10693177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana559Open in IMG/M
3300010395|Ga0058701_10696016All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha558Open in IMG/M
3300010395|Ga0058701_10700121All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha556Open in IMG/M
3300010395|Ga0058701_10709417All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis552Open in IMG/M
3300010395|Ga0058701_10734065All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha541Open in IMG/M
3300010395|Ga0058701_10740184Not Available538Open in IMG/M
3300010395|Ga0058701_10742848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana537Open in IMG/M
3300010395|Ga0058701_10760013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha530Open in IMG/M
3300010395|Ga0058701_10775011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha524Open in IMG/M
3300010395|Ga0058701_10777131All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha523Open in IMG/M
3300010395|Ga0058701_10788064All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha519Open in IMG/M
3300010395|Ga0058701_10811867All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha511Open in IMG/M
3300010395|Ga0058701_10824903All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha506Open in IMG/M
3300027718|Ga0209795_10099976All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis832Open in IMG/M
3300027718|Ga0209795_10138466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha688Open in IMG/M
3300027766|Ga0209796_10194547Not Available642Open in IMG/M
3300027766|Ga0209796_10318909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha501Open in IMG/M
3300030495|Ga0268246_10025929All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1725Open in IMG/M
3300030495|Ga0268246_10039736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1380Open in IMG/M
3300030495|Ga0268246_10059742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1112Open in IMG/M
3300030495|Ga0268246_10064372All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1069Open in IMG/M
3300030495|Ga0268246_10100456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana847Open in IMG/M
3300030495|Ga0268246_10110358All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis806Open in IMG/M
3300030495|Ga0268246_10162380All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha660Open in IMG/M
3300030495|Ga0268246_10174056All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta637Open in IMG/M
3300030495|Ga0268246_10180631All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha625Open in IMG/M
3300030495|Ga0268246_10196583All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta599Open in IMG/M
3300030495|Ga0268246_10201537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha592Open in IMG/M
3300030495|Ga0268246_10217161All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis570Open in IMG/M
3300030495|Ga0268246_10266451Not Available516Open in IMG/M
3300030495|Ga0268246_10282034All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis502Open in IMG/M
3300030498|Ga0268247_10040332All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1873Open in IMG/M
3300030498|Ga0268247_10094030All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1333Open in IMG/M
3300030498|Ga0268247_10108403Not Available1250Open in IMG/M
3300030498|Ga0268247_10113764Not Available1223Open in IMG/M
3300030498|Ga0268247_10121866All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1184Open in IMG/M
3300030498|Ga0268247_10144704Not Available1091Open in IMG/M
3300030498|Ga0268247_10148336All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1078Open in IMG/M
3300030498|Ga0268247_10209151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha904Open in IMG/M
3300030498|Ga0268247_10209392All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis903Open in IMG/M
3300030498|Ga0268247_10215746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha889Open in IMG/M
3300030498|Ga0268247_10235440All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha847Open in IMG/M
3300030498|Ga0268247_10243506All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Chenopodiaceae832Open in IMG/M
3300030498|Ga0268247_10243821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha831Open in IMG/M
3300030498|Ga0268247_10256177Not Available809Open in IMG/M
3300030498|Ga0268247_10280778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha768Open in IMG/M
3300030498|Ga0268247_10300381All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis739Open in IMG/M
3300030498|Ga0268247_10348900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha678Open in IMG/M
3300030498|Ga0268247_10351861All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha675Open in IMG/M
3300030498|Ga0268247_10389413All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha636Open in IMG/M
3300030498|Ga0268247_10394697All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha631Open in IMG/M
3300030498|Ga0268247_10396885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha629Open in IMG/M
3300030498|Ga0268247_10402441All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana624Open in IMG/M
3300030498|Ga0268247_10433944All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha596Open in IMG/M
3300030498|Ga0268247_10452028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha582Open in IMG/M
3300030498|Ga0268247_10492411All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha553Open in IMG/M
3300030498|Ga0268247_10510118All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis541Open in IMG/M
3300030498|Ga0268247_10540647All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha523Open in IMG/M
3300030498|Ga0268247_10545014All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha520Open in IMG/M
3300030498|Ga0268247_10545101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha520Open in IMG/M
3300030498|Ga0268247_10579831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha501Open in IMG/M
3300030501|Ga0268244_10546923All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha625Open in IMG/M
3300030501|Ga0268244_10709296All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha554Open in IMG/M
3300030501|Ga0268244_10753444All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta538Open in IMG/M
3300030501|Ga0268244_10771603All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha532Open in IMG/M
3300030514|Ga0268253_10053386All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1068Open in IMG/M
3300030514|Ga0268253_10085746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta891Open in IMG/M
3300030515|Ga0268254_10285316All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha545Open in IMG/M
3300030516|Ga0268255_10105706All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha845Open in IMG/M
3300030516|Ga0268255_10145235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha697Open in IMG/M
3300030516|Ga0268255_10161659All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Nicotianoideae → Nicotianeae → Nicotiana → Nicotiana tomentosiformis654Open in IMG/M
3300030516|Ga0268255_10257172Not Available502Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave96.08%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave3.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006020Agave microbial communities from Guanajuato, Mexico - Mg.Sf.eHost-AssociatedOpen in IMG/M
3300009144Agave microbial communities from Guanajuato, Mexico - Or.Sf.eHost-AssociatedOpen in IMG/M
3300010395Agave microbial communities from Guanajuato, Mexico - Or.Ma.eHost-AssociatedOpen in IMG/M
3300027718Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027766Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300030495Agave microbial communities from Guanajuato, Mexico - Or.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030498Agave microbial communities from Guanajuato, Mexico - Or.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300030501Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030514Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030515Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (v2)Host-AssociatedOpen in IMG/M
3300030516Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0058704_1065607823300006020AgaveMTGERSNLLSLTALNGGSVAFGNGKSGTIVGIGNIGKTLS
Ga0058704_1094835423300006020AgaveMTGEKLNFLSLTASDRGSVAFRNGKSGTIFGIGKIGESLPHSIDNVNLVDGL*
Ga0058702_1003022323300009144AgaveMTGEKSNFLPLTAAEGGSVAFGNRKSKTIVGIGKIGW*
Ga0058702_1008426223300009144AgaveMTGEKSDFLSLATTQGGSVAFGNGKSRSIVGIGKIGESLSHSIEDLYLVDGVKTQFAKCVPTV*
Ga0058702_1012704623300009144AgaveMMGEKSNFRSLAVSDGGSVAFENRKSGTIIGAGKIGESLSHSIENVFLVDGLQ
Ga0058702_1023575123300009144AgaveMTGEKVNFLSLAATHGESVAFGNGKSGTIVGIGKIGESLSNSIEDVYLVDG
Ga0058702_1023655613300009144AgaveMIGEKSNFLSLTATQGGSVAFENGKSGIIVGIGKIGESLSHSIDGVYL
Ga0058702_1027289713300009144AgaveMTGERFNFLSLTASQGGSVAFANGKSGTIVGIDKIDESLSHSIDCVYLVGA*
Ga0058702_1029513523300009144AgaveMTGGKSNFLSLAATQRGSVAFGNEKSGIIVGIGKIGESLSHSIDVLG*
Ga0058702_1030361023300009144AgaveMTGEKSNFISLAASDEGSAAFINGKFGTIVGIGKIGESLSHSIDNVTLRMVYNITY*
Ga0058702_1034180913300009144AgaveMTSEKFNFLSLAATQGGSVAFGNGKSGTIVGIGKIGESLS
Ga0058702_1035093923300009144AgaveMTSEKSNFLSLVPSDEGSVAFGNAMSETIVHIVKIGESLSHLIDNVYLVDRFTT*
Ga0058702_1036003423300009144AgaveLTGEKSNFLLLAATQGGSVAFGNEKLGSIVGIGKIG*
Ga0058702_1042521913300009144AgaveMTGEKSNFLSLAAAEGGSVAFGNGKIGESLSHSIDRVYLVDG*
Ga0058702_1043875513300009144AgaveMKDEKSNFLSLVASNGGTMAFENGKFGTIVGISKIGESLSNSIEDVYLV
Ga0058702_1044588713300009144AgaveMIGERSNFLSLTASQGGSVAFKNSKSGTIVGIGKIDKSLSHSIDCVYLVGD*
Ga0058702_1046027813300009144AgaveMTGEKSNFLSLATTQGGSVAFDNEKSGIIVGIGKIGESLSHS
Ga0058702_1046781413300009144AgaveLSLTVTQGGSVAFGNGKSGTIVGIGKIGESLSHFIDGVYLVDGLRHNLLSVS*
Ga0058702_1048986013300009144AgaveMTGEKSNFFSLAATQGGSVAFGNGKSGTIIGIGKIGESLSNSIEDVY
Ga0058702_1049193823300009144AgaveMTGEKTNFLSLAATQRGSVVFGNGKSGTIVGIGKIGESLSNSIEDVYL
Ga0058702_1050410313300009144AgaveMSGEKLNFLSLAAIQGGSLAFGNGKSGTIIGIGKI
Ga0058701_1008175313300010395AgaveMTGERSNFLSLTASQGGSVAFGNGKSGIIVGIGKIGETLS
Ga0058701_1009085013300010395AgaveLFKAYYGEKSNFLSLVASDGGSVAFENSKSGTIVGIGKIDGSLPH
Ga0058701_1012778723300010395AgaveMIGEKANFLSLAATQGGSLAFGNEKSGTIVGIGKIGESLSNYIEDV*
Ga0058701_1014221223300010395AgaveMTSEKSKFLSLTASDGRSVAFENAKSRTIVGIGKIGESPSHSIDSVYLVDRL*
Ga0058701_1015214133300010395AgaveMTGEKSNFLSLTTTKGGIVAFGNGKSRTIVGIGKVGESLSHSIDCVYLIDGLKRN*
Ga0058701_1016969113300010395AgaveMTGEKLNFLSLATSDGGSVAFGNGKSGTIVGIGKIG
Ga0058701_1017253633300010395AgaveMTGEKSNFLSLTTTQGGSVAFGNEKSGTIIGIGKIGESPSNSI
Ga0058701_1017699813300010395AgaveMTGEKSNFLSLVASDGGSVAFGNGKSGTIIGIGKIGESLSHS
Ga0058701_1018175233300010395AgaveMTGEKSNFLSLAATQGGSVAFENGKSGTIVSIGKIGESLSHSIDGIYLVDG*
Ga0058701_1018301153300010395AgaveMASEKSNFLSLAATHRGSVAFGNDKFGTIIGIGKISESLSHSIDGVYLVDEFT*
Ga0058701_1018411723300010395AgaveMTGEKSNFLSLAATQGGSVAFENAKFETIVGTGKIGESLSHLIDNVYLVNGSQHKCVPTV
Ga0058701_1019296923300010395AgaveMTDEKSNFLSLVASNEGSVAFGNDKSRTIVGIGKIGESLSHSIDGVYLVDGFT*
Ga0058701_1019559013300010395AgaveMTGEKSNFLSLVATQGGSVAFGNGKLGTIIGIGKIGEPPSNSIEDVY
Ga0058701_1019947923300010395AgaveMTGEKLNFLSLAATQGGSVAFENDKSGTIVGIGKMDKSLSHLIDNVHAFC*
Ga0058701_1019948143300010395AgaveMIGDKSNFLSLAATQRGSVALENGRSGTIASIGKIGESISHLIDNVYLVDGSQHKCVPTV
Ga0058701_1020023343300010395AgaveMTGEKVNFLSLAATQGGSVAFGNEKSGTIMGIGKIGESLSNSIEDVYLVDSLK
Ga0058701_1022200533300010395AgaveMTGERLNFLSLTASQGGSVAFGNGKSGTIVGIGKIGETLS
Ga0058701_1023691413300010395AgaveMTGEKSNFLSLTSSDGGSVAFGNCKSGVIVGVGKICESLSHSIENVYVVDG
Ga0058701_1025307013300010395AgaveMTREKSNFLSLATTQGGSVAFGNEKSGIIVDIGKIVESLSHSIDGV*
Ga0058701_1025343733300010395AgaveMIRAKSNFLSFTASDRGSMAFENDKSRTIVGIGKIGKSPSHSIDNVYLVDGL*
Ga0058701_1027497033300010395AgaveFLSLVASNGGSVTFENDKFGTIVGIGKIGESLYHSINGVYLVDGFT*
Ga0058701_1028114433300010395AgaveMTGEKSNFLSLTAAQGGSVAFENGKFGTIVRICKIGESLSYSINGIYLVDGLR
Ga0058701_1028494013300010395AgaveMTGEKSNFLSLIAAEGGSVAFGNGKSGTIVGIGKI
Ga0058701_1029852823300010395AgaveMTCEKFNFLSLTVAEGGSAAFGNGKFGTIVRIGKISESLSHSIDSVYLVDSLKHNLLVCPNCVIRTT*
Ga0058701_1030806623300010395AgaveMIGVQFNFLSLTVTQRGSVAFGNGKSGTIVGIGKIGESLSHFIDGVYLVDGL
Ga0058701_1030937413300010395AgaveMSGRKSNFLSVTAAEGWSVAFGNGKSRTIVRIGKIGESLSHSIDSVYLVDG
Ga0058701_1031114333300010395AgaveMTGEKANFLSLAATQGGSVAFGNRKSGTIIGIGKIGESLSN
Ga0058701_1033300523300010395AgaveMTGEKSNFLSLAATQGGSVAFENGKSGTIVSISKIGESLFHSIDDVYLVDGL
Ga0058701_1035619613300010395AgaveMIGEKFNFISLAATQGGSVAFGNGKSGSIVGIGKIGESL
Ga0058701_1036073723300010395AgaveVDSGCLRHITGEKSNFLALTASDGGSVAFGNGNFGTIVGIGKIGDSLSYSIDNVYLVDGL
Ga0058701_1038676723300010395AgaveMRMTSIKSNFLSLTPTQGGSVAFANGKSGTIIGISKIGESLSYSIDGVYLVDGLRHNLLCVS*
Ga0058701_1038792123300010395AgaveMTGERSKFLSLTALQGGNVAFENGKFGIIVGIGKIDESLSHSIDCVYLVGG*
Ga0058701_1039247013300010395AgaveMTGEKSNFLSLTASDGGSVAFRNSKFGTIVGIGKIGELPSYSIIMYTLLMVYN
Ga0058701_1039428013300010395AgaveMIGEKSNFLSLAAPQRGYVAFGNGKSGSIVNIGKINESLSHFIEDVYL
Ga0058701_1039680513300010395AgaveMTGEKANFLSLTATQGGSVAFGNEKSDTIVGIGK*
Ga0058701_1040007013300010395AgaveMTSEKSNFLSLAASDGWSVAFGNGKSGTIVGIGKIGESLSHSIDIVYLVDG
Ga0058701_1040311513300010395AgaveMTGEKENFLSLAATQGGSVAFGNGKSGTIIGIGKIGESLSNSIEDVYL
Ga0058701_1040674113300010395AgaveMTGEKSNFLSLAATQGGSVVFGNGKSGTIIGIGKISESLSNSIEGVY
Ga0058701_1040715423300010395AgaveMIGKKSNFLSLAATQGGSVAFGNGKSGSIVGIGKIGESLSHSIEDVYLVDGLK
Ga0058701_1041102233300010395AgaveMTDEKANFLSLAATQGGSVAFGNGKSGTIMGIGKIG
Ga0058701_1042269923300010395AgaveMTGEKSNFVSLTASDGGSVAFENSKSGIIIRVGKIGESLSHSIENVYLVDGL*
Ga0058701_1042993223300010395AgaveMTSEKANFLSLAATHGGSVAFGNGKPRTIIGIGEIGSGV*
Ga0058701_1044311333300010395AgaveMTGEKANFLSLATTQGGTVAFGNGKSGTIVGIGKI
Ga0058701_1047905923300010395AgaveMTGEKSNFFFSLAATEGGSVAFGNGKLGSIVGIDKIGESLSHSIEDV*
Ga0058701_1049897313300010395AgaveMTCEKSNFLSLVASNGGSVAFENGKSGTIVGIGKIGESLSHLIDNVYLVDGLQHS
Ga0058701_1050944513300010395AgaveMTGEKFNFLSLTTAEGRSVAFGNDKSGTIVGIGKIGE*
Ga0058701_1051793623300010395AgaveMTGEKSNILSLVASDGGSVAFTNSKFGKIFGIGKIGESL
Ga0058701_1053143923300010395AgaveMTGEKDNFLSLVATNGGSVAFGNGKSGTIIGIGKIGESL
Ga0058701_1053249713300010395AgaveVKKANFLSLAVTQGGSVAFGNGKSGTIIGIGKIGESLSNSIE
Ga0058701_1053311813300010395AgaveMTGDKANFLSLAATQGRSVAFGNGKSETIMGIGKIGESLSNSIEDVYLVD
Ga0058701_1058849323300010395AgaveMTSEKANFLSLAATQGRSVAFGNGKSETIMDICKIGKSLSNSIEDVYLVDGLK
Ga0058701_1059659223300010395AgaveMTGEKSNFLSLTAAQGGSMAFENGKSGTIIGIGKIGEWMVFI*
Ga0058701_1059735913300010395AgaveMTGEESNFLSLAATYGGSVAFGNGKSGTIIGIGKIGESLSNSIE
Ga0058701_1059950513300010395AgaveMIGEKSDFLSLAATQGGSVAFGNGKSGTIVGIGKISESLSHSINGVY*
Ga0058701_1059997423300010395AgaveMTGEKFNFLSLAATQGGSVTFSNGKSGSIVGIGKTGKSLSHSI*
Ga0058701_1065939313300010395AgaveMTDEKSNFLSLAATQGGSVAFGNGKSGTIIVIGKIGESLSNSIEDVYLVDG*
Ga0058701_1066242923300010395AgaveMTGEKANFLSLATTQGGSVAFGNGKSGTIVGISKIGESLSNSIEDVY
Ga0058701_1068635513300010395AgaveMTGEKSNFLSLTVVEGGSVAFGNGKSGTIVGIGKIGE
Ga0058701_1069200513300010395AgaveMTGEKSNFLSLTAAEGGSVTFGNGKFGTIVGIGKIG
Ga0058701_1069317713300010395AgaveMTGERSHFPSLTASQGGSMVFENGKSGTIVGIGKIDESLSHSIDCVYHVGG*
Ga0058701_1069601623300010395AgaveMTGEKDNFLSLVATHGGSVTFGNGKSGTIVGIGKISESLSNSIEDVY
Ga0058701_1070012113300010395AgaveMTGEKSNCLSLVASDGASVAFGNDKSRTIVGIDKIGESLSHSIDNVYL
Ga0058701_1070941713300010395AgaveMTGEKSNFLSLTATQGGSVAFGNGKSGTITGIGKIGE
Ga0058701_1073406523300010395AgaveMTGEKSNFLSLTAAEGGSVAFGNSKSWTIVGIGKIGDSLFHLIDSVYIL*
Ga0058701_1074018413300010395AgaveMTGEKSNFLSLTTAEGGSVAFGNGKSGTIIGIGKIGESLSHSIDC
Ga0058701_1074284813300010395AgaveVVVQGTRQGEISNFLSLTASDGGSVGFENDKSRTIVDIGKIGESPSHSIDNVY
Ga0058701_1076001313300010395AgaveMTGEKSNFLSLVAFDGGSVAFGNGKSGTIVGIDKIG
Ga0058701_1077501113300010395AgaveMIGDRSNFFSLTALDGGSVAFENGKFRIIVGIGKIGESLSHSVDNV*
Ga0058701_1077713113300010395AgaveMTGEKSNFLSLAATQGGSVAFGNGKSETNISIGKIDESLSNSY*
Ga0058701_1078806413300010395AgaveMMGEKSNFLSLAATQGGSVAFGNKKSGTIVGIGKIDESFSHSIENVYLVNGLKTQFAKCVSTV*
Ga0058701_1081186723300010395AgaveMTGKKSNFLSLAATQGGNVVFDNEKSGIIVDIGKIGKSLSHSIDGV*
Ga0058701_1082490313300010395AgaveMTGERSNFLSLTASQGGSVAFENDKFGTIVGIGKIDESLSHSIDCVY
Ga0209795_1009997623300027718AgaveMTGEKSNFLSLAATQGGSVAFGNEKSGIIVDIGKIGKSLSHSIDGV
Ga0209795_1013846613300027718AgaveMGGEKSNFLSLTAVEGGSVAFDNGKSGTIVGIGKIGESLSH
Ga0209796_1019454733300027766AgaveMASEKSNFLSLAATHRGSVAFGNDKFGTIIGIGKISESLSHSI
Ga0209796_1031890923300027766AgaveMTSEKSNFLSLTVAEGRSVAFGNGKSGTIVRIGKIGESLSHSINSVYLVDDLKHNL
Ga0268246_1002592923300030495AgaveMTGEKSNFLPLTAAEGGSVAFGNRKSKTIVGIGKIGW
Ga0268246_1003973613300030495AgaveMTGEKFNFLSLAATQGGSVAFGNGKSGLIVGIGKIGESLSHS
Ga0268246_1005974233300030495AgaveMTGEKSNFLSLTATEGGSVAFGNGKSGIIVGIGKIGEPLSHSIDCVCLVDGLSIIY
Ga0268246_1006437213300030495AgaveMTGEKSNFLSLVAIQGGSVAFGNGKSGSIVGIGKIVS
Ga0268246_1010045613300030495AgaveMTGEKSNFLSLVASNGGSVAFENGKSRTIVGIGKICESLSHLINCIYPV
Ga0268246_1011035823300030495AgaveMKGEKSKFLSLVASNEGSVAFGNGKSRTIVGISKIGDSLSHSIDGVYLVDGLK
Ga0268246_1016238013300030495AgaveMSGRKSNFLSVTAVEGWSVAFGNGKSRTIVRIGKIGESLSHSIDSVYLVDGLNHNLLSVS
Ga0268246_1017405613300030495AgaveMTGEKSNFLSLIASAQGSVVFGNGKSRTIVDIGKIGELPSHSIDNVY
Ga0268246_1018063113300030495AgaveMTSEKFNFLSLAATQGGSVAFGNGKSGTIVGIGKIGESLSHSIKDVYLQ
Ga0268246_1019658313300030495AgaveMTGEKSNFISLAASDEGSAAFINGKFGTIVGIGKIGESLSPLIDTMYLVDGLQ
Ga0268246_1020153723300030495AgaveMTGEKLNFLSLATTQGGSVPFGNRKSGTIVSIGKIGESLSHSIEDVYLVDG
Ga0268246_1021716123300030495AgaveMTGEKANFLSLAATQGGSVAFGNGKSGIIVGIGKIGESLSNSIEDVY
Ga0268246_1026645113300030495AgaveMTGDRSNFLSLTALDGGSVAFWKRQVWAIVSIGKIGESLSHSIDNVY
Ga0268246_1028203423300030495AgaveMTGEKSNFLSLAATQGGSVAFENGKSGTIVSIGKI
Ga0268247_1004033233300030498AgaveMTSEKSKFLSLTASDGRSVAFENAKSRTIVGIGKIGESPSHSIDSVYLVDRL
Ga0268247_1009403033300030498AgaveMTSEKSNFHSLTAAQGGSVAFENGKSGIIVGTGKIGESLSHSIDTVYLIDDLRQF
Ga0268247_1010840333300030498AgaveMTGEKSNFLPLIAAEGGSVAFGNGKSKTIVGIGKIGW
Ga0268247_1011376413300030498AgaveMTGEKSNFLALVATQGGSVAFGNEKSGTIIGKIGKIGESLSH
Ga0268247_1012186613300030498AgaveMTGEKSNFLSLAATQGGSVAFENGKSGTIVSIGKIGESLSHSIDGIYLVDG
Ga0268247_1014470433300030498AgaveMAGEKSNFLSLAATQGGSVAFGNGKSGTIVGIGKISES
Ga0268247_1014833633300030498AgaveMTGEKSNFLSLTAAQGRNVTFSNGKSEIIVEIGKIGESLSHSTDSVYL
Ga0268247_1020915123300030498AgaveMIGKKSNFLSLVASDRGSMAFENGKSRTIVDIGKIGESLPHSIDNVYLVD
Ga0268247_1020939233300030498AgaveMTGKKANFLLLAATQGGSVAFGNGKSGTIMGIGKIGKSLSNSIEEVYLVDGLK
Ga0268247_1021574613300030498AgaveMTNEKSNFFSLVASDGGSVAFENGKSGTIVRIGKIGDTL
Ga0268247_1023544023300030498AgaveMTGEKDNFLSLVATHGGSVTFGNGKSGTIVGIGKISESLSNSIED
Ga0268247_1024350623300030498AgaveMTGVRTNFLSLTATQEGSVAFGNGKSRTIVGIGKIGESLFHSIDGVYLVDGLRHNLLSVS
Ga0268247_1024382123300030498AgaveMTGEKANFLSLSATQGGSVAFGNGKSGTIMGIGKIVSHSPTL
Ga0268247_1025617713300030498AgaveMKDEKSNFLSLVASNGGTVAFENGKFGTIVGISKIGESLFHLIDNVYLVDGLQHEYVPIV
Ga0268247_1028077813300030498AgaveMTSEKFNFLSLAATQGGSVAFGNGKSGTIVGIGKIGES
Ga0268247_1030038133300030498AgaveMTGEKSNFLSVTAVEGGSVAFGNGKSETIVGIGNIGE
Ga0268247_1034890013300030498AgaveMIGEKANFLSLAATQGGSLAFGNEKSGTIVGIGKIGESLSNYIEDV
Ga0268247_1035186113300030498AgaveMTREKSNFLSLATTQGGSVAFGNEKSGIIVDIGKIVESLSHSIDGV
Ga0268247_1038473913300030498AgaveMTGEISNFLSLTASDRGSVAFENGKSETIVGIGKIGESLSRSIDNVYLVDGLQHN
Ga0268247_1038941323300030498AgaveMTCEKFNFLSLTVAEGGSAAFGNGKFGTIVRIGKISESLSHSIDSVYLVDSLKHNLLVCPNCVIRTT
Ga0268247_1039469723300030498AgaveMTGEKANFLSLAATQRGSVAFDNGKSGTIVSIRKIGES
Ga0268247_1039688523300030498AgaveMTGEKFNFLSLAAIHGGSVAFENNKFGTIVGIGKIGESLSHLINNVNGLQYNMLSVSQLC
Ga0268247_1040244123300030498AgaveMIRAKSNFLSFTASDRGSMAFENDKSRTIVGIGKIGKSPSHSIDNVYLVDGL
Ga0268247_1043394423300030498AgaveCSRRTTGEKSNFLSLVATQGGSVAFGNGKSGTIIGIGKIGESLSHSIEDVYILG
Ga0268247_1045202813300030498AgaveMTSEKVNFLSLAATQGGSVVFSNGKSGTIVGIGKIGESL
Ga0268247_1049241123300030498AgaveNFLSLVASNGGSVAFENGKSGTIVGIGKIGESLSHSIDNVYLVDGPNCVIKIT
Ga0268247_1051011813300030498AgaveMTGEKSNFLSLAATKGGSVAFGNGKSGTIVGIDKIGES
Ga0268247_1054064733300030498AgaveMTGEKSNFLSLAATQGGSVEFGNEKSGIIVDIGKIGESLS
Ga0268247_1054501423300030498AgaveKSNFLSLTASDEGSMAFGNSKFKTIVGIGKIRESLSY
Ga0268247_1054510113300030498AgaveEGGSVAFGNDKSRTIVGIGKIGESLSHSIDCVYLVDGLNIIYLVCSNCVIKTT
Ga0268247_1057983123300030498AgaveMTGEESNFLSLAATYGGSVAFGNEKSGTIIGIGKIGESL
Ga0268244_1054692323300030501AgaveMTGEKSNLLSLTASDGRRVAFGNGKSGTIIGIGKIGE
Ga0268244_1070929623300030501AgaveVDSGYSRHITGEKSNFLSLTASDGGSVAFGNGKSGTIAGICKIGESLPHSIDNVYVVDGL
Ga0268244_1075344413300030501AgaveMTGEKSNFLSLTASEGGSVAFGNGKSGTTVGIGKIGESLSHFIINVY
Ga0268244_1077160313300030501AgaveMTGEKSKFLSLTALEGGSVAFGNGKSGTIVGIGKIG
Ga0268253_1005338613300030514AgaveMTGEKSNFLSLTASEGGSVAFGNGKSGTIVGVGRIGESLSHLIDN
Ga0268253_1008574623300030514AgaveMTGEKSNFLSLTASHGGSVAFRNDKSGTIVAIGEIGKSLPHSIDN
Ga0268254_1028531613300030515AgaveMTGEKFNFLSLAATQGGSMAFGNGKFGTIVGIGKIGESLSHSIDCIYLIDGL
Ga0268255_1010570623300030516AgaveMTGDKSNFLSLIATEGGSVPFGNGKSGTIVGIRKIGESLSHSIDGVYLIDGLKH
Ga0268255_1014523513300030516AgaveMTGEKSNFLSLAATQGGSVAFGNGKSGTIVGIGKI
Ga0268255_1016165923300030516AgaveMTGEKSNFLSLTAAEGGSVAFGNGKSRIIVGIGKIRESLSHSINCVYLV
Ga0268255_1025717223300030516AgaveGKKSNFLSLAATQGGNVVFDNEKSGIIVDIGKIGKSLSHSIDGV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.