Basic Information | |
---|---|
Family ID | F044848 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 153 |
Average Sequence Length | 38 residues |
Representative Sequence | SYEMIPNAPKHYETHQNMSLGSNGVDQVRLLGKITT |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 153 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.38 % |
% of genes near scaffold ends (potentially truncated) | 94.77 % |
% of genes from short scaffolds (< 2000 bps) | 94.12 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.22 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (44.444 % of family members) |
Environment Ontology (ENVO) | Unclassified (84.314 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (81.046 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.88% β-sheet: 0.00% Coil/Unstructured: 78.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 44.44% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 28.10% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 9.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.31% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012949 | Switchgrass enrichment cultures co-assembly | Engineered | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028052 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028148 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028464 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028465 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028469 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028471 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028474 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062593_1029516792 | 3300004114 | Soil | VSCSNETLPNAPKHYETHQNMSLGSNGVDQVRLLGKITT* |
Ga0070666_102054022 | 3300005335 | Switchgrass Rhizosphere | VSCSYETIPNAPKHYATHQNMSLGFNGVDWVRSLRKIPT* |
Ga0070668_1015133011 | 3300005347 | Switchgrass Rhizosphere | MQQVSCSYETIPNAPKYYETHRNISLGSNGVDQVRSLQKIT |
Ga0070671_1012411832 | 3300005355 | Switchgrass Rhizosphere | VSCGYETIPNAPKHYATHQNMSLGSNGVDWVRSLQKIPT* |
Ga0070667_1006011192 | 3300005367 | Switchgrass Rhizosphere | VLHRVSCVYEMIPNAPKHYAMHQNMSLGSNGVDWVSSAQKIPT* |
Ga0070709_113570171 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | QYVLQQVSCSYETIPNAPKHYETHQNMNLGSDQVRWLRNITT* |
Ga0070702_1017601581 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | PVLHRVSCSYETIPNAPKHYETHQNMSLGSNGVDWVRSLQKIPT* |
Ga0068859_1010594052 | 3300005617 | Switchgrass Rhizosphere | SCVYEMIPNAPKHYATHQNMSLGSNGVDWVRSVQKIPT* |
Ga0068859_1023362113 | 3300005617 | Switchgrass Rhizosphere | VSCSYETIPNAPKHYATHQNMSLGSNGVDWVRSLRKIPA* |
Ga0068859_1029274071 | 3300005617 | Switchgrass Rhizosphere | QQVSCSYETIPNAPKYYEMHQNISLGYNGVDQVRSLQKITT* |
Ga0068864_1013514712 | 3300005618 | Switchgrass Rhizosphere | HPILHRVSCGYEMIPNAPKHYATHQNMSLGSNGVDWVRSLQKIPT* |
Ga0068864_1019477541 | 3300005618 | Switchgrass Rhizosphere | RVSCSYETITNAPKHNETYENISLGSNGVDWVGSLQKIPT* |
Ga0068861_1007946481 | 3300005719 | Switchgrass Rhizosphere | ETITNAPKHNETYENMSLGSNGVDWVRSLRKIPT* |
Ga0068861_1024055931 | 3300005719 | Switchgrass Rhizosphere | CGYETIPNAPKHYATHQNMSLGSNGVDWVRSLQKIPM* |
Ga0068858_1010909711 | 3300005842 | Switchgrass Rhizosphere | SETVRNAPKRKQTHQNMSLGSNGVDREHLLRKIMHDFVA* |
Ga0068860_1011177051 | 3300005843 | Switchgrass Rhizosphere | CSNETLPNAPKYYETHQNMSLGSNGVGRVHLLRKIPK* |
Ga0068860_1023992762 | 3300005843 | Switchgrass Rhizosphere | RVSCSYEMIPNAPKHYETHQNMSLGSNGVDQVRLLGKITM* |
Ga0068860_1025230002 | 3300005843 | Switchgrass Rhizosphere | VSCSYETITDEPKHYETYQNMSLGSNGVDWVRSLRKIQT* |
Ga0105136_1099821 | 3300009973 | Switchgrass Associated | FETIPNAPKHYATHQNMSLSSNGVDWVRLLQKILT* |
Ga0105129_1134662 | 3300009975 | Switchgrass Associated | SCSYEMIPNAPKHYETHQNMSLGSNGVDQVRLLGKITT* |
Ga0105128_1086301 | 3300009976 | Switchgrass Associated | CSYEMIENAPKHCETHQNMSLWSNGVDQVRLLHKITM* |
Ga0105128_1137251 | 3300009976 | Switchgrass Associated | VSCSYKMIPNAAKHYEMHQNMSLGPNGVDWVRSL* |
Ga0105135_1084221 | 3300009980 | Switchgrass Associated | VSCGFETIPNAPKHYATHQNMSLSSNGVDWVRLLQKILT* |
Ga0105133_1231041 | 3300009981 | Switchgrass Associated | EMIPNASKHYATHENMSLGSNGVDWVRSLRKILT* |
Ga0105133_1321641 | 3300009981 | Switchgrass Associated | ILHRVPCSNETLPNAPKHYENDPEHEFGSNGVDRVRSL* |
Ga0105131_1034181 | 3300009989 | Switchgrass Associated | SYEMITDEPKHYETYQNMSLGSNGVDWVRSLRKILT* |
Ga0105131_1306471 | 3300009989 | Switchgrass Associated | YETITDEPKHYETYQNMSLGSNGVDWVHSLQKIST* |
Ga0105132_1184771 | 3300009990 | Switchgrass Associated | YETIRNAPKHYVTHQNMSLGSNGVDWVRSLRKIPA* |
Ga0105120_10268031 | 3300009992 | Switchgrass Associated | YEMITDEPKHYETYQNMSLGSNGVDWVRSLRKIPM* |
Ga0105126_10483011 | 3300009994 | Switchgrass Associated | SYETIPNAPKHYATGENMSLGSNGVDWVRSLRKIPM* |
Ga0105139_10652912 | 3300009995 | Switchgrass Associated | ETIPNAPKHYAMHQNLSLASNGVDWVRLLQKIPT* |
Ga0105139_10920921 | 3300009995 | Switchgrass Associated | VSCIYETIPNAPKHYETHQNMSLVANVVDWVRSLRKIPT* |
Ga0105139_11154341 | 3300009995 | Switchgrass Associated | YETIPNAAKHYATHENMSLGSNGVDWVRSLRKIPM* |
Ga0134125_109123081 | 3300010371 | Terrestrial Soil | MVPNAPKQYETHQNVSLWSNGVDQVRLLRKIPMRL |
Ga0134123_126426131 | 3300010403 | Terrestrial Soil | VSCSYETITNAPKHYETYENMSLGSNGVDWVRSL* |
Ga0153798_102694921 | 3300012949 | Switchgrass Degrading | EMFPNARKHYATHQNISLGSNGGDWVRSVQKILT* |
Ga0157379_115372431 | 3300014968 | Switchgrass Rhizosphere | YETITDEPKHYETYQNMRLGSNGVDWVRSLRKILT* |
Ga0157379_121790571 | 3300014968 | Switchgrass Rhizosphere | HRVSCSYETIPNAPKYYETHQNMSLGSNGVDQVRSLQ* |
Ga0182183_10195111 | 3300015270 | Switchgrass Phyllosphere | YETITNAPKNNETYENMSLGSNGVDWVRSLRKIAS* |
Ga0182100_10963571 | 3300015280 | Switchgrass Phyllosphere | NETIPNAPKHYEMHQNISLGSNGVDRVRSLQKIAT* |
Ga0182101_10734451 | 3300015284 | Switchgrass Phyllosphere | MNPNAPKHYEAHQNMKLGSNEVDQVCSLRKITT*LPGTNF |
Ga0182101_10747581 | 3300015284 | Switchgrass Phyllosphere | RVSSINETLPKAPKHYETQQNMSLGFNWVDGVRSF* |
Ga0182103_10577952 | 3300015293 | Switchgrass Phyllosphere | YETIPNAPKHYETHKKMSLGSNGVDQVRWLRKNTT* |
Ga0182104_10919821 | 3300015297 | Switchgrass Phyllosphere | NSETVPNAPKRRETHQNMSLGSNGVDQVHSLQKILA* |
Ga0182184_11008621 | 3300015301 | Switchgrass Phyllosphere | SYEIIRNELKHCATHKNMSLGSNGVDPVRLLRKITT* |
Ga0182162_10341211 | 3300015310 | Switchgrass Phyllosphere | SYETITDEPKHYETYQNMSLGSNRVDWVRLLQKIPT* |
Ga0182162_11298891 | 3300015310 | Switchgrass Phyllosphere | RVSCSKEMIPYAPKHYKMQENMSLGSNGVDRVLLL* |
Ga0182182_10207691 | 3300015311 | Switchgrass Phyllosphere | YEMIPNAPKHYETHQNMSLGSNGVDQVHLLGKITT* |
Ga0182182_10211481 | 3300015311 | Switchgrass Phyllosphere | LQRVSCSYETITNAPKHYEMPQNMSLGSNGVDQVRWL* |
Ga0182182_10787791 | 3300015311 | Switchgrass Phyllosphere | SYEMISNAPKYCEMHRNISLGSNGVDQVRWLRKITM* |
Ga0182168_10555341 | 3300015312 | Switchgrass Phyllosphere | SYETIPNAPKHYETHQNMSLQSNGVDQVCSLQKITT* |
Ga0182168_11045401 | 3300015312 | Switchgrass Phyllosphere | TNTPKHYEMHKNMSLGSNGVDRVHSLRKISDATS* |
Ga0182164_11373482 | 3300015313 | Switchgrass Phyllosphere | FALILPLQPVLHRVSCSYEMIPNAPEHYEMHQNMSLGSNWVDLVRWLRKITT* |
Ga0182120_10483352 | 3300015315 | Switchgrass Phyllosphere | SCSYETITNAPKHNETYENMSLGSNGVDWVRSLRKIAS* |
Ga0182120_10830561 | 3300015315 | Switchgrass Phyllosphere | RVSCSYEMIPNAPKHYETHQNMSLGSNGVDQVRLLGITT* |
Ga0182120_10949821 | 3300015315 | Switchgrass Phyllosphere | VLCSNERLPNAPKHYETHQNMSLGSNGVDRVDLLQKNPM* |
Ga0182121_11305681 | 3300015316 | Switchgrass Phyllosphere | ETIPNAPKHYATHQNMSLGFNGVDWVRSLRKIPM* |
Ga0182181_10626911 | 3300015318 | Switchgrass Phyllosphere | YEMIPNAPKHYATHQNMSLGSNGVDWVRSVQKIPT* |
Ga0182130_11337901 | 3300015319 | Switchgrass Phyllosphere | ETIQNAQKHYETHQYMSLGFNRVDRVRSLQKILM* |
Ga0182165_10564501 | 3300015320 | Switchgrass Phyllosphere | ETITDEPKHYETYQNMSLGSNRVDWVRLLQKIPT* |
Ga0182134_10584751 | 3300015324 | Switchgrass Phyllosphere | VYEMIPNAPKHYATHQNMSLGSNGVDWVRSVQKIPT* |
Ga0182134_11407282 | 3300015324 | Switchgrass Phyllosphere | YEMIPNAPKHYERHQNMSLGSNGMDQVRLLGKITT* |
Ga0182148_10297621 | 3300015325 | Switchgrass Phyllosphere | CSYEMIPNATKHYEMHQNMSL*SNGVDQVHLL*VIPI* |
Ga0182166_11396352 | 3300015326 | Switchgrass Phyllosphere | MHYETLTNAPKHYETHQNMSLGSNGVDQVHLLGKI |
Ga0182166_11437631 | 3300015326 | Switchgrass Phyllosphere | VYEMIPNVPKHYATHQNMSLGSNGVDWVRLVQKIPT* |
Ga0182153_10968132 | 3300015328 | Switchgrass Phyllosphere | YETIRTAPKYYETHQNISLGSNGVDQVRSLQKITT* |
Ga0182153_11428511 | 3300015328 | Switchgrass Phyllosphere | ETIENAPKHYETHQNMSLGSNGVDQVRSLRKITM* |
Ga0182131_11215821 | 3300015331 | Switchgrass Phyllosphere | HRVSCSYEKIPNAPEHYEMHQNMSLESNGLDQLRWLQ* |
Ga0182117_10506141 | 3300015332 | Switchgrass Phyllosphere | ETLTNAPKHYETHQNMSLGSNGVDQVHLLGKITT* |
Ga0182117_10863471 | 3300015332 | Switchgrass Phyllosphere | VSCSYETITNAPKHNETYENMSLGSNGVDWVRSLRKIPT* |
Ga0182132_11310701 | 3300015334 | Switchgrass Phyllosphere | SNETLPNAPKYNAMHQNMSLGSNGVDWVRSLQKKF* |
Ga0182132_11361991 | 3300015334 | Switchgrass Phyllosphere | SNEIVPNAPKHYETHQNMSLGPDGVDRVDLLQKI* |
Ga0182116_11655242 | 3300015335 | Switchgrass Phyllosphere | YEMIPNAPKHYETHQNMSLGSNGVDQVCLLGKFTT* |
Ga0182150_10507802 | 3300015336 | Switchgrass Phyllosphere | LHRVSCSYEKIPNAPEHYEMHQNMSLESNGVDQVRWLRKITT* |
Ga0182151_10483621 | 3300015337 | Switchgrass Phyllosphere | SYEKIPNAPEQYEMHQNMSLGSNGVDQVRWLRNITT* |
Ga0182151_11016561 | 3300015337 | Switchgrass Phyllosphere | ETLPNAPKYYETHQNMILGSNGVDQVRSLRKIPM* |
Ga0182151_11230202 | 3300015337 | Switchgrass Phyllosphere | SCSYEKIPNAREHYEMHQNMSLGSNGVDLVRWLRKITT* |
Ga0182149_10465651 | 3300015339 | Switchgrass Phyllosphere | SYETITNAPKHNETYENMSLGSNGVDWVRSLRKIPM* |
Ga0182149_11245691 | 3300015339 | Switchgrass Phyllosphere | RVSCGYETIPNAPKHYATHQNMNLGSNGVDLLRSLEKIPA* |
Ga0182133_10600401 | 3300015340 | Switchgrass Phyllosphere | ETIENASKHYETHQNMSLGSNGVDQVRSLHKITM* |
Ga0182133_11694072 | 3300015340 | Switchgrass Phyllosphere | YETIPNAPKHYETHQNMSLGSNGVDQVRSLQKNIM* |
Ga0182115_12392911 | 3300015348 | Switchgrass Phyllosphere | EKISNAPKHYETHQNMSLGSNGVDQVRSLQKVQT* |
Ga0182185_10938011 | 3300015349 | Switchgrass Phyllosphere | YETLTNAPKHYETHQNMSLGSNGVDQVCLLGKITT* |
Ga0182163_11886901 | 3300015350 | Switchgrass Phyllosphere | SYETIPNAPKYYETDRNLSLGSNGVDWVRSLQKIPT* |
Ga0182163_12226361 | 3300015350 | Switchgrass Phyllosphere | LILHNVSCSNEMIPNAPKHYEPDQNMGLGSNGVDRVRSM* |
Ga0182169_12643502 | 3300015352 | Switchgrass Phyllosphere | EMIPNAPKHNETHQNMSLGSNGVDQVRLLRKITT* |
Ga0182179_10890281 | 3300015353 | Switchgrass Phyllosphere | VLHRVSCSYEKIPNAPEHYEMHQNMSLGSNGVDQVRWLRKITT* |
Ga0182179_11766241 | 3300015353 | Switchgrass Phyllosphere | EMIPNAPKHYETHQNMSLGSNGVDWVRLLQKIPT* |
Ga0182167_10533111 | 3300015354 | Switchgrass Phyllosphere | ETIPNASKHYERHKNMILGYKGVDQVRLLGKMTT* |
Ga0182167_11615572 | 3300015354 | Switchgrass Phyllosphere | EKIPNAPEQYEMHQNMSLGSNGVDQVRWLRNITT* |
Ga0182167_11825941 | 3300015354 | Switchgrass Phyllosphere | VSCSYETIPNAPKHYETHQNMSLGTNGVDQVRLFGKITM* |
Ga0182167_12784441 | 3300015354 | Switchgrass Phyllosphere | SYKTITNAPKYYEIDRNISLESNRVDWVRLLRKNMT* |
Ga0182199_10581381 | 3300017412 | Switchgrass Phyllosphere | SYEMITDEPKHYETYQNMSLGSNGVDWVRSLRKILT |
Ga0182199_11353551 | 3300017412 | Switchgrass Phyllosphere | SYETITDEPKHYETYQNMSLGSNRVDWVRLLQKIPT |
Ga0182199_11372331 | 3300017412 | Switchgrass Phyllosphere | VHPVLRRDSCSHETIENAPKHYETHQNMSLGSNGVDQVRSLRKITM |
Ga0182195_10778691 | 3300017414 | Switchgrass Phyllosphere | VSCSYETIPNAPKHYETHQNMSLGSNGVDQVRSLQKVQT |
Ga0182195_11364762 | 3300017414 | Switchgrass Phyllosphere | SCSYEMIPNAPKHYETHQNMSLGSNGVDQVRLLGKITM |
Ga0182195_11366822 | 3300017414 | Switchgrass Phyllosphere | HPVLHRVSCSYEKIPNAPEHYEMHQNMSLESNGLDQLRWLQ |
Ga0182195_12139302 | 3300017414 | Switchgrass Phyllosphere | SYEMIPNAPKHYETHRNMSLGSNRVDQVRLLGKITT |
Ga0182213_10614331 | 3300017421 | Switchgrass Phyllosphere | SYETIPNASQHYATHQNMSLGSNVVDWVHLLKKIPT |
Ga0182196_10544291 | 3300017432 | Switchgrass Phyllosphere | VLQQVSCSYETIPNAPKYYEMHQNISLGSNGVDQVRSLQKITT |
Ga0182196_10655521 | 3300017432 | Switchgrass Phyllosphere | VSRSNEMVPNAPKHYETLQNMSLGSNIMDRVPSLQKIPM |
Ga0182198_10874451 | 3300017445 | Switchgrass Phyllosphere | VSCSYETIPNAPKYYETHQNMSLGSNGAVQVRLLQKITT |
Ga0182216_10922451 | 3300017693 | Switchgrass Phyllosphere | RVSCSYETITDEPKHYETYQNMSLGSNGVDWVRSLQKIPT |
Ga0207697_100292025 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | RVSCSYEKIPNAPEHYEMHQNMSLESNGVDQVRWLRKITT |
Ga0207708_112485111 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LHRVSCSYETITDEPKHYETYQNMSLRSNGVDWVRSLQKIPT |
Ga0207676_118144581 | 3300026095 | Switchgrass Rhizosphere | SNETLPNAPKYYETHQNMSLGSNGVDQVRLLRKIPM |
Ga0268322_10090691 | 3300028049 | Phyllosphere | YETITDEPKHYETYQNMRLGSNGVDWVRSLRKILT |
Ga0268322_10463632 | 3300028049 | Phyllosphere | RSYETIQNAPKHYATHQNMSLGSNGVDRVRSLQKITT |
Ga0268344_10013281 | 3300028051 | Phyllosphere | MNYETLTNAPKHYETHQNMSLGSNGVDQMRLLGKI |
Ga0268344_10143591 | 3300028051 | Phyllosphere | YEMIPNAPKHYETHQNMSLVSNGADQVRWLQKITT |
Ga0268300_10067941 | 3300028052 | Phyllosphere | MIENAPKHYKTHQNMSLGSNGVDQVRSLRKITMXLR |
Ga0268300_10094991 | 3300028052 | Phyllosphere | VLHRVSCSYETIPNAPEHYATHQNMSLGSNGVDWVRS |
Ga0268346_10155861 | 3300028053 | Phyllosphere | TVLHRVSCSYETITNAPKHNETYENMSLGSNGVDWVRSLRKIPS |
Ga0268346_10307641 | 3300028053 | Phyllosphere | MVPNAPKQYETHQNVSLWSNGVDQVRLLRKIPMRLRGTNF |
Ga0268338_10159081 | 3300028055 | Phyllosphere | SYEMIPNAPKHYETHQNMSLGSNGVDQVRLLGKITT |
Ga0268330_10527071 | 3300028056 | Phyllosphere | SNETLPNAPKHYETHQNMSLWSNGVDRVRSLRKILM |
Ga0268332_10377321 | 3300028058 | Phyllosphere | HRVSCTNKMVQNAPKHYEMHQNMSLRSDGVDRVDLLQKI |
Ga0268314_10309532 | 3300028061 | Phyllosphere | ANQTVPSARKYYKTHQNVSLGYNGVDRVRSLRKIPT |
Ga0268314_10357101 | 3300028061 | Phyllosphere | CSYETIPNAPKHYERLQNMSLGSNGLDQVRLLGKITT |
Ga0268340_10278991 | 3300028064 | Phyllosphere | VSCSYETITNASKHYETYENMSLGSVGVDWVHSLQKIPK |
Ga0268340_10579221 | 3300028064 | Phyllosphere | SYETIPNAPKHYETHQNMSLGSNGVDQVRSLRNITM |
Ga0268355_10058041 | 3300028139 | Phyllosphere | YEMIPNAPKHYAMHQNMSLKSKGVDWVRSVQKIPT |
Ga0268334_10042681 | 3300028140 | Phyllosphere | QYVLHQVSCSYETIPNAPKHYETHQNMSLGSNGVDQVH |
Ga0268347_10062291 | 3300028142 | Phyllosphere | SYEMIPNAPKHYERHQNMSLGSNGVDQVCLLGKITM |
Ga0268347_10109041 | 3300028142 | Phyllosphere | ILHRVSCGYETIPNAPKHYEMHQNMSLGSNGVDWVRS |
Ga0268348_10079601 | 3300028143 | Phyllosphere | SYETIPDAPEHYERLQNISLGSNGVDQVCLFGKITT |
Ga0268354_10225381 | 3300028148 | Phyllosphere | PVQSILHQVSCGYEMIPNAPKHYETHQNMSLGSNGVDQVHLLGKITT |
Ga0268308_10039502 | 3300028151 | Phyllosphere | LHPVLHRVSCSYEKIPNAPEHYEMHQNMSLESNGLDQLRWLQ |
Ga0268308_10156401 | 3300028151 | Phyllosphere | ILHRVSYSCEMIPNAPKHYATQENMSLGSNGVDWVRS |
Ga0268336_10124801 | 3300028152 | Phyllosphere | GYETIPNAPKHYATHQNMILESNGVDWVRSLQKIPT |
Ga0268316_10020121 | 3300028253 | Phyllosphere | HRVSCSYETIENAPKQYETHQNMSLGSNGVDQVRLLGKITT |
Ga0268265_117818782 | 3300028380 | Switchgrass Rhizosphere | PALHRLSCSNKIIQNAPEHYEMHQIMSLGSNGVDRVRSL |
Ga0268302_1040351 | 3300028464 | Phyllosphere | YETIRNAPKHNETYENMSLGSNGVDWVRSLRKIAS |
Ga0268301_1052171 | 3300028465 | Phyllosphere | YEMIPNASKHYETHQNMSLGSNGVDQMRSLQKITT |
Ga0268317_10016151 | 3300028468 | Phyllosphere | HPVLHRVSCSYEKIPNAPEHYEMHQNMSLDSNGLDQLRWLQ |
Ga0268317_10051421 | 3300028468 | Phyllosphere | RVSCSYETITDEPKHYETYQNMSLGSNGADSVRSLRKIQT |
Ga0268337_10150362 | 3300028469 | Phyllosphere | VLRRVSYIYETIENASKHYETHQNMSLGSNGVDQVRSLRKITM |
Ga0268307_10080001 | 3300028470 | Phyllosphere | SKMIPNAPKHNETHQNMSLEYNGVDQVLLFRKNTT |
Ga0268307_10177342 | 3300028470 | Phyllosphere | SCSHETIENAPKHYETHQNMSLGSNGVDQVRSLRKITM |
Ga0268323_10190691 | 3300028471 | Phyllosphere | HKVSSSNEMIPNAPKHYEPDQNMGLGSNGVDRVRSL |
Ga0268315_10107051 | 3300028472 | Phyllosphere | MIPNAPKHYETHQNMSLGSNGVDQVCLLGKFTTXFRGTNF |
Ga0268315_10239871 | 3300028472 | Phyllosphere | VLHRVSSSYEKIPNAPEHYEMHQNMSLGSNLVDLVRWLRKITT |
Ga0268319_10065291 | 3300028473 | Phyllosphere | LHTVLHRVSCSYEKIPNAPEHYEMHQNMSLGSNGVDQVR |
Ga0268319_10092292 | 3300028473 | Phyllosphere | VPRTFALIVPLHPVLHRVSCSYEKIPNAPEHYEMHQNMSLDSNGLDQLRWLQ |
Ga0268331_10134301 | 3300028474 | Phyllosphere | RVSCSYETITNAPKHYETYENMSLGSNGVDWVRSL |
Ga0268327_10010792 | 3300028475 | Phyllosphere | ALIAPLHPVLHRVSCSYEKIPNAPEHYEMHQNMSLDSNGLDQLRWLQ |
Ga0268327_10247061 | 3300028475 | Phyllosphere | NGTLTNTPKHYEMHKNMSLGSNGVDWVRSLRKIPM |
Ga0268329_10159241 | 3300028476 | Phyllosphere | CSYEMIPNAPKHYETHLNKSLGSNGVDQVRLLRKITT |
Ga0268313_10125281 | 3300028523 | Phyllosphere | CSYETIIDEPKHYETYQNMCLGSNGVDWVCSLRKIPK |
Ga0268339_10032041 | 3300028526 | Phyllosphere | LHRVSCSYETITNAPKNNETYENMSLGSNGVDWVRSLRKIAS |
Ga0214497_11271411 | 3300032689 | Switchgrass Phyllosphere | VSCSHKTITNAPKHSEAYENISLGSNGVDWVGSLR |
Ga0214499_11379001 | 3300032697 | Switchgrass Phyllosphere | QVLCNSETVLNAPKRKETKQNMSLGSNGVDQVRLLGKIRT |
⦗Top⦘ |