NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044765

Metagenome / Metatranscriptome Family F044765

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044765
Family Type Metagenome / Metatranscriptome
Number of Sequences 154
Average Sequence Length 42 residues
Representative Sequence IRGEIIEYLDTGKVLAKDVEDEDIMFARPGPTVEYWEGED
Number of Associated Samples 132
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 87.66 %
% of genes from short scaffolds (< 2000 bps) 94.81 %
Associated GOLD sequencing projects 130
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.260 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(24.026 % of family members)
Environment Ontology (ENVO) Unclassified
(24.026 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.649 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 17.65%    Coil/Unstructured: 82.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 154 Family Scaffolds
PF07883Cupin_2 6.49
PF00583Acetyltransf_1 2.60
PF07228SpoIIE 2.60
PF12680SnoaL_2 1.95
PF00578AhpC-TSA 1.95
PF01872RibD_C 1.95
PF00171Aldedh 1.30
PF13238AAA_18 1.30
PF12697Abhydrolase_6 1.30
PF07676PD40 1.30
PF13302Acetyltransf_3 1.30
PF01828Peptidase_A4 1.30
PF12857TOBE_3 1.30
PF03795YCII 1.30
PF03575Peptidase_S51 0.65
PF12681Glyoxalase_2 0.65
PF13745Obsolete Pfam Family 0.65
PF13632Glyco_trans_2_3 0.65
PF00484Pro_CA 0.65
PF13649Methyltransf_25 0.65
PF13240zinc_ribbon_2 0.65
PF00857Isochorismatase 0.65
PF10604Polyketide_cyc2 0.65
PF00800PDT 0.65
PF02867Ribonuc_red_lgC 0.65
PF07366SnoaL 0.65
PF00561Abhydrolase_1 0.65
PF05988DUF899 0.65
PF00248Aldo_ket_red 0.65
PF01883FeS_assembly_P 0.65
PF07931CPT 0.65
PF00211Guanylate_cyc 0.65
PF05147LANC_like 0.65
PF01980TrmO 0.65
PF13177DNA_pol3_delta2 0.65
PF01609DDE_Tnp_1 0.65
PF00892EamA 0.65
PF00903Glyoxalase 0.65
PF05977MFS_3 0.65
PF13847Methyltransf_31 0.65
PF06224HTH_42 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 154 Family Scaffolds
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 1.95
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 1.95
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 1.30
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 1.30
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 1.30
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 1.30
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.65
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.65
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.65
COG5421TransposaseMobilome: prophages, transposons [X] 0.65
COG4403Lantibiotic modifying enzymeDefense mechanisms [V] 0.65
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.65
COG3896Chloramphenicol 3-O-phosphotransferaseDefense mechanisms [V] 0.65
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.65
COG3293TransposaseMobilome: prophages, transposons [X] 0.65
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 0.65
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.65
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.65
COG1720tRNA (Thr-GGU) A37 N6-methylaseTranslation, ribosomal structure and biogenesis [J] 0.65
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.65
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.65
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 0.65
COG0209Ribonucleotide reductase alpha subunitNucleotide transport and metabolism [F] 0.65
COG0077Prephenate dehydrataseAmino acid transport and metabolism [E] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.91 %
UnclassifiedrootN/A9.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309009|GPKNP_GG3DY5401EN56KAll Organisms → cellular organisms → Bacteria509Open in IMG/M
2170459016|G1P06HT02F47WLAll Organisms → cellular organisms → Bacteria558Open in IMG/M
3300000858|JGI10213J12805_10035062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_121240Open in IMG/M
3300000891|JGI10214J12806_10415598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria595Open in IMG/M
3300000891|JGI10214J12806_12516524All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300000955|JGI1027J12803_103505867All Organisms → cellular organisms → Archaea835Open in IMG/M
3300000955|JGI1027J12803_108248963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales735Open in IMG/M
3300001978|JGI24747J21853_1017868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300004114|Ga0062593_100551098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1085Open in IMG/M
3300004114|Ga0062593_103062828All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300004153|Ga0063455_100697131All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300004156|Ga0062589_101309188All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300004157|Ga0062590_100504852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1032Open in IMG/M
3300004157|Ga0062590_102347311All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300004480|Ga0062592_102194697All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300004643|Ga0062591_100708350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria912Open in IMG/M
3300005336|Ga0070680_100820420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300005341|Ga0070691_10686763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. PRF04-17613Open in IMG/M
3300005356|Ga0070674_100386666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1140Open in IMG/M
3300005441|Ga0070700_100730005All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300005468|Ga0070707_102075682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300005526|Ga0073909_10254454All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300005539|Ga0068853_102046339All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005558|Ga0066698_10675279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Paenarthrobacter → unclassified Paenarthrobacter → Paenarthrobacter sp. DKR-5685Open in IMG/M
3300005718|Ga0068866_11109951Not Available567Open in IMG/M
3300005719|Ga0068861_100138268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1985Open in IMG/M
3300005937|Ga0081455_10221713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1401Open in IMG/M
3300006028|Ga0070717_10697754All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300006031|Ga0066651_10307602All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300006163|Ga0070715_10180528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1058Open in IMG/M
3300006169|Ga0082029_1440634All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300006572|Ga0074051_11782187All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300006845|Ga0075421_102196111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300006852|Ga0075433_10566878All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300006871|Ga0075434_100569189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1152Open in IMG/M
3300006876|Ga0079217_10847167All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300006880|Ga0075429_101355781All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300006903|Ga0075426_10137774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1758Open in IMG/M
3300006904|Ga0075424_102833221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → unclassified Mycolicibacterium → Mycolicibacterium sp. CBMA 234505Open in IMG/M
3300006969|Ga0075419_11441634All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300007004|Ga0079218_11440818All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300009078|Ga0105106_10898877All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300009093|Ga0105240_11591608All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300009098|Ga0105245_12226434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300009100|Ga0075418_10586681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1199Open in IMG/M
3300009147|Ga0114129_12161301All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300009156|Ga0111538_10655846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia rhizosphera → Gordonia rhizosphera NBRC 160681330Open in IMG/M
3300009162|Ga0075423_12543772All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300009610|Ga0105340_1211822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria819Open in IMG/M
3300009789|Ga0126307_10189280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1651Open in IMG/M
3300009789|Ga0126307_10412190All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300009837|Ga0105058_1197088Not Available502Open in IMG/M
3300009840|Ga0126313_11333617All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300010038|Ga0126315_10639900Not Available690Open in IMG/M
3300010039|Ga0126309_10266966All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300010040|Ga0126308_11054476All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300010045|Ga0126311_10760739All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300010154|Ga0127503_10361217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium756Open in IMG/M
3300010333|Ga0134080_10037468Not Available1868Open in IMG/M
3300010362|Ga0126377_12282589All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300010362|Ga0126377_13384267All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300010399|Ga0134127_13387826All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300010868|Ga0124844_1299773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300012021|Ga0120192_10006830All Organisms → cellular organisms → Bacteria1601Open in IMG/M
3300012045|Ga0136623_10162397All Organisms → cellular organisms → Bacteria → Proteobacteria966Open in IMG/M
3300012200|Ga0137382_10072695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2209Open in IMG/M
3300012200|Ga0137382_10683567All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300012359|Ga0137385_11074089All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300012360|Ga0137375_11462474All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300012482|Ga0157318_1007024All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300012500|Ga0157314_1006988All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300012530|Ga0136635_10005618All Organisms → cellular organisms → Bacteria3926Open in IMG/M
3300012681|Ga0136613_10011809All Organisms → cellular organisms → Bacteria4931Open in IMG/M
3300012681|Ga0136613_10696017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300012892|Ga0157294_10084773All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300012899|Ga0157299_10333693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia514Open in IMG/M
3300012906|Ga0157295_10113354All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300012951|Ga0164300_10288781All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300012957|Ga0164303_10546280All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300012958|Ga0164299_10284046All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300012958|Ga0164299_11199368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300012960|Ga0164301_11006879All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300012984|Ga0164309_10474724All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300012984|Ga0164309_10675305All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300012984|Ga0164309_10931506All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300012984|Ga0164309_11783884All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300012985|Ga0164308_10628928All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300012987|Ga0164307_11828380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300012988|Ga0164306_10712976All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300012989|Ga0164305_10176392All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300012989|Ga0164305_11715929All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300013307|Ga0157372_12411020All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300013503|Ga0120127_10104850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300013772|Ga0120158_10097209All Organisms → cellular organisms → Bacteria1783Open in IMG/M
3300014150|Ga0134081_10213654Not Available660Open in IMG/M
3300014267|Ga0075313_1086170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium765Open in IMG/M
3300014324|Ga0075352_1189975All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300014969|Ga0157376_12017207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → Nitriliruptoraceae → Nitriliruptor → unclassified Nitriliruptor → Nitriliruptor sp.615Open in IMG/M
3300015077|Ga0173483_10853208All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300015359|Ga0134085_10273045All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300015371|Ga0132258_11634140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1626Open in IMG/M
3300015371|Ga0132258_12208645All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300015371|Ga0132258_13280301Not Available1114Open in IMG/M
3300015371|Ga0132258_13376554All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300015372|Ga0132256_101965903Not Available691Open in IMG/M
3300017654|Ga0134069_1373002Not Available514Open in IMG/M
3300018073|Ga0184624_10068383Not Available1474Open in IMG/M
3300018074|Ga0184640_10518220All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300018422|Ga0190265_11426288All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300018422|Ga0190265_12754478All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300018432|Ga0190275_11352343Not Available789Open in IMG/M
3300018469|Ga0190270_10293530All Organisms → cellular organisms → Bacteria1444Open in IMG/M
3300018481|Ga0190271_12256966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora650Open in IMG/M
3300018482|Ga0066669_10098303All Organisms → cellular organisms → Bacteria2025Open in IMG/M
3300020022|Ga0193733_1152145All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300021082|Ga0210380_10544581All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300025791|Ga0210115_1020156All Organisms → cellular organisms → Bacteria1515Open in IMG/M
3300025791|Ga0210115_1033480All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300025906|Ga0207699_11026937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300025919|Ga0207657_10410069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1065Open in IMG/M
3300025922|Ga0207646_11794606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300025935|Ga0207709_10193855All Organisms → cellular organisms → Bacteria1446Open in IMG/M
3300025935|Ga0207709_10808953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium757Open in IMG/M
3300025935|Ga0207709_11409154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300025945|Ga0207679_10356013All Organisms → cellular organisms → Bacteria1277Open in IMG/M
3300026023|Ga0207677_11216934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium690Open in IMG/M
3300026121|Ga0207683_11056120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia754Open in IMG/M
3300026142|Ga0207698_12014481Not Available591Open in IMG/M
3300027163|Ga0209878_1041592All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300027560|Ga0207981_1070399All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300027561|Ga0209887_1000698All Organisms → cellular organisms → Bacteria10258Open in IMG/M
3300027821|Ga0209811_10365090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300028705|Ga0307276_10000397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5410Open in IMG/M
3300028713|Ga0307303_10080193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Paenarthrobacter → unclassified Paenarthrobacter → Paenarthrobacter sp. DKR-5727Open in IMG/M
3300028718|Ga0307307_10010623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2442Open in IMG/M
3300028721|Ga0307315_10050825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1153Open in IMG/M
3300028754|Ga0307297_10376805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300028784|Ga0307282_10274042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium812Open in IMG/M
3300028787|Ga0307323_10317020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300028872|Ga0307314_10124424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium725Open in IMG/M
3300028881|Ga0307277_10055689All Organisms → cellular organisms → Bacteria1618Open in IMG/M
3300028881|Ga0307277_10182788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Paenarthrobacter → unclassified Paenarthrobacter → Paenarthrobacter sp. DKR-5916Open in IMG/M
3300028881|Ga0307277_10535182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300030513|Ga0268242_1129365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300030606|Ga0299906_10966484All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300031099|Ga0308181_1066053Not Available720Open in IMG/M
3300031754|Ga0307475_10373435All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300032017|Ga0310899_10551099All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300032177|Ga0315276_11716030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium648Open in IMG/M
3300034147|Ga0364925_0320896All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300034149|Ga0364929_0006517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3099Open in IMG/M
3300034165|Ga0364942_0116915Not Available865Open in IMG/M
3300034176|Ga0364931_0203524Not Available646Open in IMG/M
3300034818|Ga0373950_0082402All Organisms → cellular organisms → Bacteria673Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil24.03%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.19%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.55%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.60%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.60%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.60%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.95%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.95%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.30%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.30%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.30%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.30%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.30%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.30%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.30%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.30%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.30%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.30%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.65%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.65%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.65%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.65%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.65%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.65%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.65%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.65%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309009Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001978Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300012021Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1EnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012482Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510Host-AssociatedOpen in IMG/M
3300012500Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610Host-AssociatedOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012681Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300025791Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027163Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027560Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)EnvironmentalOpen in IMG/M
3300027561Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030513Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2)EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPKNP_037097202070309009SoilIRGEIIEYLDTGKVLAKDVEDENIMFARPGPTVEYWEGED
2ZMR_012844102170459016Switchgrass, Maize And Mischanthus LitterMLSSMIPGEIIEYLDTGKVLAKDVEDEDIVFARPGPTVEFWEGEE
JGI10213J12805_1003506213300000858SoilGEIIEYLDTGKVLAKDVEDEDIMFARPGPTAEYWEGEY*
JGI10214J12806_1041559823300000891SoilGEIIEYLDTGKVLAKDVDDEDVMFARPGPEVEYWEGED*
JGI10214J12806_1251652413300000891SoilGEIIEYLDTGKILAKDVEDEDVMFARPGPTAEYWEGED*
JGI1027J12803_10350586733300000955SoilSMIRGEIIEYLDTGKVLAKDVEDEDIMFARPGPTAEYWEGEE*
JGI1027J12803_10824896313300000955SoilEYLDTGKVLAKDVEDENIVFARPGPTVEFWEGEE*
JGI24747J21853_101786823300001978Corn, Switchgrass And Miscanthus RhizosphereRGEVIEYLDTGKVLAKDFADEDIMFARPGPTIEFWEGED*
Ga0062593_10055109823300004114SoilRVLMLSSMIRGEIIEYLDTGKVLAKDVEDEDIMFARPGPRVEYWEGED*
Ga0062593_10306282813300004114SoilMIGGEIIEYLDTGKVLAKDAQDEDIMFARPGPTPEYWEGED*
Ga0063455_10069713123300004153SoilSMIRGEIIEYVDTGKILAKGVEDEDIMFARPGPAVEFWEGED*
Ga0062589_10130918823300004156SoilSMIGGEIIEYLDTGKILAKGVDDEDVMFARPGPAVEYWEGED*
Ga0062590_10050485213300004157SoilSMIGGEIIEYLDTGKVLAKGAEDEDIMFARPGPTAEFWEGED*
Ga0062590_10234731113300004157SoilMLSSMIPGEIIEYLDSGKVLAKDIEDEDIVFARPGPTVEFWEGEE*
Ga0062592_10219469713300004480SoilLMLSSMIRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED*
Ga0062591_10070835033300004643SoilSMIGGEIIEYLDTGKVLAKDAEDEDIMFARPGPTAEFWEGED*
Ga0070680_10082042013300005336Corn RhizosphereRVLMLSSMIRGEIIEYLDTGKVLTKDVEDEDIMFARPGPTVEYWEGED*
Ga0070691_1068676323300005341Corn, Switchgrass And Miscanthus RhizosphereVLMLSSMIRGEVIEYLDTGKVLAKDFADEDIMFARPGPTIEFWEGED*
Ga0070674_10038666613300005356Miscanthus RhizosphereRVLMLSSMIRGEIIEYLDTGKLLAKDVEDEDIMFARPGPTVEYWEGED*
Ga0070700_10073000533300005441Corn, Switchgrass And Miscanthus RhizosphereVLMLSSMIRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED*
Ga0070707_10207568213300005468Corn, Switchgrass And Miscanthus RhizosphereLSSMIRGEVIEYLDTGKVLAKDFADEDIMFARPGPTIEFWEGED*
Ga0073909_1025445423300005526Surface SoilLDTGKVLAKDAEAEDILFARPGPTVEYWEGEDGR*
Ga0068853_10204633923300005539Corn RhizosphereSMSPGEVIEYLDTGKVLAKDAKDDDIMFARPGPAVEYWEDEE*
Ga0066698_1067527913300005558SoilEVIEYLDTGKILAKDAQDEDVMFARPGPAVEYWEGEQ*
Ga0068866_1110995113300005718Miscanthus RhizosphereGEIIEYLDTGKVLAKDVGDEDIMFARPGPTAEYWEGEE*
Ga0068861_10013826833300005719Switchgrass RhizosphereEYLDTGKVLAKDFADEDIMFARPGPTIEFWEGED*
Ga0081455_1022171313300005937Tabebuia Heterophylla RhizosphereRVLMLSSMVPGEVIEYLDTGKILAKGAEDEDIMFARPGPDVEYWEGET*
Ga0070717_1069775433300006028Corn, Switchgrass And Miscanthus RhizosphereIEYLDTGKVLAKGVKDEDIMFTRPGPTPDYWEGEE*
Ga0066651_1030760213300006031SoilRVLMLSSMIPGEIIEYLDTGKVLAKGVDDEDIMFAQPGPDADFWGGEE*
Ga0070715_1018052813300006163Corn, Switchgrass And Miscanthus RhizosphereIEYLDTGKVLAKDVEDEDIMFARPGPTIEFWEGED*
Ga0082029_144063423300006169Termite NestMLSSMIPGEIIEYIDTGKVLAKGAEDEDIMFARPGPTAEFWEGED*
Ga0074051_1178218713300006572SoilLMLSSMIRGEIIEYLDTGKVLAKDVEDEDIMFAKPGPTAEYWEGED*
Ga0075421_10219611113300006845Populus RhizosphereLMLSSMIRGEIIEYLDTGKVLAKGVDDEDVMFARPGPAVEYWEGED*
Ga0075433_1056687813300006852Populus RhizosphereLMLSSMIRGEIIEYLDTGKVLAKDIEDEDVMFARPGPEVEYWEGED*
Ga0075434_10056918913300006871Populus RhizosphereIEYLDTGKVLAKGVEDEDIMFARPGPTPEYWEGED*
Ga0079217_1084716713300006876Agricultural SoilGEIIEYLDTGKVLAKDAQDEDIMFARPGPTAEYWEGED*
Ga0075429_10135578123300006880Populus RhizospherePGEIIEYLDTGKVLAKDVEDEDIVFARPGPTAEYWEGEE*
Ga0075426_1013777433300006903Populus RhizosphereEYLDTGKVLAKDIDDEDVMFARPGPEVEYWEGED*
Ga0075424_10283322113300006904Populus RhizosphereLMLSSMIRGEIIEYLDTGKVLAKDVEDEDIMFARPGPTVEYWEGED*
Ga0075419_1144163423300006969Populus RhizospherePVRVLMLSSMVRGEIIEYLDTGKVFAGVDDEDVMFARPGPAVEYWEGED*
Ga0079218_1144081813300007004Agricultural SoilMLSSTIPGEIIEYLDTGKVLAKDAQDEDVMFARPGPTAEYWEGED*
Ga0105106_1089887713300009078Freshwater SedimentVLMLSSMIRGEIIEYLDTGKVLAKDVEDEDIMFARPGPAVEYWEGED*
Ga0105240_1159160813300009093Corn RhizosphereIPGEVIEYLDTGKILAKDAKDDDIMFARPGPAVEYWEDEE*
Ga0105245_1222643423300009098Miscanthus RhizosphereMLSSMTRGEIIEYLDTGKVLAKGVDDEDIMFARPGPAVEYWEGEE*
Ga0075418_1058668113300009100Populus RhizosphereIEYLDTGKVLAKDVDDEDVMFARPGPPVEYWEGED*
Ga0114129_1216130123300009147Populus RhizosphereEIIEYLDTGKVLAKGVDDEDVMFARPGPDVEYWADED*
Ga0111538_1065584613300009156Populus RhizosphereMLSSMVRGEIIEYLDTGKILAKDVEDEDVMFARPGPTAEYWEGED*
Ga0075423_1254377223300009162Populus RhizosphereMLSSMISSEIIEYLDTGKVLAKVSEEEDIMFARPGPTAEYWEGED*
Ga0105340_121182233300009610SoilEYLDTGKVLAKGVEDEDIMFAKPGPTAEFWEGEA*
Ga0126307_1018928063300009789Serpentine SoilSMVNGEIIEYLDTGKILAKVVEDEDIMFAKPGPTAEYWEGEE*
Ga0126307_1041219023300009789Serpentine SoilMLSSMIPGEIIEYLDTGKVLAKDAQDEDVMFARPGPTAEYWEGED*
Ga0105058_119708813300009837Groundwater SandIIEYLDTGKVLAKGIEDEDIMFARPGPTVEYWEGED*
Ga0126313_1133361713300009840Serpentine SoilRVLMLSSMIPGEIIEYLDTGKLLAKDVEDEDIVFARPGPTVEYWEGEE*
Ga0126315_1063990023300010038Serpentine SoilIIEYPDTGKVLAKDVEDEDIVFARPGPTVEFWEGEE*
Ga0126309_1026696623300010039Serpentine SoilSSMIRGEIIEYLDTGKVLAKDAQDEDIMFARPGPTAEYWEGEN*
Ga0126308_1105447613300010040Serpentine SoilMLSSMIRGEIIEYLDTGKVLAKDAQDEDIMFARPGPTAEYWEGENSLRATLSIDGPP
Ga0126311_1076073923300010045Serpentine SoilMLSSMIRGEIIQYLDSGKILAKSVEDEDIVFARPGPTVEYWEGEE*
Ga0127503_1036121713300010154SoilLMLSSMTPGEVIEYLDTGKVLAKDAKDDDIMFARPGPAVEYWEDEE*
Ga0134080_1003746813300010333Grasslands SoilLEYLDTGKILADGVGGEHIMFSRPGPVADYWEGED*
Ga0126377_1228258923300010362Tropical Forest SoilSSMIPGEVIEYLDTGKILAKGAEDEDIMFARPGPEAEYWEGEE*
Ga0126377_1338426713300010362Tropical Forest SoilMLSSMIRGDIIEYLDTGKVLAKGVDDEDVMFARPGPTAEYWEGEE*
Ga0134127_1338782613300010399Terrestrial SoilVLMLSSMIRGEIIEYLDTGKVLAKDVEDEDIMFAKPGPASEYWEGED*
Ga0124844_129977323300010868Tropical Forest SoilLSSMNPGEVIEYLDTGKVLAKDAKDEDILFARPGPAVEYWEDEE*
Ga0120192_1000683043300012021TerrestrialGGEPTEYLDTGKVLAKSVEDEDVMFARPGPTVEYWEGED*
Ga0136623_1016239713300012045Polar Desert SandGEIIEYLDTGKVLAKGNEDEDIMFARPGPTADYWEGEE*
Ga0137382_1007269553300012200Vadose Zone SoilRVLMLSSMIRGEITEYLDTGKILAKDAADEDIMFARPGPTPEYWEGED*
Ga0137382_1068356733300012200Vadose Zone SoilLSSMTAGEVIEYLDTGKVLAKDAKDDDIMFARPSPAVEYWEDEE*
Ga0137385_1107408923300012359Vadose Zone SoilMLSSMIRGEIIEYLDTGKVLAKDAQDEDVMFARPGPAVEYWEGEE*
Ga0137375_1146247413300012360Vadose Zone SoilTPGEVIEYLDTGKVLAKDAKDADIMFARPGPAVEYWEDEE*
Ga0157318_100702413300012482Arabidopsis RhizosphereIEYLDTGKVLAKDHEDEDIMFAKPGPTVEYWEGED*
Ga0157314_100698823300012500Arabidopsis RhizosphereEYLDTGKVLAKDVEDENIMFARPGPTVEYWEGED*
Ga0136635_1000561843300012530Polar Desert SandMLSSMIRGEIIEYLDTGKVLAKDVEDEDIMFARPGPPVEYWEGEN*
Ga0136613_1001180993300012681Polar Desert SandEYLDTGKVLAKGVEDEDVMFARPGPTVEYWEGED*
Ga0136613_1069601723300012681Polar Desert SandVLMLSSMIRGEIIEYLDTGKVLAKGVEDEDVMFARPGPAVEYWEGED*
Ga0157294_1008477313300012892SoilSMIRGEVIEYLDTGKILAKDVEDEDIMFARPGPAVEYWEGED*
Ga0157299_1033369323300012899SoilRGEVIEYLDTGKILAKDVEDEDIMFARPGPAVEYWEGED*
Ga0157295_1011335433300012906SoilSMIRGEIIEYLDTGKILAKDVDDEDVVFARPGPMAEYWEGEQ*
Ga0164300_1028878123300012951SoilLSSMMRGEIIEYLDTGKVLAKDVEDEDILFARPGPTVEYWEGED*
Ga0164303_1054628023300012957SoilGEIIEYLDTGKVLAKDVEDEDILFARPGPTVEYWEGED*
Ga0164299_1028404613300012958SoilGEIIEYLDTGKVLAKDIEDEDVMFARHGPAVEYWESED*
Ga0164299_1119936813300012958SoilLMLSSTIRGEIIEYLDTGKVLAKDVEDEDIMFVRPGPTVEYWEGED*
Ga0164301_1100687923300012960SoilEVIEYLDTGKVLAKDAKDDDIMFAKPGPAAEYWEDEE*
Ga0164309_1047472433300012984SoilPGEVIEYLDTGKVLAKDAKDDDIMFARPGPAVEYWEDEE*
Ga0164309_1067530523300012984SoilMLSSMIGGEIIEYLDTGKVLAKDVEDEDILFARPGPTVEYWEGED*
Ga0164309_1093150613300012984SoilRVLMLSSMIRGEVIEYLDTGKVLAKDVEDEDIMFARPGPTIEFWEGED*
Ga0164309_1178388423300012984SoilVLMLSSMTPGEVIEYLDTGKVLAKDAKDDDIMFAKPGPAVEYWEDEE*
Ga0164308_1062892823300012985SoilRVLMLSSMIGGEIIEYLDTGKVLAKGAEDEDIMFARPGPSAEFWEGED*
Ga0164307_1182838013300012987SoilIEYLDTGKVLAKGAQDDDIMFAKRGGDAEYWEGEE*
Ga0164306_1071297623300012988SoilEYLDTGKVLAKDAKDDDIMFARPGPAVEYWEDEE*
Ga0164305_1017639233300012989SoilGGDIVEYLDTGKVLAKDAQDEDIMFARPGPTAEFWEGEN*
Ga0164305_1171592923300012989SoilRVLMLSSMIPGEIIEYLDSGKVLAKDVEDEDIAFARPGPTVEFWEGEE*
Ga0157372_1241102023300013307Corn RhizosphereMVEVDTVEYLDTGKVSATSVGDEPIMFARPGPTAEYWEGED*
Ga0120127_1010485023300013503PermafrostLMLSSMIPGEIIEFLDTGKVLAKGVEDDDIMFARPGPTVEYWEGED*
Ga0120158_1009720933300013772PermafrostIRGEVIEYLDTGKVLAKDVEDEDIMFARPGPTIEFWEGED*
Ga0134081_1021365413300014150Grasslands SoilEYLDTGKVLAKDVEDEDIVFARPGPTVEYWEGEE*
Ga0075313_108617013300014267Natural And Restored WetlandsVRVLMLSSMIRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED*
Ga0075352_118997513300014324Natural And Restored WetlandsRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED*
Ga0157376_1201720713300014969Miscanthus RhizosphereMIRGEVIEYLDTGKVLAKDVEDEDIMFARPGPTIEFWDGED*
Ga0173483_1085320823300015077SoilLSSMIRGEIIEYLDTGKILAKDVDDEDVVFARPGPTADYWEGEE*
Ga0134085_1027304533300015359Grasslands SoilMLSSMVPGEIIEYLDTGKVLAKDVEDEDIVFARPGPTVEYWEGEE*
Ga0132258_1163414033300015371Arabidopsis RhizosphereSSMIPGEIIEYLDTGKVLAKDVEDEDILFARPGPTVEYWEGED*
Ga0132258_1220864543300015371Arabidopsis RhizosphereRVLMLSSMNRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED*
Ga0132258_1328030123300015371Arabidopsis RhizosphereVIEYLDTGKILAKDAEDEDIMFAKPGPAVEYWQDED*
Ga0132258_1337655433300015371Arabidopsis RhizosphereSMIRGEIIEYLDTGKVLAKDIEDEDVMFARPGPEVEYWEGED*
Ga0132256_10196590333300015372Arabidopsis RhizosphereSSMTPGEVIEYLDTGKVLAKDAKDDDIMFARPGPAVEYWEDEE*
Ga0134069_137300223300017654Grasslands SoilMLSSMVPGEIIEYLYTGKVLAKDVEDEDIVFARPGPTVEYWEGEE
Ga0184624_1006838323300018073Groundwater SedimentGEIIEYLDTGKVLAKGVDDEDVMFARPGPAVEYWEDED
Ga0184640_1051822023300018074Groundwater SedimentMLSSMNRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED
Ga0190265_1142628823300018422SoilGEIIEYLDTGKVLAKDAQDEDIIFARPGPTAEYWEGED
Ga0190265_1275447813300018422SoilLMLSSMIRGEIIEYLDTGKVLAKDVEDEDIMFARPGPPVEYWEGEN
Ga0190275_1135234313300018432SoilSMISGEVIEYLDTGKVLAKGVDDEDIVFARPGPPVEYWEGED
Ga0190270_1029353043300018469SoilVRVLMLSSMIRGEIIEYLDTGKVLAKGVDDEDVVFARPGPAVEYWEGED
Ga0190271_1225696623300018481SoilLMLSSMIRGEIIEYLDTGKVLAKDVEDEDVMFARPGPTAEYWEGEE
Ga0066669_1009830333300018482Grasslands SoilMLSSMIPGEIIEYLDTGKVLAKDVEDEDIVFARPGPTVEYWEGEE
Ga0193733_115214523300020022SoilEIIEYLDTGKVLAKDVEDEDIVFARPGPTVEFWEGEE
Ga0210380_1054458113300021082Groundwater SedimentSSMVPGEIIEYLDTGKVLAKGVDDEDVLFARPGPAVEYWEDED
Ga0210115_102015613300025791Natural And Restored WetlandsSMIRGEIIEYLDTGKILAKDVDDEDVVFARPGPTADYWEGEE
Ga0210115_103348033300025791Natural And Restored WetlandsMIRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED
Ga0207699_1102693713300025906Corn, Switchgrass And Miscanthus RhizosphereLSSMISSEIIEYLDTGKVLAKVSEEEDIMFARPGPTAEYWEGED
Ga0207657_1041006913300025919Corn RhizosphereTVEYLDTGKVSATSVGDEPIMFARPGPTAEYWEGED
Ga0207646_1179460613300025922Corn, Switchgrass And Miscanthus RhizosphereIEYLDTGKVYAASVGGEPIVLARPGPTVEYWEGEQ
Ga0207709_1019385533300025935Miscanthus RhizosphereIRGEIIEYLDTGKVLAKDVEDEDIMFARPGPTVEYWEGED
Ga0207709_1080895313300025935Miscanthus RhizosphereLMLSSMIGGEIIEYLDTGKVLAKGFEDEDIMFARPGPTVEYWEGED
Ga0207709_1140915423300025935Miscanthus RhizosphereSSMIGGEIIEYLDTGKVLAKGAQDEDIMFARPGPTAEFWEGED
Ga0207679_1035601313300025945Corn RhizosphereIRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED
Ga0207677_1121693413300026023Miscanthus RhizosphereRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED
Ga0207683_1105612023300026121Miscanthus RhizosphereGEVIEYLDTGKVLAKDVEDEDIMFARPGPAIDFWEGED
Ga0207698_1201448113300026142Corn RhizosphereMLSSMIPGEIIEYLDTGKVLAKDVDDEDVMFARPGPSVEYWEGED
Ga0209878_104159223300027163Groundwater SandIEYLDTGKVLAKGIEDEDIMFARPGPTVEYWEGED
Ga0207981_107039913300027560SoilMIGGEIIEYLDTGKVLAKDARDEDIMFAQPGPTAEFWEGED
Ga0209887_100069823300027561Groundwater SandMLSSMIRGEIIEYLDTGKVLAKGIEDEDIMFARPGPTVEYWEGED
Ga0209811_1036509013300027821Surface SoilMIRGEIIEYLDTGKVLAKDAEDEDILFARPGPTVEYWEGED
Ga0307276_1000039763300028705SoilSSMIDGDIIEYLDTGKVLAQSPSGEQVMFGRPGPKAEYWEGEE
Ga0307303_1008019313300028713SoilPGEIIEYLDTGKVLAKDVEDEDIVFARPGPTVEFWEGEE
Ga0307307_1001062343300028718SoilFIEYLDTGKVLAKDVEDEDIMFARPGPTIEFWEGED
Ga0307315_1005082533300028721SoilIVEYLDTGKVLAKDVEDEDIVFARPGPTVEFWEGEE
Ga0307297_1037680523300028754SoilGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED
Ga0307282_1027404223300028784SoilIIEYLDTGKVLAKGVEDEDIMFARPGPTVEYWEGEDL
Ga0307323_1031702013300028787SoilEIIEYLDTGKVLAKDVEDEDIVFARPGPSVEFWEGEE
Ga0307314_1012442413300028872SoilSMIRGEIIEYLDTGEILAKDSEDEDVMFAKPGAPVEYWEGEE
Ga0307277_1005568913300028881SoilIEYLDTGKVLGDALGGEHIMFSRPGPVADYWEGED
Ga0307277_1018278813300028881SoilVLMLSSMIPGEIIEYLDTGKVLAKDVEDEDIVFARPGPTVEFWEGEE
Ga0307277_1053518213300028881SoilSMIGPDIIEYLDTGKVYATSVADEPIMLARPGPTVEYWEGEE
Ga0268242_112936523300030513SoilMVSSMIDPDTIEYLDTGKVLAKDAAGTDIVFAKPGPVADYWEGES
Ga0299906_1096648423300030606SoilLSSMIRGEIIEYLDTGKLLAKDAQDEDIMFARPGPAVEYWEGED
Ga0308181_106605333300031099SoilGEIIEYLDTGKVLAKDAQDEDIMFARPGPTAEYWEGED
Ga0307475_1037343533300031754Hardwood Forest SoilVLMLSSMIRGEIIEYLDTGKVLAKDARDEDIVFARPGPAVDYWEGEE
Ga0310899_1055109923300032017SoilLMLSSMIGGEIIEYLDTGKVLAKGAEDEDIMFARPGATAEFWEGED
Ga0315276_1171603013300032177SedimentMVPGEIIEYLDTGKVLAKGVDDEDVMFARPGPAVEYWEDED
Ga0364925_0320896_328_4653300034147SedimentMLSSMIRGEIIEYLDTGKVLAKGVEDEDIMFARPGPTAEFWDGEE
Ga0364929_0006517_95_2503300034149SedimentMLSSMIPGEIIEYLDTGKVLAKGVEDEDIMFARPGPDVEFWEGEEELSSSG
Ga0364942_0116915_7_1323300034165SedimentMIRGEIIEYLDTGKVLAKDAQDEDIMFARPGPAVEYWEGED
Ga0364931_0203524_1_1263300034176SedimentMIRGEIIEYLDTGKVLAKDAQDEDIMFARPGPAVEYWEGEE
Ga0373950_0082402_520_6573300034818Rhizosphere SoilMLSSLTLGDIIEYLDTGKVLAKDVEDEDIMFARPGPAVEYWEGED


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.