Basic Information | |
---|---|
Family ID | F044765 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 154 |
Average Sequence Length | 42 residues |
Representative Sequence | IRGEIIEYLDTGKVLAKDVEDEDIMFARPGPTVEYWEGED |
Number of Associated Samples | 132 |
Number of Associated Scaffolds | 154 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 87.66 % |
% of genes from short scaffolds (< 2000 bps) | 94.81 % |
Associated GOLD sequencing projects | 130 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.260 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (24.026 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.026 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.649 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 17.65% Coil/Unstructured: 82.35% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 154 Family Scaffolds |
---|---|---|
PF07883 | Cupin_2 | 6.49 |
PF00583 | Acetyltransf_1 | 2.60 |
PF07228 | SpoIIE | 2.60 |
PF12680 | SnoaL_2 | 1.95 |
PF00578 | AhpC-TSA | 1.95 |
PF01872 | RibD_C | 1.95 |
PF00171 | Aldedh | 1.30 |
PF13238 | AAA_18 | 1.30 |
PF12697 | Abhydrolase_6 | 1.30 |
PF07676 | PD40 | 1.30 |
PF13302 | Acetyltransf_3 | 1.30 |
PF01828 | Peptidase_A4 | 1.30 |
PF12857 | TOBE_3 | 1.30 |
PF03795 | YCII | 1.30 |
PF03575 | Peptidase_S51 | 0.65 |
PF12681 | Glyoxalase_2 | 0.65 |
PF13745 | Obsolete Pfam Family | 0.65 |
PF13632 | Glyco_trans_2_3 | 0.65 |
PF00484 | Pro_CA | 0.65 |
PF13649 | Methyltransf_25 | 0.65 |
PF13240 | zinc_ribbon_2 | 0.65 |
PF00857 | Isochorismatase | 0.65 |
PF10604 | Polyketide_cyc2 | 0.65 |
PF00800 | PDT | 0.65 |
PF02867 | Ribonuc_red_lgC | 0.65 |
PF07366 | SnoaL | 0.65 |
PF00561 | Abhydrolase_1 | 0.65 |
PF05988 | DUF899 | 0.65 |
PF00248 | Aldo_ket_red | 0.65 |
PF01883 | FeS_assembly_P | 0.65 |
PF07931 | CPT | 0.65 |
PF00211 | Guanylate_cyc | 0.65 |
PF05147 | LANC_like | 0.65 |
PF01980 | TrmO | 0.65 |
PF13177 | DNA_pol3_delta2 | 0.65 |
PF01609 | DDE_Tnp_1 | 0.65 |
PF00892 | EamA | 0.65 |
PF00903 | Glyoxalase | 0.65 |
PF05977 | MFS_3 | 0.65 |
PF13847 | Methyltransf_31 | 0.65 |
PF06224 | HTH_42 | 0.65 |
COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
---|---|---|---|
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.95 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.95 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.30 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.30 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.30 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.30 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.65 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.65 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.65 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
COG4403 | Lantibiotic modifying enzyme | Defense mechanisms [V] | 0.65 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.65 |
COG3896 | Chloramphenicol 3-O-phosphotransferase | Defense mechanisms [V] | 0.65 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.65 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.65 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.65 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.65 |
COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 0.65 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.65 |
COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.65 |
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.65 |
COG0077 | Prephenate dehydratase | Amino acid transport and metabolism [E] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.91 % |
Unclassified | root | N/A | 9.09 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2070309009|GPKNP_GG3DY5401EN56K | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
2170459016|G1P06HT02F47WL | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300000858|JGI10213J12805_10035062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12 | 1240 | Open in IMG/M |
3300000891|JGI10214J12806_10415598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
3300000891|JGI10214J12806_12516524 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300000955|JGI1027J12803_103505867 | All Organisms → cellular organisms → Archaea | 835 | Open in IMG/M |
3300000955|JGI1027J12803_108248963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 735 | Open in IMG/M |
3300001978|JGI24747J21853_1017868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
3300004114|Ga0062593_100551098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1085 | Open in IMG/M |
3300004114|Ga0062593_103062828 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300004153|Ga0063455_100697131 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300004156|Ga0062589_101309188 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300004157|Ga0062590_100504852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1032 | Open in IMG/M |
3300004157|Ga0062590_102347311 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300004480|Ga0062592_102194697 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300004643|Ga0062591_100708350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 912 | Open in IMG/M |
3300005336|Ga0070680_100820420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
3300005341|Ga0070691_10686763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. PRF04-17 | 613 | Open in IMG/M |
3300005356|Ga0070674_100386666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1140 | Open in IMG/M |
3300005441|Ga0070700_100730005 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300005468|Ga0070707_102075682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
3300005526|Ga0073909_10254454 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300005539|Ga0068853_102046339 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300005558|Ga0066698_10675279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Paenarthrobacter → unclassified Paenarthrobacter → Paenarthrobacter sp. DKR-5 | 685 | Open in IMG/M |
3300005718|Ga0068866_11109951 | Not Available | 567 | Open in IMG/M |
3300005719|Ga0068861_100138268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1985 | Open in IMG/M |
3300005937|Ga0081455_10221713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1401 | Open in IMG/M |
3300006028|Ga0070717_10697754 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300006031|Ga0066651_10307602 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300006163|Ga0070715_10180528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1058 | Open in IMG/M |
3300006169|Ga0082029_1440634 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300006572|Ga0074051_11782187 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300006845|Ga0075421_102196111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
3300006852|Ga0075433_10566878 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300006871|Ga0075434_100569189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1152 | Open in IMG/M |
3300006876|Ga0079217_10847167 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300006880|Ga0075429_101355781 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300006903|Ga0075426_10137774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1758 | Open in IMG/M |
3300006904|Ga0075424_102833221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → unclassified Mycolicibacterium → Mycolicibacterium sp. CBMA 234 | 505 | Open in IMG/M |
3300006969|Ga0075419_11441634 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300007004|Ga0079218_11440818 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300009078|Ga0105106_10898877 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300009093|Ga0105240_11591608 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300009098|Ga0105245_12226434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
3300009100|Ga0075418_10586681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1199 | Open in IMG/M |
3300009147|Ga0114129_12161301 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300009156|Ga0111538_10655846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia rhizosphera → Gordonia rhizosphera NBRC 16068 | 1330 | Open in IMG/M |
3300009162|Ga0075423_12543772 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300009610|Ga0105340_1211822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
3300009789|Ga0126307_10189280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1651 | Open in IMG/M |
3300009789|Ga0126307_10412190 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300009837|Ga0105058_1197088 | Not Available | 502 | Open in IMG/M |
3300009840|Ga0126313_11333617 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300010038|Ga0126315_10639900 | Not Available | 690 | Open in IMG/M |
3300010039|Ga0126309_10266966 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300010040|Ga0126308_11054476 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300010045|Ga0126311_10760739 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300010154|Ga0127503_10361217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 756 | Open in IMG/M |
3300010333|Ga0134080_10037468 | Not Available | 1868 | Open in IMG/M |
3300010362|Ga0126377_12282589 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300010362|Ga0126377_13384267 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300010399|Ga0134127_13387826 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300010868|Ga0124844_1299773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
3300012021|Ga0120192_10006830 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
3300012045|Ga0136623_10162397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 966 | Open in IMG/M |
3300012200|Ga0137382_10072695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2209 | Open in IMG/M |
3300012200|Ga0137382_10683567 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300012359|Ga0137385_11074089 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300012360|Ga0137375_11462474 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300012482|Ga0157318_1007024 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300012500|Ga0157314_1006988 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300012530|Ga0136635_10005618 | All Organisms → cellular organisms → Bacteria | 3926 | Open in IMG/M |
3300012681|Ga0136613_10011809 | All Organisms → cellular organisms → Bacteria | 4931 | Open in IMG/M |
3300012681|Ga0136613_10696017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300012892|Ga0157294_10084773 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300012899|Ga0157299_10333693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
3300012906|Ga0157295_10113354 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300012951|Ga0164300_10288781 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300012957|Ga0164303_10546280 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300012958|Ga0164299_10284046 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300012958|Ga0164299_11199368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300012960|Ga0164301_11006879 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300012984|Ga0164309_10474724 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300012984|Ga0164309_10675305 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300012984|Ga0164309_10931506 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300012984|Ga0164309_11783884 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300012985|Ga0164308_10628928 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300012987|Ga0164307_11828380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
3300012988|Ga0164306_10712976 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300012989|Ga0164305_10176392 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
3300012989|Ga0164305_11715929 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300013307|Ga0157372_12411020 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300013503|Ga0120127_10104850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
3300013772|Ga0120158_10097209 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
3300014150|Ga0134081_10213654 | Not Available | 660 | Open in IMG/M |
3300014267|Ga0075313_1086170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 765 | Open in IMG/M |
3300014324|Ga0075352_1189975 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300014969|Ga0157376_12017207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → Nitriliruptoraceae → Nitriliruptor → unclassified Nitriliruptor → Nitriliruptor sp. | 615 | Open in IMG/M |
3300015077|Ga0173483_10853208 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300015359|Ga0134085_10273045 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300015371|Ga0132258_11634140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1626 | Open in IMG/M |
3300015371|Ga0132258_12208645 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
3300015371|Ga0132258_13280301 | Not Available | 1114 | Open in IMG/M |
3300015371|Ga0132258_13376554 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300015372|Ga0132256_101965903 | Not Available | 691 | Open in IMG/M |
3300017654|Ga0134069_1373002 | Not Available | 514 | Open in IMG/M |
3300018073|Ga0184624_10068383 | Not Available | 1474 | Open in IMG/M |
3300018074|Ga0184640_10518220 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300018422|Ga0190265_11426288 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300018422|Ga0190265_12754478 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300018432|Ga0190275_11352343 | Not Available | 789 | Open in IMG/M |
3300018469|Ga0190270_10293530 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
3300018481|Ga0190271_12256966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 650 | Open in IMG/M |
3300018482|Ga0066669_10098303 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
3300020022|Ga0193733_1152145 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300021082|Ga0210380_10544581 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300025791|Ga0210115_1020156 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
3300025791|Ga0210115_1033480 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300025906|Ga0207699_11026937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
3300025919|Ga0207657_10410069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1065 | Open in IMG/M |
3300025922|Ga0207646_11794606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
3300025935|Ga0207709_10193855 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300025935|Ga0207709_10808953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
3300025935|Ga0207709_11409154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
3300025945|Ga0207679_10356013 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
3300026023|Ga0207677_11216934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
3300026121|Ga0207683_11056120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 754 | Open in IMG/M |
3300026142|Ga0207698_12014481 | Not Available | 591 | Open in IMG/M |
3300027163|Ga0209878_1041592 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300027560|Ga0207981_1070399 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300027561|Ga0209887_1000698 | All Organisms → cellular organisms → Bacteria | 10258 | Open in IMG/M |
3300027821|Ga0209811_10365090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
3300028705|Ga0307276_10000397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5410 | Open in IMG/M |
3300028713|Ga0307303_10080193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Paenarthrobacter → unclassified Paenarthrobacter → Paenarthrobacter sp. DKR-5 | 727 | Open in IMG/M |
3300028718|Ga0307307_10010623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2442 | Open in IMG/M |
3300028721|Ga0307315_10050825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1153 | Open in IMG/M |
3300028754|Ga0307297_10376805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
3300028784|Ga0307282_10274042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
3300028787|Ga0307323_10317020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
3300028872|Ga0307314_10124424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
3300028881|Ga0307277_10055689 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
3300028881|Ga0307277_10182788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Paenarthrobacter → unclassified Paenarthrobacter → Paenarthrobacter sp. DKR-5 | 916 | Open in IMG/M |
3300028881|Ga0307277_10535182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
3300030513|Ga0268242_1129365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
3300030606|Ga0299906_10966484 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300031099|Ga0308181_1066053 | Not Available | 720 | Open in IMG/M |
3300031754|Ga0307475_10373435 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
3300032017|Ga0310899_10551099 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300032177|Ga0315276_11716030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 648 | Open in IMG/M |
3300034147|Ga0364925_0320896 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300034149|Ga0364929_0006517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3099 | Open in IMG/M |
3300034165|Ga0364942_0116915 | Not Available | 865 | Open in IMG/M |
3300034176|Ga0364931_0203524 | Not Available | 646 | Open in IMG/M |
3300034818|Ga0373950_0082402 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 24.03% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.19% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.55% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.60% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.60% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.60% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.60% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.95% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.95% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.30% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.30% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.30% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.30% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.30% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.30% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.30% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.30% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.30% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.30% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.65% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.65% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.65% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.65% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.65% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.65% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.65% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.65% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.65% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.65% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Host-Associated | Open in IMG/M |
3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300030513 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2) | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPKNP_03709720 | 2070309009 | Soil | IRGEIIEYLDTGKVLAKDVEDENIMFARPGPTVEYWEGED |
2ZMR_01284410 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MLSSMIPGEIIEYLDTGKVLAKDVEDEDIVFARPGPTVEFWEGEE |
JGI10213J12805_100350621 | 3300000858 | Soil | GEIIEYLDTGKVLAKDVEDEDIMFARPGPTAEYWEGEY* |
JGI10214J12806_104155982 | 3300000891 | Soil | GEIIEYLDTGKVLAKDVDDEDVMFARPGPEVEYWEGED* |
JGI10214J12806_125165241 | 3300000891 | Soil | GEIIEYLDTGKILAKDVEDEDVMFARPGPTAEYWEGED* |
JGI1027J12803_1035058673 | 3300000955 | Soil | SMIRGEIIEYLDTGKVLAKDVEDEDIMFARPGPTAEYWEGEE* |
JGI1027J12803_1082489631 | 3300000955 | Soil | EYLDTGKVLAKDVEDENIVFARPGPTVEFWEGEE* |
JGI24747J21853_10178682 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | RGEVIEYLDTGKVLAKDFADEDIMFARPGPTIEFWEGED* |
Ga0062593_1005510982 | 3300004114 | Soil | RVLMLSSMIRGEIIEYLDTGKVLAKDVEDEDIMFARPGPRVEYWEGED* |
Ga0062593_1030628281 | 3300004114 | Soil | MIGGEIIEYLDTGKVLAKDAQDEDIMFARPGPTPEYWEGED* |
Ga0063455_1006971312 | 3300004153 | Soil | SMIRGEIIEYVDTGKILAKGVEDEDIMFARPGPAVEFWEGED* |
Ga0062589_1013091882 | 3300004156 | Soil | SMIGGEIIEYLDTGKILAKGVDDEDVMFARPGPAVEYWEGED* |
Ga0062590_1005048521 | 3300004157 | Soil | SMIGGEIIEYLDTGKVLAKGAEDEDIMFARPGPTAEFWEGED* |
Ga0062590_1023473111 | 3300004157 | Soil | MLSSMIPGEIIEYLDSGKVLAKDIEDEDIVFARPGPTVEFWEGEE* |
Ga0062592_1021946971 | 3300004480 | Soil | LMLSSMIRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED* |
Ga0062591_1007083503 | 3300004643 | Soil | SMIGGEIIEYLDTGKVLAKDAEDEDIMFARPGPTAEFWEGED* |
Ga0070680_1008204201 | 3300005336 | Corn Rhizosphere | RVLMLSSMIRGEIIEYLDTGKVLTKDVEDEDIMFARPGPTVEYWEGED* |
Ga0070691_106867632 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VLMLSSMIRGEVIEYLDTGKVLAKDFADEDIMFARPGPTIEFWEGED* |
Ga0070674_1003866661 | 3300005356 | Miscanthus Rhizosphere | RVLMLSSMIRGEIIEYLDTGKLLAKDVEDEDIMFARPGPTVEYWEGED* |
Ga0070700_1007300053 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VLMLSSMIRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED* |
Ga0070707_1020756821 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LSSMIRGEVIEYLDTGKVLAKDFADEDIMFARPGPTIEFWEGED* |
Ga0073909_102544542 | 3300005526 | Surface Soil | LDTGKVLAKDAEAEDILFARPGPTVEYWEGEDGR* |
Ga0068853_1020463392 | 3300005539 | Corn Rhizosphere | SMSPGEVIEYLDTGKVLAKDAKDDDIMFARPGPAVEYWEDEE* |
Ga0066698_106752791 | 3300005558 | Soil | EVIEYLDTGKILAKDAQDEDVMFARPGPAVEYWEGEQ* |
Ga0068866_111099511 | 3300005718 | Miscanthus Rhizosphere | GEIIEYLDTGKVLAKDVGDEDIMFARPGPTAEYWEGEE* |
Ga0068861_1001382683 | 3300005719 | Switchgrass Rhizosphere | EYLDTGKVLAKDFADEDIMFARPGPTIEFWEGED* |
Ga0081455_102217131 | 3300005937 | Tabebuia Heterophylla Rhizosphere | RVLMLSSMVPGEVIEYLDTGKILAKGAEDEDIMFARPGPDVEYWEGET* |
Ga0070717_106977543 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IEYLDTGKVLAKGVKDEDIMFTRPGPTPDYWEGEE* |
Ga0066651_103076021 | 3300006031 | Soil | RVLMLSSMIPGEIIEYLDTGKVLAKGVDDEDIMFAQPGPDADFWGGEE* |
Ga0070715_101805281 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | IEYLDTGKVLAKDVEDEDIMFARPGPTIEFWEGED* |
Ga0082029_14406342 | 3300006169 | Termite Nest | MLSSMIPGEIIEYIDTGKVLAKGAEDEDIMFARPGPTAEFWEGED* |
Ga0074051_117821871 | 3300006572 | Soil | LMLSSMIRGEIIEYLDTGKVLAKDVEDEDIMFAKPGPTAEYWEGED* |
Ga0075421_1021961111 | 3300006845 | Populus Rhizosphere | LMLSSMIRGEIIEYLDTGKVLAKGVDDEDVMFARPGPAVEYWEGED* |
Ga0075433_105668781 | 3300006852 | Populus Rhizosphere | LMLSSMIRGEIIEYLDTGKVLAKDIEDEDVMFARPGPEVEYWEGED* |
Ga0075434_1005691891 | 3300006871 | Populus Rhizosphere | IEYLDTGKVLAKGVEDEDIMFARPGPTPEYWEGED* |
Ga0079217_108471671 | 3300006876 | Agricultural Soil | GEIIEYLDTGKVLAKDAQDEDIMFARPGPTAEYWEGED* |
Ga0075429_1013557812 | 3300006880 | Populus Rhizosphere | PGEIIEYLDTGKVLAKDVEDEDIVFARPGPTAEYWEGEE* |
Ga0075426_101377743 | 3300006903 | Populus Rhizosphere | EYLDTGKVLAKDIDDEDVMFARPGPEVEYWEGED* |
Ga0075424_1028332211 | 3300006904 | Populus Rhizosphere | LMLSSMIRGEIIEYLDTGKVLAKDVEDEDIMFARPGPTVEYWEGED* |
Ga0075419_114416342 | 3300006969 | Populus Rhizosphere | PVRVLMLSSMVRGEIIEYLDTGKVFAGVDDEDVMFARPGPAVEYWEGED* |
Ga0079218_114408181 | 3300007004 | Agricultural Soil | MLSSTIPGEIIEYLDTGKVLAKDAQDEDVMFARPGPTAEYWEGED* |
Ga0105106_108988771 | 3300009078 | Freshwater Sediment | VLMLSSMIRGEIIEYLDTGKVLAKDVEDEDIMFARPGPAVEYWEGED* |
Ga0105240_115916081 | 3300009093 | Corn Rhizosphere | IPGEVIEYLDTGKILAKDAKDDDIMFARPGPAVEYWEDEE* |
Ga0105245_122264342 | 3300009098 | Miscanthus Rhizosphere | MLSSMTRGEIIEYLDTGKVLAKGVDDEDIMFARPGPAVEYWEGEE* |
Ga0075418_105866811 | 3300009100 | Populus Rhizosphere | IEYLDTGKVLAKDVDDEDVMFARPGPPVEYWEGED* |
Ga0114129_121613012 | 3300009147 | Populus Rhizosphere | EIIEYLDTGKVLAKGVDDEDVMFARPGPDVEYWADED* |
Ga0111538_106558461 | 3300009156 | Populus Rhizosphere | MLSSMVRGEIIEYLDTGKILAKDVEDEDVMFARPGPTAEYWEGED* |
Ga0075423_125437722 | 3300009162 | Populus Rhizosphere | MLSSMISSEIIEYLDTGKVLAKVSEEEDIMFARPGPTAEYWEGED* |
Ga0105340_12118223 | 3300009610 | Soil | EYLDTGKVLAKGVEDEDIMFAKPGPTAEFWEGEA* |
Ga0126307_101892806 | 3300009789 | Serpentine Soil | SMVNGEIIEYLDTGKILAKVVEDEDIMFAKPGPTAEYWEGEE* |
Ga0126307_104121902 | 3300009789 | Serpentine Soil | MLSSMIPGEIIEYLDTGKVLAKDAQDEDVMFARPGPTAEYWEGED* |
Ga0105058_11970881 | 3300009837 | Groundwater Sand | IIEYLDTGKVLAKGIEDEDIMFARPGPTVEYWEGED* |
Ga0126313_113336171 | 3300009840 | Serpentine Soil | RVLMLSSMIPGEIIEYLDTGKLLAKDVEDEDIVFARPGPTVEYWEGEE* |
Ga0126315_106399002 | 3300010038 | Serpentine Soil | IIEYPDTGKVLAKDVEDEDIVFARPGPTVEFWEGEE* |
Ga0126309_102669662 | 3300010039 | Serpentine Soil | SSMIRGEIIEYLDTGKVLAKDAQDEDIMFARPGPTAEYWEGEN* |
Ga0126308_110544761 | 3300010040 | Serpentine Soil | MLSSMIRGEIIEYLDTGKVLAKDAQDEDIMFARPGPTAEYWEGENSLRATLSIDGPP |
Ga0126311_107607392 | 3300010045 | Serpentine Soil | MLSSMIRGEIIQYLDSGKILAKSVEDEDIVFARPGPTVEYWEGEE* |
Ga0127503_103612171 | 3300010154 | Soil | LMLSSMTPGEVIEYLDTGKVLAKDAKDDDIMFARPGPAVEYWEDEE* |
Ga0134080_100374681 | 3300010333 | Grasslands Soil | LEYLDTGKILADGVGGEHIMFSRPGPVADYWEGED* |
Ga0126377_122825892 | 3300010362 | Tropical Forest Soil | SSMIPGEVIEYLDTGKILAKGAEDEDIMFARPGPEAEYWEGEE* |
Ga0126377_133842671 | 3300010362 | Tropical Forest Soil | MLSSMIRGDIIEYLDTGKVLAKGVDDEDVMFARPGPTAEYWEGEE* |
Ga0134127_133878261 | 3300010399 | Terrestrial Soil | VLMLSSMIRGEIIEYLDTGKVLAKDVEDEDIMFAKPGPASEYWEGED* |
Ga0124844_12997732 | 3300010868 | Tropical Forest Soil | LSSMNPGEVIEYLDTGKVLAKDAKDEDILFARPGPAVEYWEDEE* |
Ga0120192_100068304 | 3300012021 | Terrestrial | GGEPTEYLDTGKVLAKSVEDEDVMFARPGPTVEYWEGED* |
Ga0136623_101623971 | 3300012045 | Polar Desert Sand | GEIIEYLDTGKVLAKGNEDEDIMFARPGPTADYWEGEE* |
Ga0137382_100726955 | 3300012200 | Vadose Zone Soil | RVLMLSSMIRGEITEYLDTGKILAKDAADEDIMFARPGPTPEYWEGED* |
Ga0137382_106835673 | 3300012200 | Vadose Zone Soil | LSSMTAGEVIEYLDTGKVLAKDAKDDDIMFARPSPAVEYWEDEE* |
Ga0137385_110740892 | 3300012359 | Vadose Zone Soil | MLSSMIRGEIIEYLDTGKVLAKDAQDEDVMFARPGPAVEYWEGEE* |
Ga0137375_114624741 | 3300012360 | Vadose Zone Soil | TPGEVIEYLDTGKVLAKDAKDADIMFARPGPAVEYWEDEE* |
Ga0157318_10070241 | 3300012482 | Arabidopsis Rhizosphere | IEYLDTGKVLAKDHEDEDIMFAKPGPTVEYWEGED* |
Ga0157314_10069882 | 3300012500 | Arabidopsis Rhizosphere | EYLDTGKVLAKDVEDENIMFARPGPTVEYWEGED* |
Ga0136635_100056184 | 3300012530 | Polar Desert Sand | MLSSMIRGEIIEYLDTGKVLAKDVEDEDIMFARPGPPVEYWEGEN* |
Ga0136613_100118099 | 3300012681 | Polar Desert Sand | EYLDTGKVLAKGVEDEDVMFARPGPTVEYWEGED* |
Ga0136613_106960172 | 3300012681 | Polar Desert Sand | VLMLSSMIRGEIIEYLDTGKVLAKGVEDEDVMFARPGPAVEYWEGED* |
Ga0157294_100847731 | 3300012892 | Soil | SMIRGEVIEYLDTGKILAKDVEDEDIMFARPGPAVEYWEGED* |
Ga0157299_103336932 | 3300012899 | Soil | RGEVIEYLDTGKILAKDVEDEDIMFARPGPAVEYWEGED* |
Ga0157295_101133543 | 3300012906 | Soil | SMIRGEIIEYLDTGKILAKDVDDEDVVFARPGPMAEYWEGEQ* |
Ga0164300_102887812 | 3300012951 | Soil | LSSMMRGEIIEYLDTGKVLAKDVEDEDILFARPGPTVEYWEGED* |
Ga0164303_105462802 | 3300012957 | Soil | GEIIEYLDTGKVLAKDVEDEDILFARPGPTVEYWEGED* |
Ga0164299_102840461 | 3300012958 | Soil | GEIIEYLDTGKVLAKDIEDEDVMFARHGPAVEYWESED* |
Ga0164299_111993681 | 3300012958 | Soil | LMLSSTIRGEIIEYLDTGKVLAKDVEDEDIMFVRPGPTVEYWEGED* |
Ga0164301_110068792 | 3300012960 | Soil | EVIEYLDTGKVLAKDAKDDDIMFAKPGPAAEYWEDEE* |
Ga0164309_104747243 | 3300012984 | Soil | PGEVIEYLDTGKVLAKDAKDDDIMFARPGPAVEYWEDEE* |
Ga0164309_106753052 | 3300012984 | Soil | MLSSMIGGEIIEYLDTGKVLAKDVEDEDILFARPGPTVEYWEGED* |
Ga0164309_109315061 | 3300012984 | Soil | RVLMLSSMIRGEVIEYLDTGKVLAKDVEDEDIMFARPGPTIEFWEGED* |
Ga0164309_117838842 | 3300012984 | Soil | VLMLSSMTPGEVIEYLDTGKVLAKDAKDDDIMFAKPGPAVEYWEDEE* |
Ga0164308_106289282 | 3300012985 | Soil | RVLMLSSMIGGEIIEYLDTGKVLAKGAEDEDIMFARPGPSAEFWEGED* |
Ga0164307_118283801 | 3300012987 | Soil | IEYLDTGKVLAKGAQDDDIMFAKRGGDAEYWEGEE* |
Ga0164306_107129762 | 3300012988 | Soil | EYLDTGKVLAKDAKDDDIMFARPGPAVEYWEDEE* |
Ga0164305_101763923 | 3300012989 | Soil | GGDIVEYLDTGKVLAKDAQDEDIMFARPGPTAEFWEGEN* |
Ga0164305_117159292 | 3300012989 | Soil | RVLMLSSMIPGEIIEYLDSGKVLAKDVEDEDIAFARPGPTVEFWEGEE* |
Ga0157372_124110202 | 3300013307 | Corn Rhizosphere | MVEVDTVEYLDTGKVSATSVGDEPIMFARPGPTAEYWEGED* |
Ga0120127_101048502 | 3300013503 | Permafrost | LMLSSMIPGEIIEFLDTGKVLAKGVEDDDIMFARPGPTVEYWEGED* |
Ga0120158_100972093 | 3300013772 | Permafrost | IRGEVIEYLDTGKVLAKDVEDEDIMFARPGPTIEFWEGED* |
Ga0134081_102136541 | 3300014150 | Grasslands Soil | EYLDTGKVLAKDVEDEDIVFARPGPTVEYWEGEE* |
Ga0075313_10861701 | 3300014267 | Natural And Restored Wetlands | VRVLMLSSMIRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED* |
Ga0075352_11899751 | 3300014324 | Natural And Restored Wetlands | RGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED* |
Ga0157376_120172071 | 3300014969 | Miscanthus Rhizosphere | MIRGEVIEYLDTGKVLAKDVEDEDIMFARPGPTIEFWDGED* |
Ga0173483_108532082 | 3300015077 | Soil | LSSMIRGEIIEYLDTGKILAKDVDDEDVVFARPGPTADYWEGEE* |
Ga0134085_102730453 | 3300015359 | Grasslands Soil | MLSSMVPGEIIEYLDTGKVLAKDVEDEDIVFARPGPTVEYWEGEE* |
Ga0132258_116341403 | 3300015371 | Arabidopsis Rhizosphere | SSMIPGEIIEYLDTGKVLAKDVEDEDILFARPGPTVEYWEGED* |
Ga0132258_122086454 | 3300015371 | Arabidopsis Rhizosphere | RVLMLSSMNRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED* |
Ga0132258_132803012 | 3300015371 | Arabidopsis Rhizosphere | VIEYLDTGKILAKDAEDEDIMFAKPGPAVEYWQDED* |
Ga0132258_133765543 | 3300015371 | Arabidopsis Rhizosphere | SMIRGEIIEYLDTGKVLAKDIEDEDVMFARPGPEVEYWEGED* |
Ga0132256_1019659033 | 3300015372 | Arabidopsis Rhizosphere | SSMTPGEVIEYLDTGKVLAKDAKDDDIMFARPGPAVEYWEDEE* |
Ga0134069_13730022 | 3300017654 | Grasslands Soil | MLSSMVPGEIIEYLYTGKVLAKDVEDEDIVFARPGPTVEYWEGEE |
Ga0184624_100683832 | 3300018073 | Groundwater Sediment | GEIIEYLDTGKVLAKGVDDEDVMFARPGPAVEYWEDED |
Ga0184640_105182202 | 3300018074 | Groundwater Sediment | MLSSMNRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED |
Ga0190265_114262882 | 3300018422 | Soil | GEIIEYLDTGKVLAKDAQDEDIIFARPGPTAEYWEGED |
Ga0190265_127544781 | 3300018422 | Soil | LMLSSMIRGEIIEYLDTGKVLAKDVEDEDIMFARPGPPVEYWEGEN |
Ga0190275_113523431 | 3300018432 | Soil | SMISGEVIEYLDTGKVLAKGVDDEDIVFARPGPPVEYWEGED |
Ga0190270_102935304 | 3300018469 | Soil | VRVLMLSSMIRGEIIEYLDTGKVLAKGVDDEDVVFARPGPAVEYWEGED |
Ga0190271_122569662 | 3300018481 | Soil | LMLSSMIRGEIIEYLDTGKVLAKDVEDEDVMFARPGPTAEYWEGEE |
Ga0066669_100983033 | 3300018482 | Grasslands Soil | MLSSMIPGEIIEYLDTGKVLAKDVEDEDIVFARPGPTVEYWEGEE |
Ga0193733_11521452 | 3300020022 | Soil | EIIEYLDTGKVLAKDVEDEDIVFARPGPTVEFWEGEE |
Ga0210380_105445811 | 3300021082 | Groundwater Sediment | SSMVPGEIIEYLDTGKVLAKGVDDEDVLFARPGPAVEYWEDED |
Ga0210115_10201561 | 3300025791 | Natural And Restored Wetlands | SMIRGEIIEYLDTGKILAKDVDDEDVVFARPGPTADYWEGEE |
Ga0210115_10334803 | 3300025791 | Natural And Restored Wetlands | MIRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED |
Ga0207699_110269371 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LSSMISSEIIEYLDTGKVLAKVSEEEDIMFARPGPTAEYWEGED |
Ga0207657_104100691 | 3300025919 | Corn Rhizosphere | TVEYLDTGKVSATSVGDEPIMFARPGPTAEYWEGED |
Ga0207646_117946061 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IEYLDTGKVYAASVGGEPIVLARPGPTVEYWEGEQ |
Ga0207709_101938553 | 3300025935 | Miscanthus Rhizosphere | IRGEIIEYLDTGKVLAKDVEDEDIMFARPGPTVEYWEGED |
Ga0207709_108089531 | 3300025935 | Miscanthus Rhizosphere | LMLSSMIGGEIIEYLDTGKVLAKGFEDEDIMFARPGPTVEYWEGED |
Ga0207709_114091542 | 3300025935 | Miscanthus Rhizosphere | SSMIGGEIIEYLDTGKVLAKGAQDEDIMFARPGPTAEFWEGED |
Ga0207679_103560131 | 3300025945 | Corn Rhizosphere | IRGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED |
Ga0207677_112169341 | 3300026023 | Miscanthus Rhizosphere | RGEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED |
Ga0207683_110561202 | 3300026121 | Miscanthus Rhizosphere | GEVIEYLDTGKVLAKDVEDEDIMFARPGPAIDFWEGED |
Ga0207698_120144811 | 3300026142 | Corn Rhizosphere | MLSSMIPGEIIEYLDTGKVLAKDVDDEDVMFARPGPSVEYWEGED |
Ga0209878_10415922 | 3300027163 | Groundwater Sand | IEYLDTGKVLAKGIEDEDIMFARPGPTVEYWEGED |
Ga0207981_10703991 | 3300027560 | Soil | MIGGEIIEYLDTGKVLAKDARDEDIMFAQPGPTAEFWEGED |
Ga0209887_10006982 | 3300027561 | Groundwater Sand | MLSSMIRGEIIEYLDTGKVLAKGIEDEDIMFARPGPTVEYWEGED |
Ga0209811_103650901 | 3300027821 | Surface Soil | MIRGEIIEYLDTGKVLAKDAEDEDILFARPGPTVEYWEGED |
Ga0307276_100003976 | 3300028705 | Soil | SSMIDGDIIEYLDTGKVLAQSPSGEQVMFGRPGPKAEYWEGEE |
Ga0307303_100801931 | 3300028713 | Soil | PGEIIEYLDTGKVLAKDVEDEDIVFARPGPTVEFWEGEE |
Ga0307307_100106234 | 3300028718 | Soil | FIEYLDTGKVLAKDVEDEDIMFARPGPTIEFWEGED |
Ga0307315_100508253 | 3300028721 | Soil | IVEYLDTGKVLAKDVEDEDIVFARPGPTVEFWEGEE |
Ga0307297_103768052 | 3300028754 | Soil | GEIIEYLDTGKVLAKDVDDEDVMFARPGPAVEYWEGED |
Ga0307282_102740422 | 3300028784 | Soil | IIEYLDTGKVLAKGVEDEDIMFARPGPTVEYWEGEDL |
Ga0307323_103170201 | 3300028787 | Soil | EIIEYLDTGKVLAKDVEDEDIVFARPGPSVEFWEGEE |
Ga0307314_101244241 | 3300028872 | Soil | SMIRGEIIEYLDTGEILAKDSEDEDVMFAKPGAPVEYWEGEE |
Ga0307277_100556891 | 3300028881 | Soil | IEYLDTGKVLGDALGGEHIMFSRPGPVADYWEGED |
Ga0307277_101827881 | 3300028881 | Soil | VLMLSSMIPGEIIEYLDTGKVLAKDVEDEDIVFARPGPTVEFWEGEE |
Ga0307277_105351821 | 3300028881 | Soil | SMIGPDIIEYLDTGKVYATSVADEPIMLARPGPTVEYWEGEE |
Ga0268242_11293652 | 3300030513 | Soil | MVSSMIDPDTIEYLDTGKVLAKDAAGTDIVFAKPGPVADYWEGES |
Ga0299906_109664842 | 3300030606 | Soil | LSSMIRGEIIEYLDTGKLLAKDAQDEDIMFARPGPAVEYWEGED |
Ga0308181_10660533 | 3300031099 | Soil | GEIIEYLDTGKVLAKDAQDEDIMFARPGPTAEYWEGED |
Ga0307475_103734353 | 3300031754 | Hardwood Forest Soil | VLMLSSMIRGEIIEYLDTGKVLAKDARDEDIVFARPGPAVDYWEGEE |
Ga0310899_105510992 | 3300032017 | Soil | LMLSSMIGGEIIEYLDTGKVLAKGAEDEDIMFARPGATAEFWEGED |
Ga0315276_117160301 | 3300032177 | Sediment | MVPGEIIEYLDTGKVLAKGVDDEDVMFARPGPAVEYWEDED |
Ga0364925_0320896_328_465 | 3300034147 | Sediment | MLSSMIRGEIIEYLDTGKVLAKGVEDEDIMFARPGPTAEFWDGEE |
Ga0364929_0006517_95_250 | 3300034149 | Sediment | MLSSMIPGEIIEYLDTGKVLAKGVEDEDIMFARPGPDVEFWEGEEELSSSG |
Ga0364942_0116915_7_132 | 3300034165 | Sediment | MIRGEIIEYLDTGKVLAKDAQDEDIMFARPGPAVEYWEGED |
Ga0364931_0203524_1_126 | 3300034176 | Sediment | MIRGEIIEYLDTGKVLAKDAQDEDIMFARPGPAVEYWEGEE |
Ga0373950_0082402_520_657 | 3300034818 | Rhizosphere Soil | MLSSLTLGDIIEYLDTGKVLAKDVEDEDIMFARPGPAVEYWEGED |
⦗Top⦘ |