| Basic Information | |
|---|---|
| Family ID | F044722 |
| Family Type | Metagenome |
| Number of Sequences | 154 |
| Average Sequence Length | 53 residues |
| Representative Sequence | MYRLSRAVQFLGLVVAGAAFFVGVLGHDVRRELVLLGIGAGIFFAGQALQRGAR |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 62.99 % |
| % of genes near scaffold ends (potentially truncated) | 24.03 % |
| % of genes from short scaffolds (< 2000 bps) | 81.17 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.117 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (8.442 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.558 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.260 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.98% β-sheet: 0.00% Coil/Unstructured: 39.02% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF00160 | Pro_isomerase | 36.36 |
| PF00389 | 2-Hacid_dh | 31.17 |
| PF02826 | 2-Hacid_dh_C | 9.74 |
| PF13646 | HEAT_2 | 9.09 |
| PF05258 | DciA | 3.25 |
| PF12850 | Metallophos_2 | 1.95 |
| PF02812 | ELFV_dehydrog_N | 1.30 |
| PF08281 | Sigma70_r4_2 | 1.30 |
| PF11954 | DUF3471 | 1.30 |
| PF06071 | YchF-GTPase_C | 0.65 |
| PF00364 | Biotin_lipoyl | 0.65 |
| PF02739 | 5_3_exonuc_N | 0.65 |
| PF07638 | Sigma70_ECF | 0.65 |
| PF02785 | Biotin_carb_C | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 36.36 |
| COG5512 | Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives) | General function prediction only [R] | 3.25 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 1.30 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.65 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.12 % |
| Unclassified | root | N/A | 16.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2084038017|SPCE_SO_FSPRUNR02FP5J2 | Not Available | 504 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100291190 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300000559|F14TC_100472283 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300004013|Ga0055465_10168812 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300004020|Ga0055440_10211797 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300004114|Ga0062593_101113536 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300004145|Ga0055489_10046886 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300004479|Ga0062595_102012866 | Not Available | 558 | Open in IMG/M |
| 3300005293|Ga0065715_11046752 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005328|Ga0070676_10555210 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300005328|Ga0070676_10909137 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300005332|Ga0066388_100331942 | All Organisms → cellular organisms → Bacteria | 2167 | Open in IMG/M |
| 3300005332|Ga0066388_104186705 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300005332|Ga0066388_104204485 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005334|Ga0068869_100662827 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300005355|Ga0070671_100126180 | All Organisms → cellular organisms → Bacteria | 2154 | Open in IMG/M |
| 3300005366|Ga0070659_100195007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1666 | Open in IMG/M |
| 3300005367|Ga0070667_100078022 | All Organisms → cellular organisms → Bacteria | 2829 | Open in IMG/M |
| 3300005456|Ga0070678_100181128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1725 | Open in IMG/M |
| 3300005457|Ga0070662_101341501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300005467|Ga0070706_100009293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9163 | Open in IMG/M |
| 3300005467|Ga0070706_100309399 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300005468|Ga0070707_100253600 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300005518|Ga0070699_100433425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1191 | Open in IMG/M |
| 3300005518|Ga0070699_101256896 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005518|Ga0070699_101469329 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300005536|Ga0070697_101691205 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005543|Ga0070672_100446685 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300005549|Ga0070704_101895395 | Not Available | 552 | Open in IMG/M |
| 3300005564|Ga0070664_100612434 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300005618|Ga0068864_100011509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7308 | Open in IMG/M |
| 3300005618|Ga0068864_101991019 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005713|Ga0066905_100559999 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300005764|Ga0066903_100040481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5487 | Open in IMG/M |
| 3300005764|Ga0066903_100057101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4833 | Open in IMG/M |
| 3300005764|Ga0066903_100576153 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300005764|Ga0066903_100755136 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300005840|Ga0068870_10679333 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300005841|Ga0068863_100043632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4256 | Open in IMG/M |
| 3300005841|Ga0068863_101672816 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005842|Ga0068858_100339999 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300005842|Ga0068858_102402255 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005843|Ga0068860_102079796 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005937|Ga0081455_10066272 | All Organisms → cellular organisms → Bacteria | 3017 | Open in IMG/M |
| 3300005993|Ga0080027_10028602 | All Organisms → cellular organisms → Bacteria | 1988 | Open in IMG/M |
| 3300006050|Ga0075028_100489747 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300006169|Ga0082029_1076968 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300006642|Ga0075521_10417069 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006806|Ga0079220_10265291 | Not Available | 1037 | Open in IMG/M |
| 3300006852|Ga0075433_10000270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 30504 | Open in IMG/M |
| 3300006854|Ga0075425_100020955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7150 | Open in IMG/M |
| 3300006854|Ga0075425_102113407 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300007076|Ga0075435_100073607 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
| 3300009012|Ga0066710_101023288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1275 | Open in IMG/M |
| 3300009089|Ga0099828_10574260 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300009098|Ga0105245_12927105 | Not Available | 529 | Open in IMG/M |
| 3300009101|Ga0105247_11073773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300009148|Ga0105243_12647888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300009157|Ga0105092_10001730 | All Organisms → cellular organisms → Bacteria | 11719 | Open in IMG/M |
| 3300009166|Ga0105100_10254027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
| 3300009545|Ga0105237_12583180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300009821|Ga0105064_1142044 | Not Available | 514 | Open in IMG/M |
| 3300010359|Ga0126376_10257984 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300010360|Ga0126372_12180526 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300010362|Ga0126377_10119129 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
| 3300010362|Ga0126377_11353935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300010373|Ga0134128_11148244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300011998|Ga0120114_1029451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1116 | Open in IMG/M |
| 3300012906|Ga0157295_10363644 | Not Available | 528 | Open in IMG/M |
| 3300012948|Ga0126375_10855322 | Not Available | 726 | Open in IMG/M |
| 3300012960|Ga0164301_10810350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300012961|Ga0164302_10991819 | Not Available | 654 | Open in IMG/M |
| 3300013306|Ga0163162_13148436 | Not Available | 530 | Open in IMG/M |
| 3300014052|Ga0120109_1029474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1229 | Open in IMG/M |
| 3300014056|Ga0120125_1079395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300014324|Ga0075352_1193646 | Not Available | 597 | Open in IMG/M |
| 3300014325|Ga0163163_10225051 | Not Available | 1925 | Open in IMG/M |
| 3300014829|Ga0120104_1014192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1408 | Open in IMG/M |
| 3300014968|Ga0157379_10475057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
| 3300014969|Ga0157376_12951848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300015089|Ga0167643_1064640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300015090|Ga0167634_1020719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300015168|Ga0167631_1027374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
| 3300015168|Ga0167631_1034034 | Not Available | 827 | Open in IMG/M |
| 3300017792|Ga0163161_10656576 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300017947|Ga0187785_10387185 | Not Available | 668 | Open in IMG/M |
| 3300017959|Ga0187779_10005715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7292 | Open in IMG/M |
| 3300017974|Ga0187777_11013249 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300018063|Ga0184637_10173438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1328 | Open in IMG/M |
| 3300018075|Ga0184632_10287323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300018084|Ga0184629_10003872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5579 | Open in IMG/M |
| 3300019356|Ga0173481_10481796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300021478|Ga0210402_10010062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 8182 | Open in IMG/M |
| 3300025324|Ga0209640_10699032 | Not Available | 808 | Open in IMG/M |
| 3300025567|Ga0210076_1082366 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300025903|Ga0207680_10028172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3139 | Open in IMG/M |
| 3300025908|Ga0207643_10003847 | All Organisms → cellular organisms → Bacteria | 8076 | Open in IMG/M |
| 3300025910|Ga0207684_10224677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1620 | Open in IMG/M |
| 3300025911|Ga0207654_10536532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
| 3300025920|Ga0207649_11571733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300025930|Ga0207701_11391514 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300025931|Ga0207644_10712306 | Not Available | 837 | Open in IMG/M |
| 3300025931|Ga0207644_11291442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300025937|Ga0207669_11087336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300025945|Ga0207679_11297159 | Not Available | 668 | Open in IMG/M |
| 3300025986|Ga0207658_10049204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3096 | Open in IMG/M |
| 3300025986|Ga0207658_10053995 | All Organisms → cellular organisms → Bacteria | 2971 | Open in IMG/M |
| 3300026035|Ga0207703_11706634 | Not Available | 606 | Open in IMG/M |
| 3300026067|Ga0207678_10210437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1663 | Open in IMG/M |
| 3300026088|Ga0207641_10011261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 7336 | Open in IMG/M |
| 3300026088|Ga0207641_10182508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1923 | Open in IMG/M |
| 3300026088|Ga0207641_11089084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300026088|Ga0207641_11993084 | Not Available | 582 | Open in IMG/M |
| 3300026281|Ga0209863_10067882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300027511|Ga0209843_1031290 | Not Available | 984 | Open in IMG/M |
| 3300027722|Ga0209819_10048030 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300027873|Ga0209814_10437692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300027902|Ga0209048_10000055 | All Organisms → cellular organisms → Bacteria | 100371 | Open in IMG/M |
| 3300027902|Ga0209048_10025280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5096 | Open in IMG/M |
| 3300028381|Ga0268264_11892006 | Not Available | 606 | Open in IMG/M |
| 3300028587|Ga0247828_10324589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300028802|Ga0307503_10149528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
| 3300030336|Ga0247826_10466117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
| 3300030336|Ga0247826_11421504 | Not Available | 561 | Open in IMG/M |
| 3300031226|Ga0307497_10689804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300031538|Ga0310888_10274503 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300031572|Ga0318515_10289813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
| 3300031680|Ga0318574_10590664 | Not Available | 651 | Open in IMG/M |
| 3300031720|Ga0307469_10641827 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300031740|Ga0307468_100401679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
| 3300031740|Ga0307468_102035960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300031779|Ga0318566_10083657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1554 | Open in IMG/M |
| 3300031835|Ga0318517_10220708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300031954|Ga0306926_12191580 | Not Available | 616 | Open in IMG/M |
| 3300031997|Ga0315278_10028604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5349 | Open in IMG/M |
| 3300031997|Ga0315278_11842579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300032000|Ga0310903_10036367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1804 | Open in IMG/M |
| 3300032089|Ga0318525_10462379 | Not Available | 650 | Open in IMG/M |
| 3300032205|Ga0307472_102429176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300032205|Ga0307472_102650565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300032770|Ga0335085_10268265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2041 | Open in IMG/M |
| 3300032782|Ga0335082_10299121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1482 | Open in IMG/M |
| 3300032782|Ga0335082_10780282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300032783|Ga0335079_11475525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300032954|Ga0335083_10022085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7305 | Open in IMG/M |
| 3300032955|Ga0335076_10165548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2122 | Open in IMG/M |
| 3300033004|Ga0335084_10240824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1876 | Open in IMG/M |
| 3300033414|Ga0316619_11111213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300033550|Ga0247829_10166956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1727 | Open in IMG/M |
| 3300033803|Ga0314862_0177613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300034123|Ga0370479_0107942 | Not Available | 741 | Open in IMG/M |
| 3300034176|Ga0364931_0002209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4358 | Open in IMG/M |
| 3300034176|Ga0364931_0039355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1410 | Open in IMG/M |
| 3300034178|Ga0364934_0109238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1042 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.25% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.25% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.60% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.60% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.60% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.95% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.95% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.30% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.30% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.30% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.30% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.30% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil | 0.65% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.65% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.65% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2084038017 | Soil microbial communities from Hopland, California, USA, that is PCE polluted - amended with soybean oil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015090 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300034123 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SPCE_SO_00046260 | 2084038017 | Soil | MYALSRLVQFAGLVVAGSALFVGLMQHDARRELLILGIGAGIFFAGYTLQKVRR |
| INPhiseqgaiiFebDRAFT_1002911902 | 3300000364 | Soil | MYALARVIQFLGLVVAGSALFVGFLGHDARRELLVLGIGAALFFAGRGLQKGFR* |
| F14TC_1004722832 | 3300000559 | Soil | MYALARVIQFLGLVVAGAALFVGFLGHDARRELLVLGIGAALFFAGRGLQKGFR* |
| Ga0055465_101688122 | 3300004013 | Natural And Restored Wetlands | MYRMARAVQFLGLVVAGAAFFVGLLGHNVRRELLLLGIGAGIFFAGRALQGRAS* |
| Ga0055440_102117971 | 3300004020 | Natural And Restored Wetlands | MYALGRAVQFLGLVVAGAAFFVGVLAHNVRRELALLGIGAAIFLAGWVLQRGRR* |
| Ga0062593_1011135362 | 3300004114 | Soil | MYALSRLVQFAGLVVAGSALFVGVMGKDARRELMVLGVGAAIFLLGYMLQRTTR* |
| Ga0055489_100468862 | 3300004145 | Natural And Restored Wetlands | MYRLSRAVQFLGLVVAGAAFFVGVLGHDVRRELVLLGIGAGIFFAGQALQRGAR* |
| Ga0062595_1020128662 | 3300004479 | Soil | MYALARLVQFAGLVVAGSAFFVGVMGKDARRELMILGVGAAIFLLGYMMQRARR* |
| Ga0065715_110467521 | 3300005293 | Miscanthus Rhizosphere | MYRMARAVQFLGLVVAGAALFVGLLGHNVRRELLLLGIGAGIFFAGRALQGRAS* |
| Ga0070676_105552101 | 3300005328 | Miscanthus Rhizosphere | MYRMARAIQFLGLVVAGAALFVGLLGHNVRRELLLLGIGAGIFFAGRALQGRAS* |
| Ga0070676_109091371 | 3300005328 | Miscanthus Rhizosphere | MYALSRLVQFAGLVVAGSALFVGLMQRDARRELLILSVGAGIFFAGYALQRVRR* |
| Ga0066388_1003319422 | 3300005332 | Tropical Forest Soil | VYALGRVVQFLGLVISGAALFVGVLGSNVRRELALLGIGAAIFFAGWMLQRGRR* |
| Ga0066388_1041867051 | 3300005332 | Tropical Forest Soil | VYALSRAVQFLGLVIAGAAFFVGVLGSNVRRELALLGIGAAVFFAGRALQGKTK* |
| Ga0066388_1042044852 | 3300005332 | Tropical Forest Soil | VYAAGRAVQFLGLVISGSAFFVGVFGQNVRRELLLLGIGAAIFFAGWMLQRTRR* |
| Ga0068869_1006628271 | 3300005334 | Miscanthus Rhizosphere | SMYALSRLVQFAGLVVAGSALFVGLMQRDARRELLILSVGAGIFFAGYALQRVRR* |
| Ga0070671_1001261802 | 3300005355 | Switchgrass Rhizosphere | MYAVSRLVQFAGLVVAGSALFVGLMQHDARRELLILGVGAGIFFAGYALQRVRR* |
| Ga0070659_1001950071 | 3300005366 | Corn Rhizosphere | MARAVQFLGLVVAGAALFVGLLGHNVRRELLLLGIGAGIFFAGRALQGRAS* |
| Ga0070667_1000780224 | 3300005367 | Switchgrass Rhizosphere | MYRMARGVQFLGLVVAGAALFVGLLGHNVRRELLLLGIGAGIFFAGRALQGRAS* |
| Ga0070678_1001811284 | 3300005456 | Miscanthus Rhizosphere | SPCRRRGRPRVRLLARLVQFAGLVIAGAAFFVGVMGHDERRELLLLAFGAAVFTEGWLLQRGVR* |
| Ga0070662_1013415011 | 3300005457 | Corn Rhizosphere | MYALSRLVQFAGLVVAGSALFVGLMQRDARRELIILSVGAGIFFAGYAL |
| Ga0070706_1000092937 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVLARSAQLLGLIVTGAAFFVGVLGHNVRRELLLLAVGAAIFFAGRALQARGA* |
| Ga0070706_1003093991 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MISPARAVQFLGLVVSGSAFFVGVLGHNVRRELLLLAIGAAIFLAGRWLQRGRP* |
| Ga0070707_1002536002 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVLARSAQLLGLIVTGAAFFVGVLGHNVRRELLLLAIGAAIFFAGRALQARGA* |
| Ga0070699_1004334252 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VTYLGRGVQFLGLVIAGSAFFVGLLGHDERRELLLLAIGAGVFTAGYLIQRSRR* |
| Ga0070699_1012568961 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MYVMARAIQFLGLIVAGAALFVGLLGHDVRRELLVLGIGAAIFFVGRTLQRGFR* |
| Ga0070699_1014693292 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PEMISPARAVQFLGLVVSGSAFFVGVLGHNVRRELLLLAIGAAIFLAGRWLQRGRP* |
| Ga0070697_1016912052 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MYVLARVIQFLGLIVAGAALFVGLLGHDVRRELLLLGIGAAIFFVGRTLQRGFR* |
| Ga0070672_1004466852 | 3300005543 | Miscanthus Rhizosphere | MYALSRLVQFAGLVVAGSALFVGVVGKDARRELMVLGVGAAIFLLGYMLQRTTR* |
| Ga0070704_1018953952 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | QFAGLVVAGSALFVGLMQRDARRELLILSVGAGIFFAGYALQRVRR* |
| Ga0070664_1006124342 | 3300005564 | Corn Rhizosphere | MYALARLVQFAGLVVAGAAFFVGVMGKDARRELVILGVGAAIFLLGYMMQRARR* |
| Ga0068864_1000115095 | 3300005618 | Switchgrass Rhizosphere | MYALSRLVQFAGLVVAGSALFVGLMQRDARRELIILSVGAGIFFAGYALQRVRR* |
| Ga0068864_1019910192 | 3300005618 | Switchgrass Rhizosphere | MYKLGRSVQFLGLVVAGSALFVGVISHDSRRELMLLGVGAGIFFSGYALQRSGK* |
| Ga0066905_1005599992 | 3300005713 | Tropical Forest Soil | MYALARAIQFLGLVVAGSALFVGFLGHDARRELLVLGIGAALFFAGRGLQRGFR* |
| Ga0066903_1000404815 | 3300005764 | Tropical Forest Soil | VYALSRAVQFLGLVIAGAAFFVGVLGSNVRRELALLGIGAAVFFAGRALQGRTK* |
| Ga0066903_1000571015 | 3300005764 | Tropical Forest Soil | VCAAGRAVQFLGLVISGSAFFVGVFGQNVRRELLLLGIGAAIFFAGWMLQRTRR* |
| Ga0066903_1005761532 | 3300005764 | Tropical Forest Soil | VYAIARAVQFLGLVIAGSAFFVGVLGHDVRRELLILGIGAAIFFAGRGLQKGFR* |
| Ga0066903_1007551362 | 3300005764 | Tropical Forest Soil | VYAAARAVQFLGLVIAGSAFFVGVFGQNTRRELLLLGIGAAIFFAGWTLQRTRR* |
| Ga0068870_106793332 | 3300005840 | Miscanthus Rhizosphere | MYALSRLVQFAGLVVAGSALFVGLMQRDARRELLILSVGAGIFFAGY |
| Ga0068863_1000436322 | 3300005841 | Switchgrass Rhizosphere | MYALSRGIQLLGLVVAGAAFFVGLLAHDSRRELLLLGVGAAIFFSGQALQRRSR* |
| Ga0068863_1016728162 | 3300005841 | Switchgrass Rhizosphere | MYRISRAVQFLGLVVAGAAFFVGVLGHDVRRELVLLGIGAGIFFAGQALQRGTR* |
| Ga0068858_1003399991 | 3300005842 | Switchgrass Rhizosphere | QFLGLVVAGAALFVGLLGHNVRRELLLLGIGAGIFFAGRALQGRAS* |
| Ga0068858_1024022552 | 3300005842 | Switchgrass Rhizosphere | MYALSRLVQFAGLVVAGSALFVGLMQHDARRELLILGVGAGIFFAGYALQRVRR* |
| Ga0068860_1020797962 | 3300005843 | Switchgrass Rhizosphere | MYALARLVQFAGLVVAGSALFVGVMGKDARRELMVLGIGAAIFLLGYMLQRTTR* |
| Ga0081455_100662722 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MYRIARAIQFVGLVVAGAAFFVGVLGHNVRRELLLLGIGAGIFFAGRALQQKGAP* |
| Ga0080027_100286022 | 3300005993 | Prmafrost Soil | MPRLGRSVQFLGLVVAGAALFVGILSHDSRRELMLLGIGAGLFFSGQALQRSGR* |
| Ga0075028_1004897472 | 3300006050 | Watersheds | MYKLSRGIQFLGLVVAGAALFVGLLGHNSRRELMLLGVGAAVFFTGQFLQRSAK* |
| Ga0082029_10769682 | 3300006169 | Termite Nest | MYRIARAVQFLGLVVAGAAFFVGVLGHNVRRELLLLGIGAGIFFAGRALQKGSP* |
| Ga0075521_104170692 | 3300006642 | Arctic Peat Soil | MYKVSRGIQFLGLVVAGAAFFVGLFGHDARRELMVLGVGAAIFFTGWSLQRSGK* |
| Ga0079220_102652911 | 3300006806 | Agricultural Soil | MYALARLVQFAGLVVAGAAFFVGVMGKDARRELMILGVGAAIFLLGYVMQRARR* |
| Ga0075433_1000027015 | 3300006852 | Populus Rhizosphere | VYVLARGIQFLGLVVAGSALFVGLLGHNVRLELLLLGIGAGVFFAGWGLQKGFR* |
| Ga0075425_1000209552 | 3300006854 | Populus Rhizosphere | MYAAGRAAQFLGLVISGSAFFVGVIGRNERRELWLLGIGAAIFFAGWMLQRTRR* |
| Ga0075425_1021134072 | 3300006854 | Populus Rhizosphere | MLVLARTAQLLGLVITGVGFFVGVLGHDVRRELLLLAVGAAIFFGGRALQARGT* |
| Ga0075435_1000736071 | 3300007076 | Populus Rhizosphere | RCLGREVRGNALEMYAAGRAAQFLGLVISGSAFFVGVIGRNERRELWLLGIGAAIFFAGWMLQRTRR* |
| Ga0066710_1010232882 | 3300009012 | Grasslands Soil | VYALSRAVQLLGLVVAGSAFFVGVFGHNVRRELLLAGLGAGVFFAGRALQGGKK |
| Ga0099828_105742602 | 3300009089 | Vadose Zone Soil | MYAVARSVQFLGLVVAGSALFVGLLGHNVRRELLLLAVGAAIFFAGRALQGGDR* |
| Ga0105245_129271051 | 3300009098 | Miscanthus Rhizosphere | QFAGLVIAGAAFFVGVMGHDERRELLLLAFGAAVFTAGWLLQRGVR* |
| Ga0105247_110737732 | 3300009101 | Switchgrass Rhizosphere | MYSLSRLVQFAGLVVAGSALFVGLMQRDARRELLILSVGAGIFFAGYALQRVRR* |
| Ga0105243_126478881 | 3300009148 | Miscanthus Rhizosphere | VRLLARLVQFAGLVIAGAAFFVGVMGHDERRELLLLAFGAAVFTAGW |
| Ga0105092_100017302 | 3300009157 | Freshwater Sediment | MYRLARAVQFLGLVVAGAAFFVGVFGHNVRRELLLLGIGAGIFFAGRALQRGGP* |
| Ga0105100_102540272 | 3300009166 | Freshwater Sediment | VYRISRAVQFLGLVVAGAAFFVGVLGHDVRRELVLLGIGAGIFFAGQALQRGVR* |
| Ga0105237_125831802 | 3300009545 | Corn Rhizosphere | MYALARLVQFAGLVVAGAAFFVGVMGKDARRELVILGVGAAIFLLGYMMQRAR |
| Ga0105064_11420442 | 3300009821 | Groundwater Sand | VYRLARAVQFLGLVVAGSALFVGLLGHNVRRELLLLGIGAGVFFAGRALEPGAR* |
| Ga0126376_102579843 | 3300010359 | Tropical Forest Soil | MYTLSRAVQFLGLVIAGAAFFVGVLGANVRRELALLGIGAAVFFAGRALQGRAK* |
| Ga0126372_121805262 | 3300010360 | Tropical Forest Soil | VYTVARLIQFLGLVVAGAALFVGFLGHDARRELIVLGIGAGLFFAGRGLQKGFR* |
| Ga0126377_101191292 | 3300010362 | Tropical Forest Soil | MYALARAIQFLGLIVAGSALFVGFLGHDARRELLVLGIGAALFFAGRGLQRGFR* |
| Ga0126377_113539352 | 3300010362 | Tropical Forest Soil | MYALARAIQFLGLVVAGSALFVGFLGHDARRELLVLGIGAALFFAGRGLQKGFR* |
| Ga0134128_111482442 | 3300010373 | Terrestrial Soil | MVQFAGLVIAGAAFFVGVIGHDERRELLLLGLGAAVFTAGWLLQRSVG* |
| Ga0120114_10294511 | 3300011998 | Permafrost | EEARLGLPVLGLVVAGSAFFVGVLGHNVRRELLLLGLGAGIFFAGQALQRSSR* |
| Ga0157295_103636441 | 3300012906 | Soil | RLVQFAGLVVAGSALFVGVMGKDARRELMVLGIGAAIFLLGYMLQRTTR* |
| Ga0126375_108553222 | 3300012948 | Tropical Forest Soil | VRFLARLVQFAGLVIAGSGFFVGLLGHDERRELLLLAIGAGVFTSGWLLQRSVR* |
| Ga0164301_108103502 | 3300012960 | Soil | MYALSRLVQFAGLVVAGSALCVGLMQRDARRELLILSVGAGIFFAGYALQRVRR* |
| Ga0164302_109918191 | 3300012961 | Soil | MYAFSRLVQFAGLVVAGSALFVGLMQHDARRELLILGVGAGIFFAGYALQRVRR* |
| Ga0163162_131484362 | 3300013306 | Switchgrass Rhizosphere | SMYALSRLVQFAGLVVAGSALFVGVMGKDARRELMVLGVGAAIFLLGYMLQRTTR* |
| Ga0120109_10294742 | 3300014052 | Permafrost | VYALSRAVQLLGLVVAGSAFFVGVIGHNVRRELLLLGLGAGIFFAGQALQRSSR* |
| Ga0120125_10793952 | 3300014056 | Permafrost | VYALSRAVQLLGLVVAGSAFFVGVLGHNVRRELLLLGLGAGIFFAGQALQRSSR* |
| Ga0075352_11936462 | 3300014324 | Natural And Restored Wetlands | VYALARTVQFLGLVVAGAALFVGVLGHNVRRELVLLGAGAAIFFAGYALQRSGR* |
| Ga0163163_102250512 | 3300014325 | Switchgrass Rhizosphere | MYKLGRSVQFLGLVVAGSALFVGVLSHDSRRELMLLGVGAGIFFSGYALQRSGK* |
| Ga0120104_10141923 | 3300014829 | Permafrost | SRAVQLLGLVVAGSAFFVGVLGHNVRRELLLLGLGAGIFFAGQALQRSSR* |
| Ga0157379_104750572 | 3300014968 | Switchgrass Rhizosphere | MYALSRLVQFAGLVVAGSALFVGLMQRDARRELLILSVGVGIFFAGYALQRVRR* |
| Ga0157376_129518482 | 3300014969 | Miscanthus Rhizosphere | MYALSRGIQLLGLVVAGAAFFVGLLGHDSRRELMLLGVGAAVFFSGQALQRRSR* |
| Ga0167643_10646401 | 3300015089 | Glacier Forefield Soil | MYALGRTAQFLGLVISGAAFFVGVLGQNSRRELGLLGIGAAVFFAGWLLQRGRR* |
| Ga0167634_10207192 | 3300015090 | Glacier Forefield Soil | VYALARSVQFLGLVVAGAALFVGVLGQNVRRELMLLGIGAALFFAGRALQRSAR* |
| Ga0167631_10273742 | 3300015168 | Glacier Forefield Soil | VYAISRMVQLLGLVVAGSAFFVGVLGHDVRRELVLLGLGAAIFFTGHALQRSVR* |
| Ga0167631_10340341 | 3300015168 | Glacier Forefield Soil | MYALGRTAQFLGLVISGAAFFVGVLGQNSRRELGLLGIGAAVFFAGWMLQRGRR* |
| Ga0163161_106565762 | 3300017792 | Switchgrass Rhizosphere | MYRMARAVQFLGLVVAGAALFVGLLGHNVRRELLLLGIGAGIFFAGRALQGRAS |
| Ga0187785_103871852 | 3300017947 | Tropical Peatland | VYAAGRAVQFLGLVVSGSAFFVGVFDQNSRRELLLLGIGAAIFFAGWTLQRTRR |
| Ga0187779_100057156 | 3300017959 | Tropical Peatland | VYAAGRAIQFFGLVVAGAAFFVGVLGADSRRELTLLAIGAAIFFAGWMLQRGRR |
| Ga0187777_110132492 | 3300017974 | Tropical Peatland | VYAAGRAIQFLGLVVAGAAFFVGVIGQNSRRELAVLGLGAAIFLAGWLLQKGRR |
| Ga0184637_101734382 | 3300018063 | Groundwater Sediment | LYPVARAVQFLGLVVAGSALFVGLLGHNVRRELLLLAVGAAIFLAGYGLQRGHR |
| Ga0184632_102873231 | 3300018075 | Groundwater Sediment | LYPAARAVQFLGLVVAGSALFVGLLGHNVRRELLLLAVGAAIFLAGYGLQRGHRRRTESCWRPESC |
| Ga0184629_100038724 | 3300018084 | Groundwater Sediment | MHALGRTVQFAGLVVAGAAFFVGVFGHEVRRELLLLGIGAGIFFAGYALQRSGK |
| Ga0173481_104817962 | 3300019356 | Soil | MYALSRLVQFAGLVVAGSALFVGVMGKDARRELMVLGVGAAIFLLGYMLQRTTR |
| Ga0210402_100100624 | 3300021478 | Soil | MYALGRTAQFLGLVISGAAFFVGVLGQNSRRELGLLGIGAAVFFAGWLLQRGRR |
| Ga0209640_106990322 | 3300025324 | Soil | MYRLARAVQFLGLVVAGSALFVGLLGHNVRRELLLLGIGAGVFFAGRALQGGAQ |
| Ga0210076_10823662 | 3300025567 | Natural And Restored Wetlands | MYRMARAVQFLGLVVAGAAFFVGLLGHNVRRELLLLGIGAGIFFAGRALQGRAS |
| Ga0207680_100281723 | 3300025903 | Switchgrass Rhizosphere | MYALSRLVQFAGLVVAGSALFVGLMQRDARRELLILSVGAGIFFAGYALQRVRR |
| Ga0207643_100038474 | 3300025908 | Miscanthus Rhizosphere | MYRMARAIQFLGLVVAGAALFVGLLGHNVRRELLLLGIGAGIFFAGRALQGRAS |
| Ga0207684_102246772 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVLARSAQLLGLIVTGAAFFVGVLGHNVRRELLLLAIGAAIFFAGRALQARGA |
| Ga0207654_105365322 | 3300025911 | Corn Rhizosphere | VRLLARLVQFAGLVIAGAAFFVGVMGHDERRELLLLAFGAAVFTAG |
| Ga0207649_115717331 | 3300025920 | Corn Rhizosphere | MYRMARAVQFLGLVVAGAALFVGLLGHNVRRELLLLGIGAGIFFAG |
| Ga0207701_113915142 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALARLVQFAGLVVAGSALFVGVMGKDARRELMVLGIGAAIFLLGYMLQRTTR |
| Ga0207644_107123062 | 3300025931 | Switchgrass Rhizosphere | LVQFAGLVVAGSALFVGLMQRDARRELLILSVGAGIFFAGYALQRVRR |
| Ga0207644_112914422 | 3300025931 | Switchgrass Rhizosphere | MYAVSRLVQFAGLVVAGSALFVGLMQHDARRELLILGVGAGIFFAGYALQRVRR |
| Ga0207669_110873361 | 3300025937 | Miscanthus Rhizosphere | MYALSRLVQFAGLVVAGSALFVGLMQRDARRELLILSVGAGIFFA |
| Ga0207679_112971592 | 3300025945 | Corn Rhizosphere | SRLVQFAGLVVAGSALFVGVMGKDARRELMVLGVGAAIFLLGYMLQRTTR |
| Ga0207658_100492043 | 3300025986 | Switchgrass Rhizosphere | MYRMARGVQFLGLVVAGAALFVGLLGHNVRRELLLLGIGAGIFFAGRALQGRAS |
| Ga0207658_100539953 | 3300025986 | Switchgrass Rhizosphere | MYALSRLVQFAGLVVAGSALFVGLMQRDARRELLILSVGAGIFFAGYALQR |
| Ga0207703_117066341 | 3300026035 | Switchgrass Rhizosphere | NPDTFSLSMYALARLVQFAGLVVAGSALFVGVMGKDARRELMVLGIGAAIFLLGYMLQRTTR |
| Ga0207678_102104371 | 3300026067 | Corn Rhizosphere | AIQFLGLVVAGAALFVGLLGHNVRRELLLLGIGAGIFFAGRALQGRAS |
| Ga0207641_100112612 | 3300026088 | Switchgrass Rhizosphere | MYALSRGIQLLGLVVAGAAFFVGLLAHDSRRELLLLGVGAAIFFSGQALQRRSR |
| Ga0207641_101825082 | 3300026088 | Switchgrass Rhizosphere | MYKLGRSVQFLGLVVAGSALFVGVISHDSRRELMLLGVGAGIFFSGYALQRSGK |
| Ga0207641_110890842 | 3300026088 | Switchgrass Rhizosphere | MYRISRAVQFLGLVVAGAAFFVGVLGHDVRRELVLLGIGAGIFFAGQALQRGTR |
| Ga0207641_119930842 | 3300026088 | Switchgrass Rhizosphere | SPSMYALSRLVQFAGLVVAGSALFVGLMQHDARRELLILGVGAGIFFAGYALQRVRR |
| Ga0209863_100678822 | 3300026281 | Prmafrost Soil | MPRLGRSVQFLGLVVAGAALFVGILSHDSRRELMLLGIGAGLFFSGQALQRSGR |
| Ga0209843_10312902 | 3300027511 | Groundwater Sand | VYRLARAVQFLGLVVAGSALFVGLLGHNVRRELLLLGIGAGVFFAGRALEPGAR |
| Ga0209819_100480302 | 3300027722 | Freshwater Sediment | MYRLARAVQFLGLVVAGAAFFVGVFGHNVRRELLLLGIGAGIFFAGRALQRGGP |
| Ga0209814_104376921 | 3300027873 | Populus Rhizosphere | VYVLARGIQFLGLVVAGSALFVGLLGHNVRLELLLLGIGAGVFFAGWGLQKGFR |
| Ga0209048_1000005581 | 3300027902 | Freshwater Lake Sediment | MYALGRTVQFLGLVVAGAALFVGVIGQNSRRELGLLGVGAAIFFAGWMLQRGRR |
| Ga0209048_100252804 | 3300027902 | Freshwater Lake Sediment | MYAVSRAVQFLGLIVAGAALFVGVLGHDVRRELMLLGIGAAIFFAGYGLQRSAR |
| Ga0268264_118920062 | 3300028381 | Switchgrass Rhizosphere | MYALSRLVQFAGLVVAGSALFVGLMQRDARRELIILSVGAGIFFAGYALQRVRR |
| Ga0247828_103245892 | 3300028587 | Soil | MSRAVQFLGLVVSGAALFVGLLGHNVRRELLLAGIGAGIFFAGYALQRSAR |
| Ga0307503_101495282 | 3300028802 | Soil | MYALSRGVQLLGLVVAGAAFFVGFLGHDSRRELMLLGIGAAIFFSGQVLQRRSR |
| Ga0247826_104661172 | 3300030336 | Soil | MSRAVQFLGLVVSGAALFVGLLGHNVRRELLLAGIGAGIFFAGYALQR |
| Ga0247826_114215041 | 3300030336 | Soil | SRAVQFLGLVVSGAALFVGLLGHNVRRELLLAGIGAGIFFAGYALQRSAR |
| Ga0307497_106898041 | 3300031226 | Soil | MYALSRGVQLLGLVVAGAAFFVGFLGHDSRRELMLLGIGAAIFFSGQVLQ |
| Ga0310888_102745031 | 3300031538 | Soil | MARAVQFLGLVVAGAALFVGLLGHNVRRELLLLGIGAGIFFAGRALQGRAS |
| Ga0318515_102898132 | 3300031572 | Soil | VYAAGRAVQFVGLVVAGAAFFVGVLDADSRRELTLLAIGAAIFFGGWMLQRGRR |
| Ga0318574_105906641 | 3300031680 | Soil | VQFVGLVVAGAAFFVGVLDADSRRELTLLAIGAAIFFGGWMLQRGRR |
| Ga0307469_106418272 | 3300031720 | Hardwood Forest Soil | VYAVSRAVQFLGLVIAGAAFFVGVLGSNVRRELALLGIGAAVFFAGRALQGRTR |
| Ga0307468_1004016792 | 3300031740 | Hardwood Forest Soil | MYALARVIQFLGLVVAGSALFVGFLGHDARRELLVLGIGTALFFAGRGLQKGFR |
| Ga0307468_1020359602 | 3300031740 | Hardwood Forest Soil | MYRMARAVQFLGLVVAGAALFVGLLGHNVRRELLLLGIGAGIFFAGRALQGRVS |
| Ga0318566_100836572 | 3300031779 | Soil | VYAAGRAVQFLGLVVAGAAFFVGVLGADSRKELTLLAIGAAIFFGGWMLQRGRR |
| Ga0318517_102207082 | 3300031835 | Soil | VYAAGRAVQFLGLVVAGAAFFVGVLGADSRKELTLLAIGAAIFFAGWM |
| Ga0306926_121915801 | 3300031954 | Soil | FLGLVVAGAALFVGVLDADSRRELTLLAIGAAIFFGGWMLQRGRR |
| Ga0315278_100286041 | 3300031997 | Sediment | MYKLGRSVQFIGLVVAGASLFVGVLGHEVRRELLLLGLGAGIFSAGYMLQRSGK |
| Ga0315278_118425792 | 3300031997 | Sediment | MYALGRTVQFVGLVVAGAALFVGVLGHEVRRELLLLGIGAGVFSAGYVLQRSGK |
| Ga0310903_100363672 | 3300032000 | Soil | MYRMARAVHFLGLVVAGAALFVGLLGHNVRRELLLLGIGAGIFFAGRALQGRAS |
| Ga0318525_104623792 | 3300032089 | Soil | VQFLGLVVAGAAFFVGVLGADSRKELTLLAIGAAIFFAGWMLQRGRR |
| Ga0307472_1024291761 | 3300032205 | Hardwood Forest Soil | MYALSRGVQLLGLVVAGAAFFVGFLGHDSRRELMLLGIGAAIFFSGQALQRRSR |
| Ga0307472_1026505652 | 3300032205 | Hardwood Forest Soil | VRLLARLVQFAGLVIAGAAFFVGVIGRDERRELLLLAIGAAVFTAGWLGQRSVR |
| Ga0335085_102682653 | 3300032770 | Soil | VRAAGRVVQFLGLVVAGSAFFVGVFGRDERRELWLLGIGAAIFFGGWMLQRTRR |
| Ga0335082_102991213 | 3300032782 | Soil | VYAAGRAVQFLGLVISGSAFFVGVFGGNERRELWLLGIGAAIFFAGWMLQRTRR |
| Ga0335082_107802822 | 3300032782 | Soil | MYAAGRAIQFLGLVVAGAAFFVGVIGQNSRRELAVLGLGAAIFFAGWLLQRGRR |
| Ga0335079_114755251 | 3300032783 | Soil | VYAAGRAIQFLGLVVAGAAFFVGVLDADSRRELTLLAIGAAIFFAGWTLQRGRR |
| Ga0335083_100220854 | 3300032954 | Soil | MYGAGRAIQFLGLVVAGAAFFVGVIGQNSRRELAVLGLGAAIFFAGWLLQRGRR |
| Ga0335076_101655482 | 3300032955 | Soil | VYAAGRAVQFLGLVVAGSAFFVGVIGQNSRRELLILGIGAAIFFAGWTLQRTRR |
| Ga0335084_102408242 | 3300033004 | Soil | MSSSTYALGRAAQFLGLVVAGAALFVGVLGQNSRRELALLGIGAGVFFAGWLLQRGRGRA |
| Ga0316619_111112132 | 3300033414 | Soil | VYRISRAVQFLGLVVAGAAFFVGVLGHDVRRELVLLGIGAGLFFAGQALQRGTR |
| Ga0247829_101669562 | 3300033550 | Soil | MYALSRLVQFAGLVVAGSALFVGLMQHDARRELLILGVGAGIFFAGYALQRVRR |
| Ga0314862_0177613_334_498 | 3300033803 | Peatland | MYAFARLVQFLGLVVAGSALFVGVFGQNVRRELLLLGIGAGIFFAGRALQGRRS |
| Ga0370479_0107942_32_196 | 3300034123 | Untreated Peat Soil | MYRVSRAVQFLGLVVAGSAFFVGVLDHDSRRELVLLGIGAGIFFAGQMLQRGVR |
| Ga0364931_0002209_2608_2772 | 3300034176 | Sediment | VFALGRTVQFFGLVVAGAAFFVGVFGHEVRRELLLLGIGAGIFFAGYALQRSGK |
| Ga0364931_0039355_1251_1409 | 3300034176 | Sediment | PAARAVQFLGLVVAGSALFVGLLGHNVRRELLLLAVGAAIFLAGYGLQRGHR |
| Ga0364934_0109238_404_568 | 3300034178 | Sediment | LYTVARAVQFLGLVVAGSALFVGLLGHNVRRELLLLAVGAAIFLAGHGLQRGHR |
| ⦗Top⦘ |