| Basic Information | |
|---|---|
| Family ID | F044709 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 154 |
| Average Sequence Length | 43 residues |
| Representative Sequence | KTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAELGKTALS |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.92 % |
| % of genes near scaffold ends (potentially truncated) | 95.45 % |
| % of genes from short scaffolds (< 2000 bps) | 83.77 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.052 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.468 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.221 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.195 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.53% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF07969 | Amidohydro_3 | 31.17 |
| PF02113 | Peptidase_S13 | 12.99 |
| PF01904 | DUF72 | 7.79 |
| PF01380 | SIS | 7.79 |
| PF01450 | IlvC | 4.55 |
| PF01427 | Peptidase_M15 | 4.55 |
| PF07991 | IlvN | 3.25 |
| PF07908 | Obsolete Pfam Family | 1.95 |
| PF13620 | CarboxypepD_reg | 1.30 |
| PF01019 | G_glu_transpept | 1.30 |
| PF00069 | Pkinase | 1.30 |
| PF01418 | HTH_6 | 0.65 |
| PF13594 | Obsolete Pfam Family | 0.65 |
| PF10369 | ALS_ss_C | 0.65 |
| PF13378 | MR_MLE_C | 0.65 |
| PF00920 | ILVD_EDD | 0.65 |
| PF13710 | ACT_5 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 15.58 |
| COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 12.99 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 7.79 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 5.19 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 4.55 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 3.25 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 1.30 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 1.30 |
| COG1737 | DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains | Transcription [K] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.05 % |
| Unclassified | root | N/A | 1.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459012|GOYVCMS02H5LTJ | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300001527|A3513AW1_1608675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 513 | Open in IMG/M |
| 3300002914|JGI25617J43924_10161463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 761 | Open in IMG/M |
| 3300003223|JGI26343J46809_1000574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2170 | Open in IMG/M |
| 3300004092|Ga0062389_101496232 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300004092|Ga0062389_103410629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300004635|Ga0062388_102624671 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005172|Ga0066683_10071850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2073 | Open in IMG/M |
| 3300005175|Ga0066673_10014844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3454 | Open in IMG/M |
| 3300005435|Ga0070714_101775170 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005450|Ga0066682_10891505 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005529|Ga0070741_10813846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300005541|Ga0070733_10124416 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300005556|Ga0066707_10567053 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005569|Ga0066705_10256173 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300005586|Ga0066691_10549250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300005602|Ga0070762_11123826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300005610|Ga0070763_10808885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300005921|Ga0070766_10179382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1314 | Open in IMG/M |
| 3300005952|Ga0080026_10233973 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300006032|Ga0066696_10468576 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300006046|Ga0066652_101141127 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300006172|Ga0075018_10072593 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300006176|Ga0070765_101407993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300006176|Ga0070765_102160898 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006796|Ga0066665_11300236 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300006797|Ga0066659_11200194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300006800|Ga0066660_10033448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3189 | Open in IMG/M |
| 3300006954|Ga0079219_10811445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300007255|Ga0099791_10007815 | All Organisms → cellular organisms → Bacteria | 4426 | Open in IMG/M |
| 3300007265|Ga0099794_10484702 | Not Available | 650 | Open in IMG/M |
| 3300009088|Ga0099830_10429348 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300009137|Ga0066709_100577014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1598 | Open in IMG/M |
| 3300009137|Ga0066709_101388199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1023 | Open in IMG/M |
| 3300009137|Ga0066709_102889065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300009137|Ga0066709_103734641 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010048|Ga0126373_13010857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300010159|Ga0099796_10239989 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300010303|Ga0134082_10008611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3651 | Open in IMG/M |
| 3300010333|Ga0134080_10494590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300010335|Ga0134063_10214867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300010336|Ga0134071_10171015 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300010358|Ga0126370_10624412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300010358|Ga0126370_10669634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300010361|Ga0126378_11675032 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300010366|Ga0126379_12795685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300011269|Ga0137392_10310341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1304 | Open in IMG/M |
| 3300011270|Ga0137391_10716037 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300011270|Ga0137391_11561827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300012096|Ga0137389_10296547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1368 | Open in IMG/M |
| 3300012189|Ga0137388_10273050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1544 | Open in IMG/M |
| 3300012189|Ga0137388_10739529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
| 3300012189|Ga0137388_11824342 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012202|Ga0137363_11415939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300012203|Ga0137399_10939528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300012203|Ga0137399_11264259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300012207|Ga0137381_10034601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4098 | Open in IMG/M |
| 3300012351|Ga0137386_10995132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300012357|Ga0137384_11591721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300012582|Ga0137358_10434215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300012683|Ga0137398_10696283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300012685|Ga0137397_10740376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300012922|Ga0137394_10400604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1170 | Open in IMG/M |
| 3300012922|Ga0137394_11283095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300012922|Ga0137394_11382774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300012924|Ga0137413_11527337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300012924|Ga0137413_11635774 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012925|Ga0137419_11844898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300012930|Ga0137407_10566783 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300012930|Ga0137407_10985277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300012930|Ga0137407_11903082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300012944|Ga0137410_11488080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300012971|Ga0126369_13585502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300012976|Ga0134076_10196717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300012977|Ga0134087_10157681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300014157|Ga0134078_10031662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1741 | Open in IMG/M |
| 3300014201|Ga0181537_10280212 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300015051|Ga0137414_1157477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1358 | Open in IMG/M |
| 3300015054|Ga0137420_1352011 | All Organisms → cellular organisms → Bacteria | 2901 | Open in IMG/M |
| 3300015245|Ga0137409_10137911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2239 | Open in IMG/M |
| 3300015264|Ga0137403_11187070 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300017656|Ga0134112_10246915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300018060|Ga0187765_11367929 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300018433|Ga0066667_10620993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300019786|Ga0182025_1385201 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
| 3300019887|Ga0193729_1012573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3790 | Open in IMG/M |
| 3300020170|Ga0179594_10109685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300020199|Ga0179592_10367871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300020579|Ga0210407_10428464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 1035 | Open in IMG/M |
| 3300020579|Ga0210407_10431746 | Not Available | 1031 | Open in IMG/M |
| 3300020581|Ga0210399_10003086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12954 | Open in IMG/M |
| 3300020581|Ga0210399_10850337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 743 | Open in IMG/M |
| 3300020581|Ga0210399_10924487 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300020581|Ga0210399_11392996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300020583|Ga0210401_10288689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1501 | Open in IMG/M |
| 3300021086|Ga0179596_10330377 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300021088|Ga0210404_10045269 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
| 3300021170|Ga0210400_10671890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300021171|Ga0210405_10112384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2150 | Open in IMG/M |
| 3300021171|Ga0210405_10254963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1388 | Open in IMG/M |
| 3300021180|Ga0210396_10669516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300021402|Ga0210385_11197721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 583 | Open in IMG/M |
| 3300021404|Ga0210389_10955723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300021405|Ga0210387_10362031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1282 | Open in IMG/M |
| 3300021406|Ga0210386_11282972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300021432|Ga0210384_11748118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300021475|Ga0210392_10081839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2080 | Open in IMG/M |
| 3300021478|Ga0210402_11975905 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300021479|Ga0210410_10337705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1351 | Open in IMG/M |
| 3300021559|Ga0210409_10906610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300022724|Ga0242665_10102618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300024330|Ga0137417_1257584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4512 | Open in IMG/M |
| 3300025916|Ga0207663_10708198 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300026277|Ga0209350_1154257 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300026530|Ga0209807_1173956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300026548|Ga0209161_10008762 | All Organisms → cellular organisms → Bacteria | 7742 | Open in IMG/M |
| 3300026552|Ga0209577_10221303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1442 | Open in IMG/M |
| 3300026555|Ga0179593_1212889 | All Organisms → cellular organisms → Bacteria | 2365 | Open in IMG/M |
| 3300027480|Ga0208993_1049919 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300027576|Ga0209003_1069755 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300027583|Ga0209527_1100237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300027643|Ga0209076_1009111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2504 | Open in IMG/M |
| 3300027643|Ga0209076_1035042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1405 | Open in IMG/M |
| 3300027655|Ga0209388_1078045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300027667|Ga0209009_1014283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1897 | Open in IMG/M |
| 3300027729|Ga0209248_10182768 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300027737|Ga0209038_10096449 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300027846|Ga0209180_10644301 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300027846|Ga0209180_10656738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 574 | Open in IMG/M |
| 3300027862|Ga0209701_10059066 | All Organisms → cellular organisms → Bacteria | 2446 | Open in IMG/M |
| 3300027862|Ga0209701_10594454 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300027875|Ga0209283_10110853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1801 | Open in IMG/M |
| 3300027882|Ga0209590_10047165 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
| 3300027908|Ga0209006_11165656 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300027965|Ga0209062_1006716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10337 | Open in IMG/M |
| 3300027986|Ga0209168_10251843 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300028536|Ga0137415_10184542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1910 | Open in IMG/M |
| 3300028773|Ga0302234_10293755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300028906|Ga0308309_10009973 | All Organisms → cellular organisms → Bacteria | 5900 | Open in IMG/M |
| 3300030906|Ga0302314_10597526 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300031720|Ga0307469_10889137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300031753|Ga0307477_10531206 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300031753|Ga0307477_10676081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 692 | Open in IMG/M |
| 3300031754|Ga0307475_10527370 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300031754|Ga0307475_10598322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300031771|Ga0318546_10265140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1184 | Open in IMG/M |
| 3300031823|Ga0307478_10211335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1564 | Open in IMG/M |
| 3300031962|Ga0307479_10191477 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
| 3300031962|Ga0307479_10880530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300031981|Ga0318531_10314306 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300032044|Ga0318558_10666864 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300032180|Ga0307471_102277133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300032180|Ga0307471_103707414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.44% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.55% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.25% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.60% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.30% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.65% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.65% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.65% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 3300001527 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-5cm-13A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N56_05071100 | 2170459012 | Grass Soil | LTKARAKIVPGHKIVLRYYGKHGWAEMTYERRVAELGKTSLS |
| A3513AW1_16086752 | 3300001527 | Permafrost | ARAKIEPGHKIVLRYYGKRGLVEMTFERRVAELGKLALS* |
| JGI25617J43924_101614631 | 3300002914 | Grasslands Soil | VNGEWVELSDSLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS* |
| JGI26343J46809_10005741 | 3300003223 | Bog Forest Soil | LTKARAKIVPGHKIVLRYYGKHGWAEMTYERRVAEMGKASLS* |
| Ga0062389_1014962321 | 3300004092 | Bog Forest Soil | SYLVNGQWVELSDSLLKARAKIEPGHKISLRYYGKNGLVEMIYERRVAELGKTALG* |
| Ga0062389_1034106292 | 3300004092 | Bog Forest Soil | SLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVVDMGKTALS* |
| Ga0062388_1026246712 | 3300004635 | Bog Forest Soil | LVNGQWVELSDSLLKARAKIEPGHKISLRYYGKNGLVEMIYERRVAELGKTALS* |
| Ga0066683_100718501 | 3300005172 | Soil | LIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAELGKTALS* |
| Ga0066673_100148441 | 3300005175 | Soil | SDSLIKTRAKIAPGHKIVLRYYGKHGLVEMTYERRVAEMGKTSLS* |
| Ga0070714_1017751702 | 3300005435 | Agricultural Soil | ELSDSVVRSRAKLEPGHKIVFRYRGKHGWCEIVYKRRVAELGKTSLG* |
| Ga0066682_108915051 | 3300005450 | Soil | NGEWVELSDSLIKTRAKIKPGHKIVLRYYGKHGLVEMTYERRVAEMGKTSLS* |
| Ga0070741_108138462 | 3300005529 | Surface Soil | VKSRARIEPGHKIIFKYHGKSGVVEVIYERRLAVLGKTALS* |
| Ga0070733_101244162 | 3300005541 | Surface Soil | VDGEWVTLSDSLTKARAKIVPGHKIVLRFYGKKGWSEMTYERRVAEMGKTSLG* |
| Ga0066707_105670531 | 3300005556 | Soil | GEWVELSDSLIKTRAKIKPGHKIVLRYYGKHGLVEMTYERRVAEMGKTSLS* |
| Ga0066705_102561732 | 3300005569 | Soil | IAPGHKIVLRYYGKHGLVEMTYERRVAEMGKTSLS* |
| Ga0066691_105492501 | 3300005586 | Soil | WVELSDSLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS* |
| Ga0070762_111238261 | 3300005602 | Soil | IKAKARIEPGHKIVLRYYGKHGLVEMTYERRVAELGKTALS* |
| Ga0070763_108088853 | 3300005610 | Soil | LVKARAKIEPGHKIVLRYYGKHGLVEMTYERRVAELGKTSLS* |
| Ga0070766_101793822 | 3300005921 | Soil | AKIVPGHKIVLRYYGKHGWAEMTYERRVAEMGKTSLG* |
| Ga0080026_102339732 | 3300005952 | Permafrost Soil | MSDAMIKARAKIEPGHKIVLRYYGKRGLVEMTFERRVAELGKTLLS* |
| Ga0066696_104685763 | 3300006032 | Soil | KTRAKIAPGHKIVLRYYGKHGLVEMTYERRVAEMGKTSLS* |
| Ga0066652_1011411273 | 3300006046 | Soil | EPGHKIVLRYHGKHGFVEMTYERRVVELGKTALS* |
| Ga0075018_100725933 | 3300006172 | Watersheds | LSDSLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTSLS* |
| Ga0070765_1014079931 | 3300006176 | Soil | GQWVTLSDSLTKARAKIVPGHKIVLRYYGKHGWAEMTYERRVAEMGKTSLS* |
| Ga0070765_1021608981 | 3300006176 | Soil | RSRAKIEPGHKIVFRYRGKHGWCEMVYERRVAELGKTSLI* |
| Ga0066665_113002361 | 3300006796 | Soil | IKAKARIEPGHKIVLRYYGKHGLVEMTYVRRVAELGKTALS* |
| Ga0066659_112001942 | 3300006797 | Soil | RAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS* |
| Ga0066660_100334482 | 3300006800 | Soil | ELSDSLIKTRAKIQPGHKILLRYHGKHGLVEVIYERRVAELGKTALS* |
| Ga0079219_108114452 | 3300006954 | Agricultural Soil | RSRAKIEPGHKIVFRYRGKHGWCEMTYERRVAELGKTSLS* |
| Ga0099791_100078151 | 3300007255 | Vadose Zone Soil | RAKIEPGHKIVFRYHGKHGWCEMIYERRLAELGKTSLS* |
| Ga0099794_104847022 | 3300007265 | Vadose Zone Soil | SRAKIAPGHKIVFRYYGKHGFVEMVYERRLAELGKTSLS* |
| Ga0099830_104293483 | 3300009088 | Vadose Zone Soil | IEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS* |
| Ga0066709_1005770144 | 3300009137 | Grasslands Soil | WVELSDSLIKTRAKIEPGHKIVLRYHGKHGFVEMTYERRVVELGKTALS* |
| Ga0066709_1013881992 | 3300009137 | Grasslands Soil | AKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS* |
| Ga0066709_1028890651 | 3300009137 | Grasslands Soil | KIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS* |
| Ga0066709_1037346411 | 3300009137 | Grasslands Soil | RAKIKRGHKIVLRYYGKHGLVEMTYERRVAEMGKTSLS* |
| Ga0099792_108622321 | 3300009143 | Vadose Zone Soil | EPGHKIVFRYHGKHGWCEMIYERRLAELGKTSLS* |
| Ga0126373_130108571 | 3300010048 | Tropical Forest Soil | SRAKIEPGHRIVFRYHGKHGWCEMVYERRLAELGKTNLG* |
| Ga0099796_102399893 | 3300010159 | Vadose Zone Soil | VELSESAVRSRAKIEPGHKIVFRYRGKHGWCEMTYERRVADLG |
| Ga0134082_100086112 | 3300010303 | Grasslands Soil | ELSDSLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS* |
| Ga0134080_104945901 | 3300010333 | Grasslands Soil | IKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAELGKTALS* |
| Ga0134063_102148672 | 3300010335 | Grasslands Soil | DSLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS* |
| Ga0134071_101710152 | 3300010336 | Grasslands Soil | VELSDSLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAELGKTALS* |
| Ga0126370_106244123 | 3300010358 | Tropical Forest Soil | IKTRAKIEPGHKIVLRYHGKHGFVEMTYERRVVELGKTALS* |
| Ga0126370_106696343 | 3300010358 | Tropical Forest Soil | AKIEPGHKIVLRYFGKHGFVEMTYERRVVELGKTALS* |
| Ga0126378_116750321 | 3300010361 | Tropical Forest Soil | GQWVELSDSLVKTRAKIEPGHKIVLRYFGRHGFVEMTYERRVAELGKTALS* |
| Ga0126379_127956852 | 3300010366 | Tropical Forest Soil | AKIQPGHKILLRYHGKHGLVEVIYERRVAELGKTALS* |
| Ga0137392_103103411 | 3300011269 | Vadose Zone Soil | KTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTKLS* |
| Ga0137391_107160371 | 3300011270 | Vadose Zone Soil | LSDSLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS* |
| Ga0137391_115618271 | 3300011270 | Vadose Zone Soil | TRAKIEPGHKIVLRYYGKHGLVEMTYERRVAELGKTALS* |
| Ga0137389_102965473 | 3300012096 | Vadose Zone Soil | SDSLIKTRAKIKPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS* |
| Ga0137388_102730503 | 3300012189 | Vadose Zone Soil | SDSLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTKLS* |
| Ga0137388_107395291 | 3300012189 | Vadose Zone Soil | IEPGHKIVLRYYGKHGLVEMTYVRRVAELGKTALS* |
| Ga0137388_118243422 | 3300012189 | Vadose Zone Soil | EPGHKIVLRYYGKHGLVEMTYERRVAEMGKTKLS* |
| Ga0137363_114159391 | 3300012202 | Vadose Zone Soil | SYLVNGEWVELSDSLIKTRAKIKPGHKIVLRYYGKHGLVEMTYERRVAEMGKTSLS* |
| Ga0137399_109395283 | 3300012203 | Vadose Zone Soil | ELSDSLIKAKAKIEPGHKIVLRYYGKHGLVEMIYERRVAELGKTALS* |
| Ga0137399_112642592 | 3300012203 | Vadose Zone Soil | ARIEPGHKIVLRYYGKHGLVEMTYVRRVAELGKTALS* |
| Ga0137381_100346011 | 3300012207 | Vadose Zone Soil | IEPGYKIVLRYYGKHGLVEMTYERRVAETGKTALS* |
| Ga0137386_109951321 | 3300012351 | Vadose Zone Soil | RAKIEPGHKIVLCYYGKHGLVEMTYERRVAEMGKTALS* |
| Ga0137384_115917211 | 3300012357 | Vadose Zone Soil | SLIKTRAKIEPGYKIVLRYYGKHGLVEMTYERRVAETGKTALS* |
| Ga0137358_104342152 | 3300012582 | Vadose Zone Soil | SDSLIKAKAKIEPGHKIVLRYYGKHGLVEMIYERRVAELGKTALS* |
| Ga0137398_106962831 | 3300012683 | Vadose Zone Soil | KSRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTSLS* |
| Ga0137397_107403762 | 3300012685 | Vadose Zone Soil | LSDSLIKAKARIEPGHKIVLRYYGKHGLVEMTYVRRVAELGKTALS* |
| Ga0137394_104006043 | 3300012922 | Vadose Zone Soil | KARIEPGHKIVLRYYGKHGLVEMTYVRRVAELGKTALS* |
| Ga0137394_112830952 | 3300012922 | Vadose Zone Soil | EPGHKIVLRYYGKHGLVEMTYVRQVAELGKTALS* |
| Ga0137394_113827742 | 3300012922 | Vadose Zone Soil | DSLIKAKARIEPGHKIVLRYYGKHGLVEMTYVRRVAELGKTALS* |
| Ga0137413_115273372 | 3300012924 | Vadose Zone Soil | AKIEPGHKIVFRYRGKHGWCEMTYERRVADLGKTSLS* |
| Ga0137413_116357741 | 3300012924 | Vadose Zone Soil | KMEPGHKIVFRYRGKHGWCEMVYERRVAELGKTSLG* |
| Ga0137419_118448981 | 3300012925 | Vadose Zone Soil | LSDSAVRSRAKIEPGHKIVFRYRGKHGWCEMTYERRVAELGKTSLS* |
| Ga0137407_105667831 | 3300012930 | Vadose Zone Soil | AKIEPGHKIVFRYRGRHGWCEMVYERRVAELGKTSLI* |
| Ga0137407_109852772 | 3300012930 | Vadose Zone Soil | QWVELSDSLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS* |
| Ga0137407_119030821 | 3300012930 | Vadose Zone Soil | ELSDSLIKAKARIEPGHKIVLRYYGKHGLVEMTYVRRVAELGKTALS* |
| Ga0137410_114880801 | 3300012944 | Vadose Zone Soil | KAKAKIEPGHKIVLRYYGKHGLVEMIYERRVAELGKTALS* |
| Ga0126369_135855023 | 3300012971 | Tropical Forest Soil | EPGHKIVLRYYGKRGLVEVTYERRVAELGKTALG* |
| Ga0134076_101967171 | 3300012976 | Grasslands Soil | KTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAELGKTALS* |
| Ga0134087_101576811 | 3300012977 | Grasslands Soil | IEPGHKIVLPYYGKHGLVEMTYERRVAEMGKTALS* |
| Ga0134078_100316621 | 3300014157 | Grasslands Soil | RAKIQPGHKILLRYHGKHRLVEVIYERRVAELGKTALS* |
| Ga0181537_102802123 | 3300014201 | Bog | LKARAKLEPGHRIVLHYFGDKGLVEMVYERRVAELGKTSLG* |
| Ga0137414_11574772 | 3300015051 | Vadose Zone Soil | VELSDSLIKTRAKIKPGHKIVLRYYGKHGLVEMTYERRVAEMGKTSLS* |
| Ga0137420_13520115 | 3300015054 | Vadose Zone Soil | MGSGGASDSLIKTRAKIKPGHKIVLRYYGKHGLVEMTYERRVAEMGKTSLS* |
| Ga0137409_101379111 | 3300015245 | Vadose Zone Soil | AKAKIEPGHKIVLRYYGKHGLVEMTYERRVAELGKRALS* |
| Ga0137403_111870702 | 3300015264 | Vadose Zone Soil | MEPGHKIVFRYRGKHGWCEMVYERRVAELGKTSLG* |
| Ga0134112_102469151 | 3300017656 | Grasslands Soil | IRGWVELSDSLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS |
| Ga0187765_113679292 | 3300018060 | Tropical Peatland | AKIAPGHKIVLRYYGKNGLVEMVYERRIAELGKTSLS |
| Ga0066667_106209934 | 3300018433 | Grasslands Soil | IKTRAKIEPGHKIVLRYHGKHGFVEMTYERRVVELGKTALS |
| Ga0182025_13852013 | 3300019786 | Permafrost | MVTGGYVEMSDAFIRARGKIEPGHKIVLRYFGKHGLVEMTFERRVAELGKTWLG |
| Ga0193729_10125735 | 3300019887 | Soil | SDSLIRARAKIEPGHKIVLRYYGKHGLVEMTFERRVAELGKISLS |
| Ga0179594_101096852 | 3300020170 | Vadose Zone Soil | WVELSDSLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS |
| Ga0179592_103678712 | 3300020199 | Vadose Zone Soil | LVKTRAKIEPGHKIVLRYYGKHGLVEVTYERRVAEMGKTALS |
| Ga0210407_104284641 | 3300020579 | Soil | VRSRAKIEPGHKIVFRYHGKHGWCEMIYERRLAELGKTSLS |
| Ga0210407_104317463 | 3300020579 | Soil | ARARIEPGHKIALRYYGKNGLVEIIYERRVAELGKTSLS |
| Ga0210399_100030869 | 3300020581 | Soil | RAKIVPGHKIVLRYYGRHGWAEMTYERRVAEMGKTSLG |
| Ga0210399_108503372 | 3300020581 | Soil | AKIEPGHRIVFRYHGKHGWCEMTYERRLAELGKTSLS |
| Ga0210399_109244871 | 3300020581 | Soil | TLSDSLTKARAKIAPGHKIVLRYYGRHGWAEMTYERRVAEMGRTSLG |
| Ga0210399_113929961 | 3300020581 | Soil | KIEPGHKIVLRYYGKHGLVEMTFERRVVDMGKTALS |
| Ga0210401_102886892 | 3300020583 | Soil | VTLSDSLTKARAKIVPGHKIVLRYYGKHGWAEMTYERRVAEMGKTSLG |
| Ga0179596_103303771 | 3300021086 | Vadose Zone Soil | DSVVRSRAKIEPGHKIVFRYRGKHGWCEMVYERRVADLGKTSLG |
| Ga0210404_100452693 | 3300021088 | Soil | SRAKIEPGHKIVFRYHGKHGWCEMIYERRLAELGKTSLS |
| Ga0210400_106718902 | 3300021170 | Soil | MSDALIRARAKIEPGHKIVLRYYGKRGLVEMTFERRVAELGKLALT |
| Ga0210405_101123843 | 3300021171 | Soil | SDSLTKARAKIVPGHKIVLRYYGKHGWAEMTYERRVAEMGKASLS |
| Ga0210405_102549632 | 3300021171 | Soil | EWVEMSDSLIRARAKIEPGHKIVLRYYGKRGLVEMTFERRVAELGKLALT |
| Ga0210396_106695161 | 3300021180 | Soil | GDWVEMSDALIRARAKIEPGHKIVLRYYGKRGLVEMTFERRVAELGKLALT |
| Ga0210385_111977211 | 3300021402 | Soil | LSDSLTKARAKIVPGHKIVLRYYGKHGWAEMTYERRVAEMGKASLG |
| Ga0210389_109557233 | 3300021404 | Soil | ELSDTLQKTRAKIEPGHKISLRYFGKNGLVEMIYERRVADLGKTSLG |
| Ga0210387_103620311 | 3300021405 | Soil | DSLTKARAKIVPGHKIVLRYYGRHGWAEMTYERRVAEMGKTSLG |
| Ga0210386_112829722 | 3300021406 | Soil | KIVPGHKIVLRYYGKHGWAEMTYERRVAEMGKASLS |
| Ga0210384_117481182 | 3300021432 | Soil | AKIEPGHKIVLRYYGKHGLVEMTFERRVTELGKTALS |
| Ga0210392_100818393 | 3300021475 | Soil | WVELSDTLQKTRAKIEPGHKISLRYFGKNGLVEMIYERRVADLGKTSLG |
| Ga0210402_119759051 | 3300021478 | Soil | KTRAKIEPGHKIVLRYYGKTGLVEMIYERRVAELGKTSLG |
| Ga0210410_103377051 | 3300021479 | Soil | KIVPGHKIVLRYYGRHGWAEMTYERRVAEMGKTSLG |
| Ga0210409_109066102 | 3300021559 | Soil | EMSDALIRARAKIEPGHKIVLRYYGKRGLVEMTFERRVAELGKLALT |
| Ga0242665_101026182 | 3300022724 | Soil | LSDSLIKARAKIEPGHKIVLRCYGKHGLVEMVYERRVAELGKTALI |
| Ga0137417_12575844 | 3300024330 | Vadose Zone Soil | VELSDSLIKTRAKIKPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALI |
| Ga0207663_107081982 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DSVVRSRAKLEPGHKIVFRYRGKHGWCEIVYKRRVAELGKTSLG |
| Ga0209350_11542571 | 3300026277 | Grasslands Soil | EWVELSDSLIKTRAKIKPGHKIVLRYYGKHGLVEMTYERRVAEMGKTSLS |
| Ga0209807_11739561 | 3300026530 | Soil | GQWVELSDSLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS |
| Ga0209161_100087621 | 3300026548 | Soil | TRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS |
| Ga0209577_102213031 | 3300026552 | Soil | ELSDSLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS |
| Ga0179593_12128896 | 3300026555 | Vadose Zone Soil | VELSDSLIKTRAKIKPGHKIVLRYYGKHGLVEMTYERRVAEMGKTSLS |
| Ga0208993_10499191 | 3300027480 | Forest Soil | TYLVTGQWVEMSDALVKARAKIEPGHKIVLRYYGKHGLVEMTFERRVAELGKLALS |
| Ga0209003_10697552 | 3300027576 | Forest Soil | VNGEWVELSDTLQKTRAKIEPGHKISLRYFGKNGLVEMIYERRVADLGKTSLG |
| Ga0209527_11002372 | 3300027583 | Forest Soil | DSVVKSRAKIAAGHKIVFRYHGKHGWCEMIFERRLAELGKTSLS |
| Ga0209076_10091113 | 3300027643 | Vadose Zone Soil | DSLIKTRAKIKPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALT |
| Ga0209076_10350422 | 3300027643 | Vadose Zone Soil | RSRAKIEPGHKIVFRYHGKHGWCEMIYERRLAELGKTSLS |
| Ga0209388_10780452 | 3300027655 | Vadose Zone Soil | SDSLIKAKAKIEPGHKIVLRYYGKHGLVEMIYERRVAELGKTALS |
| Ga0209009_10142831 | 3300027667 | Forest Soil | TYLVTGEWVEMSDSLIRARAKIEPGHKIVLRYYGKHGLVEMTFERRVAELGKLALS |
| Ga0209248_101827683 | 3300027729 | Bog Forest Soil | ELSDSLLKARAKIEPGHKIVLRYVGKNGVVEMVYERRVAELGTTALS |
| Ga0209038_100964493 | 3300027737 | Bog Forest Soil | LLKARARIAPGHKIVLRYYGKNGYVEMIYERRVAELGKTALS |
| Ga0209180_106443011 | 3300027846 | Vadose Zone Soil | IKARAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS |
| Ga0209180_106567381 | 3300027846 | Vadose Zone Soil | LSDSSVRSRAKIEPGHKIVFRYHGKHGWCEMIYERRLAELGKTSLS |
| Ga0209701_100590664 | 3300027862 | Vadose Zone Soil | ARAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS |
| Ga0209701_105944541 | 3300027862 | Vadose Zone Soil | KTRAKIKPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS |
| Ga0209283_101108531 | 3300027875 | Vadose Zone Soil | AKIEPGHKIVFRYHGKHGWCEMIYERRLAELGKTSLS |
| Ga0209590_100471651 | 3300027882 | Vadose Zone Soil | KIEPGHKIVLRYYGKHGLVEMVYERRVAELGKTALS |
| Ga0209006_111656561 | 3300027908 | Forest Soil | KARARIEPGHKIALRYYGKNGLVEIIYERRVAELGKTSLS |
| Ga0209062_10067169 | 3300027965 | Surface Soil | IEPGHKMVLRFYGKQGLVEIFYERRRAELGKMSLG |
| Ga0209168_102518432 | 3300027986 | Surface Soil | VRSRAKIEPGHKIVFRYRGKHGWCEMVYERRVAELGKTSLS |
| Ga0137415_101845421 | 3300028536 | Vadose Zone Soil | AKAKIEPGHKIVLRYYGKHGLVEMTYVRRVAELGKTALS |
| Ga0302234_102937552 | 3300028773 | Palsa | SDSLLKARAKIEPGHKISLRYYGKNGLVEMIYERRVADLGKISLG |
| Ga0308309_100099731 | 3300028906 | Soil | IVPGHKIVLRFYGKKGWSEMTYERRVAEMGKTSLG |
| Ga0302314_105975261 | 3300030906 | Palsa | LLKARGKIEPGHRIVLHYYGKKGFVEIIYERRVAELGKTALG |
| Ga0307469_108891371 | 3300031720 | Hardwood Forest Soil | LIKTRAKIEPGHKIVLRYFGKHGLVEMTYVRRVAEMGKTALI |
| Ga0307477_105312061 | 3300031753 | Hardwood Forest Soil | VELSDSLIKTRAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS |
| Ga0307477_106760811 | 3300031753 | Hardwood Forest Soil | RSRAKIEPGHKIVFRYHGKHGWCEMTYERRLAELGKTSLS |
| Ga0307475_105273701 | 3300031754 | Hardwood Forest Soil | KIEPGHKIVFRYRGKHGWCEMVYERRVADLGKTSLS |
| Ga0307475_105983221 | 3300031754 | Hardwood Forest Soil | AKIEPGHKIVIKYFGKHGLVEMTYERRVVEIGKSSVS |
| Ga0318546_102651403 | 3300031771 | Soil | LSDSLIKTRAKIQPGHKILLRYHGKRGLVEVIYERRVAELGKTALS |
| Ga0307478_102113351 | 3300031823 | Hardwood Forest Soil | ELSDSAVRSRAKIEPGHKIVFRYRGKHGWCEMTYERRVAELGKTSLS |
| Ga0307479_101914773 | 3300031962 | Hardwood Forest Soil | RAKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS |
| Ga0307479_108805301 | 3300031962 | Hardwood Forest Soil | AKIEPGHKIVLRYYGKHGLVEMTYERRVAEMGKTALS |
| Ga0318531_103143061 | 3300031981 | Soil | WVELSDSLLKTRAKIEPGHKIVLHYFGKHGLVEMVYERRVAELGKTSLG |
| Ga0318558_106668642 | 3300032044 | Soil | WVELSDSLIKTRAKIQPGHKILLRYHGKRGLVEVIYERRVAELGKTALS |
| Ga0307471_1022771331 | 3300032180 | Hardwood Forest Soil | IEPGHKIVLRYYGKHGLVEMTYVRRVAELGKTALS |
| Ga0307471_1037074142 | 3300032180 | Hardwood Forest Soil | AKAKIEPGHKIVLRYYGKHGLVEMTYERRVAELGKTALS |
| ⦗Top⦘ |