| Basic Information | |
|---|---|
| Family ID | F044689 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 154 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VGRYEDAAQVLREFLRDHGDRQEAATARRWLDRLTASGKIRTN |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 4.55 % |
| % of genes from short scaffolds (< 2000 bps) | 4.55 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (94.805 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.533 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF13432 | TPR_16 | 14.94 |
| PF14559 | TPR_19 | 5.84 |
| PF07488 | Glyco_hydro_67M | 4.55 |
| PF04389 | Peptidase_M28 | 3.25 |
| PF13620 | CarboxypepD_reg | 1.95 |
| PF00722 | Glyco_hydro_16 | 1.95 |
| PF13460 | NAD_binding_10 | 1.95 |
| PF07593 | UnbV_ASPIC | 1.30 |
| PF00313 | CSD | 1.30 |
| PF13414 | TPR_11 | 1.30 |
| PF13517 | FG-GAP_3 | 1.30 |
| PF13426 | PAS_9 | 1.30 |
| PF13490 | zf-HC2 | 0.65 |
| PF13407 | Peripla_BP_4 | 0.65 |
| PF00132 | Hexapep | 0.65 |
| PF13557 | Phenol_MetA_deg | 0.65 |
| PF08240 | ADH_N | 0.65 |
| PF07477 | Glyco_hydro_67C | 0.65 |
| PF00933 | Glyco_hydro_3 | 0.65 |
| PF12704 | MacB_PCD | 0.65 |
| PF00069 | Pkinase | 0.65 |
| PF13424 | TPR_12 | 0.65 |
| PF02517 | Rce1-like | 0.65 |
| PF09922 | DUF2154 | 0.65 |
| PF08327 | AHSA1 | 0.65 |
| PF07045 | DUF1330 | 0.65 |
| PF00486 | Trans_reg_C | 0.65 |
| PF01522 | Polysacc_deac_1 | 0.65 |
| PF03935 | SKN1_KRE6_Sbg1 | 0.65 |
| PF17189 | Glyco_hydro_30C | 0.65 |
| PF00903 | Glyoxalase | 0.65 |
| PF01019 | G_glu_transpept | 0.65 |
| PF00989 | PAS | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG3661 | Alpha-glucuronidase | Carbohydrate transport and metabolism [G] | 5.19 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.60 |
| COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 2.60 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.65 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.65 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.65 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 94.81 % |
| All Organisms | root | All Organisms | 5.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300010361|Ga0126378_10898470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300012189|Ga0137388_10503460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300015264|Ga0137403_10814588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300016270|Ga0182036_11242524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300017975|Ga0187782_10012953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6110 | Open in IMG/M |
| 3300021560|Ga0126371_10550465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1303 | Open in IMG/M |
| 3300021560|Ga0126371_10599217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1251 | Open in IMG/M |
| 3300025929|Ga0207664_11879928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.53% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.19% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.25% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.60% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.60% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.30% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.30% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.30% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.65% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_122589572 | 3300000789 | Soil | GRFEDAAQVLREFLRDHASSQEAATARRWLEQLAANGKIRSN* |
| Ga0062385_101930211 | 3300004080 | Bog Forest Soil | VAQSLTAVGRYADAAQALREYVRDHGDRREAATARKWLERLTASGKIRADSN* |
| Ga0062590_1016637714 | 3300004157 | Soil | LLVAQSLTAVGRYEDASQMLREFVRDHADRHEAATARRWLERLTASGKIRAN* |
| Ga0066683_100322101 | 3300005172 | Soil | VAQSLTAVGRYEDAAQALRDFLKSHGDRPEAATARRWLDGLVKNGKIR* |
| Ga0066679_101440022 | 3300005176 | Soil | EDSAETLRQFLKSHGDRPEAMTARRWLEGLAKNGKIRQD* |
| Ga0070687_1014019741 | 3300005343 | Switchgrass Rhizosphere | SLTAVGRYEDSAQTLRDFLRDHSDRQEAATARRWLDRLSSSGKIGNK* |
| Ga0070713_1000155828 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TAVGRYEDAAQALREFLRDYADHREAATARRWLERLSANGKIHAN* |
| Ga0070713_1002957962 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LSAVGRYEDAAQSLREFLHKHGERREAATARRWLDTLAADGKIVVK* |
| Ga0070713_1015108781 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LTAVGKYEDAAQTLRDFLNRYGDRPEAATARHWLDGLAKNGKIHNN* |
| Ga0070710_108666071 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | EDAAQVLREFLGDHASTQEAATARRWVEQLAANGKIRSN* |
| Ga0070711_1003898872 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VGRYEDAAKTLREFLRDYSNRREAAIARRWLDGLAANGKIH* |
| Ga0066707_106100721 | 3300005556 | Soil | RYDDAALTLRDFLKSHSDRPEAGTARRWLDGLVKNGKIRRE* |
| Ga0066707_106658421 | 3300005556 | Soil | AQTLREFLKSHGDRPEAATARRWLDGLVKNGKIRRE* |
| Ga0070762_103164251 | 3300005602 | Soil | RFDDAAQALRDFLKNHGDRSEATTARRYLDRMVADGKIQRQ* |
| Ga0068856_1022159941 | 3300005614 | Corn Rhizosphere | AQSLTAVGKYEDAAQSLRDFLKRYGDRPEAPTAKRWLDGLAKNGKIHSN* |
| Ga0070764_101844542 | 3300005712 | Soil | AQVLREFLKDHADRREASTARRWLEALTTSAKIRVN* |
| Ga0075029_1007091502 | 3300006052 | Watersheds | VGKYEDAAQTLRDFLKRYGDRPEAPTARRWLDGLAHNGKIRAN* |
| Ga0075030_1001601941 | 3300006162 | Watersheds | ARALTAVGKYEDAAQALREFLKRYGDRPEAPTARRWLDGLASNGKIRSK* |
| Ga0075030_1007667761 | 3300006162 | Watersheds | EDAAQSLRDFLKHYGDRPEAPTAQRYLDRLASDGKIHSN* |
| Ga0070715_100033271 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ALREFLRDYADHREAATARRWLERLSANGKIHAN* |
| Ga0070716_1002880401 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EDAAQALREFLRDYADHREAATARRWLERLSANGKIHAN* |
| Ga0070712_1001531211 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EDAAQVLREFLGDHASTQEAATARRWLEQLAANGKIRSN* |
| Ga0070712_1002514911 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AQALREFLRDYADHREAATARRWLERLSANGKIHAN* |
| Ga0070765_1004344821 | 3300006176 | Soil | TAAGKYEDAGQALRDFLKSHSDRPEAPTARRWLERLTTDGKLAKH* |
| Ga0097621_1002483792 | 3300006237 | Miscanthus Rhizosphere | EDAAAALREFIKNNSNRPEAATAKKWLDGLAKNGKIKAN* |
| Ga0075433_118510142 | 3300006852 | Populus Rhizosphere | LVAQSLTAVGRYEDAAHVLRDFLQEHADRREAATARRWLDRLASSGKISSR* |
| Ga0075436_1003956853 | 3300006914 | Populus Rhizosphere | AQSLTAIGQYDDAARTLREFLRDHAECKEAATARRWLEMLIADGKVRAIKD* |
| Ga0099830_100673965 | 3300009088 | Vadose Zone Soil | AVGQYEDSAKTLREFLKDHGDRPEAATARRWLEGLAKNGKIRRE* |
| Ga0099827_113007052 | 3300009090 | Vadose Zone Soil | YEDAAQALRDFLKRYGDRPEAPTARHWLDGLAQNGKIHPN* |
| Ga0116225_15002982 | 3300009524 | Peatlands Soil | VAQSLTAVERYEDAAEVLRKFLRDHADRQEAATARRWLEHLTADGKIRSN* |
| Ga0126374_101776132 | 3300009792 | Tropical Forest Soil | VAQSLTAVGRYEDAGQTLREFVRNHSDFPEAAMARRWLDGLAAKGKIRAH* |
| Ga0126374_103713271 | 3300009792 | Tropical Forest Soil | LTAVGRYEDAARSLREFLRVHADRTEAAMARRWLEQLVADGKIRTN* |
| Ga0126373_104790442 | 3300010048 | Tropical Forest Soil | GRYEDAAQSLREFLRAHADRTEAAMARRWLEQLVADGKIRTN* |
| Ga0126373_129805191 | 3300010048 | Tropical Forest Soil | AAQSLREFLRAHADHTEAATARRWLEQLVADGKIRTN* |
| Ga0074046_106251101 | 3300010339 | Bog Forest Soil | RYEDAAQVLREFLRDHASTQEAVTARRWLEQLAANGKIRSN* |
| Ga0074044_110822172 | 3300010343 | Bog Forest Soil | LTAVGRYEDAAQQLREFLRAHGDRREAPTAQRWLERLTATAKVQPDPN* |
| Ga0126376_100664113 | 3300010359 | Tropical Forest Soil | QSLTALGKYEEAAQTLRDFVKKHPSDSGAMTARRWLEKLAADGKISKN* |
| Ga0126376_103341561 | 3300010359 | Tropical Forest Soil | QSLTAVGKYEEAAQALRDFLKRYSDRPEAGKARRWLDGLAKNGKIHSN* |
| Ga0126372_124545871 | 3300010360 | Tropical Forest Soil | QSSTAVGRYEEAAQTLREFLKDHGDRPECATARRWLEQLTASGEIRPN* |
| Ga0126378_108984703 | 3300010361 | Tropical Forest Soil | VGRYEDAARSLREFLRIHADRTEAAMARRWLEQLVADGKIRNN* |
| Ga0126379_103767922 | 3300010366 | Tropical Forest Soil | LLVAQSLTAVGRYDDAAQSLREFLHKHGDRREAATARRWLERLTVDGKIHSK* |
| Ga0126379_108109351 | 3300010366 | Tropical Forest Soil | VGRYDDAALTLRSFLREHSDRREAAVARRWLERLAASGKINAN* |
| Ga0126381_1026502452 | 3300010376 | Tropical Forest Soil | AVGRYEDAAQALRKFLRDHPQGREADTARRWLDRLAGSGKIASR* |
| Ga0136449_1014024591 | 3300010379 | Peatlands Soil | VLRAFLREHADRQEAATARRWLENLTVNGKIRSN* |
| Ga0136449_1021356011 | 3300010379 | Peatlands Soil | AAQVLREFLRDHASTQEAVTARRWLEQLAANRKIRSN* |
| Ga0150983_110561691 | 3300011120 | Forest Soil | AQALTAVGKYEDAAQALRDFLKHYGGRPEAPTAQRWLDGLAKNGKIHSN* |
| Ga0150983_111061222 | 3300011120 | Forest Soil | EDSAKTLREFLKNHGDRPEAATARRWLEGLAKNGKIRRE* |
| Ga0150983_120947092 | 3300011120 | Forest Soil | YEDAAQALRDFLKHYGGRPEAPTAQRWLDGLAKNGKIHSN* |
| Ga0150983_130510341 | 3300011120 | Forest Soil | TGQYEAAAQALRDFLRQHGDRPEAAKARRWLDRLVADGKAKP* |
| Ga0137393_108141582 | 3300011271 | Vadose Zone Soil | DSAKTLREFLKDHGDRPEAATARRWLEGLAKNGKIRRE* |
| Ga0137389_118052511 | 3300012096 | Vadose Zone Soil | EDAAQALRDFLKRYGDRPEAPTARHWLDGLVQNGKIHPN* |
| Ga0137388_105034602 | 3300012189 | Vadose Zone Soil | LVAQSLSATGRYEDCAQALRDFLKNHADHPEAVTAQRWLARLKQSGKIAQ* |
| Ga0137378_103385352 | 3300012210 | Vadose Zone Soil | VGRYDDAAQTLRTFLKNHGDRPEAGTARRWLDGLANNGKIRRE* |
| Ga0137377_116547081 | 3300012211 | Vadose Zone Soil | VGKYEDAAATLRKFLKDHGDRPEAATAKRWLDGLAKNGKVRQN* |
| Ga0137377_116602051 | 3300012211 | Vadose Zone Soil | RYDDAAQTLRTFLKNHGDRPEAGTARRWLEGLANNGKIRRE* |
| Ga0137372_105179371 | 3300012350 | Vadose Zone Soil | ALRDFLKHYSDRPEATTARRWLDGLASNGKIQSK* |
| Ga0137360_101202282 | 3300012361 | Vadose Zone Soil | LTAVGRYEDSAQALREFLKNHGDNAEAATAKRWLERLNAAGKIHSN* |
| Ga0137361_109458702 | 3300012362 | Vadose Zone Soil | TLRDFLKNHADRPQAPTARRWLEGLVKSGKIKSE* |
| Ga0137361_113861221 | 3300012362 | Vadose Zone Soil | SLTAVGRYDDAAQTLRTFLKNHGDRPEAGTARRWLEGLANNGKIRRE* |
| Ga0137398_102792262 | 3300012683 | Vadose Zone Soil | SLTALGQYEDSAKTLREFLKDHGDRPEAATARRWLDGLVKNGKIR* |
| Ga0137419_107269431 | 3300012925 | Vadose Zone Soil | AQSLTALGQYEDSAKTLRECVRDHSDRPEAATARRWLDGLVKNGKIRQE* |
| Ga0137419_116023912 | 3300012925 | Vadose Zone Soil | YDAAADTLRDFLKNHADRPQAPTARRWLEGLVKSGKIKPQ* |
| Ga0137419_116424252 | 3300012925 | Vadose Zone Soil | YDDAAQTLREFLKSHGDSPEAATARRWLEGLAKNGKIR* |
| Ga0137419_119598741 | 3300012925 | Vadose Zone Soil | AAADTLRDFLKNHADRPQAPTARRWLEGLVKSGKIKSE* |
| Ga0137404_117923102 | 3300012929 | Vadose Zone Soil | VGKYEDAAATLRKFLKDHSDRPEAATAKRWLDGLAKNGKIRQN* |
| Ga0134076_100048071 | 3300012976 | Grasslands Soil | RYEDAAQALRDFLKSHGDRPEAATARRWLDGLVKNGKIR* |
| Ga0181522_109717441 | 3300014657 | Bog | AVGRYEDAADVLREFLREHSNLQEAVTARRWLEQLAADGKIRSH* |
| Ga0157376_113814081 | 3300014969 | Miscanthus Rhizosphere | AVGKYEDAAQALRDFLKHYGDRPEAATARRWLDGLASNGKIQSK* |
| Ga0137420_13310321 | 3300015054 | Vadose Zone Soil | GQYDAAADTLRDFLKNHADRPQAPTARRWLEGLVKKSGKIKSE* |
| Ga0137418_108571062 | 3300015241 | Vadose Zone Soil | YIFRDFLKRYNDQPEAPTTRHWLDSLAKNGKIHPN* |
| Ga0137403_108145882 | 3300015264 | Vadose Zone Soil | LVVAQSLTAVGKYEDAAATLRKFLKEHSDRPEAATAKRWLDGLAKNGKIRQN* |
| Ga0182036_112425242 | 3300016270 | Soil | GRYEDAAQSLREFLRAHADRTEAAMARRWLEQLVADGKIRNN |
| Ga0182036_117056281 | 3300016270 | Soil | VGRYEDAAEALRGFLRDHSEGREADIARRWLDRLAASGRIRAH |
| Ga0182040_108689103 | 3300016387 | Soil | QALREFLRAHADRTEAAMARRWLERLVADGKIRTN |
| Ga0182037_106218012 | 3300016404 | Soil | VELLVAKSLTAVGQYEDAAQSLRDVVKRYSDRPEATTAQRYLDRLKNDGKIHSN |
| Ga0182038_115387991 | 3300016445 | Soil | LVAQSLTAVGRFEDAAQMLREFLRDHASTPEAATARRWLEQLAADGKISSN |
| Ga0187814_104223621 | 3300017932 | Freshwater Sediment | DDSAQALRDFLKNYGDRPEAATARRWLDGLVKNGKVSQK |
| Ga0187819_104672461 | 3300017943 | Freshwater Sediment | RYEDAAEVLREFLRDHADRQEAATARRWLAQLTADGKIRSN |
| Ga0187819_107042381 | 3300017943 | Freshwater Sediment | QALRDFLKNHGDRPEAPTARRWLDGLIKNGKISQN |
| Ga0187819_108533332 | 3300017943 | Freshwater Sediment | AVGRYEDAAQVLREFLRDHADRREAATARRWLERLEASGKIKTN |
| Ga0187782_100129534 | 3300017975 | Tropical Peatland | LAQSLTAVGRYEDAAQTLREFLRDHADRPETATARRWLEQLATNGKIRPT |
| Ga0187805_102225542 | 3300018007 | Freshwater Sediment | LLLAQSLTAVGRYEDAAQVLREFLRDHADRREAGTARRWLERLGASGKIKTN |
| Ga0187770_104198982 | 3300018090 | Tropical Peatland | TAVGRYEDAAKVLRDFLRDHANQPEAATARRWLEQLAGNGKIRAN |
| Ga0187770_107383531 | 3300018090 | Tropical Peatland | TAVGRYEDAAKVLREFLRDYGNVQEAATARRWLDQLAANGKIRAN |
| Ga0066667_100369533 | 3300018433 | Grasslands Soil | AVGRYEDAAQALRDFLKSHGDRPEAATARRWLDGLVKNGKIR |
| Ga0066667_122999831 | 3300018433 | Grasslands Soil | GRYDDAAQTLRTFLKNHGDRPEAGTARRWLEGLAKNGKIGRE |
| Ga0066669_102886991 | 3300018482 | Grasslands Soil | VRYDDAALTLRDFLKSHSDRPEAATARRWLDGLVKNGKIRRE |
| Ga0179594_101103731 | 3300020170 | Vadose Zone Soil | AQTLREYLLEHGDRPEAAKARRWLAGLQANGKLQQ |
| Ga0210407_100791621 | 3300020579 | Soil | GGRYEDAAQVLRAFLRDHGGRPEAVTVRRWLERLTASAKIRAN |
| Ga0210407_108050041 | 3300020579 | Soil | YEDAAQMLREFVRDHADRREAATARRWLERLTASGKISPN |
| Ga0210407_108518302 | 3300020579 | Soil | SLTAVGRYEDAAQVLRAFLRDHGDRREAVTVRRWLERLTANAKIRN |
| Ga0210405_108754662 | 3300021171 | Soil | VAQSLTAVGRYEDAAQVLREFLRDHGDRREAVTARRWLERLTASAKIKPNSN |
| Ga0210405_110071052 | 3300021171 | Soil | VGRYEDAAQVLREFLRDHGDRQEAATARRWLDRLTASGKIRTN |
| Ga0210388_107078503 | 3300021181 | Soil | VAQSLTAVGRYEDAAKALRAFLLQHGNQREAATARKWLERLTASGKIRAD |
| Ga0210393_103405031 | 3300021401 | Soil | RYEDAAQVLREFLKEHGDRREAVTARRWLERLAASGKVRAN |
| Ga0210386_116919772 | 3300021406 | Soil | EDAAQVLREFLKDHADRREAPTARRWLEGLTASAKIRPNSNY |
| Ga0210383_115821622 | 3300021407 | Soil | QVLREFLRDHASAQETATARRWLEQLAANGKIRSN |
| Ga0213878_100995803 | 3300021444 | Bulk Soil | GRYEDAAQTLREFSRDHSEGAEANTARRWLEQLTASGKIAAR |
| Ga0210410_103886751 | 3300021479 | Soil | AVGRYEDAAQVLRAFLRDHGDRREAVTVRRWLERLTANAKIRN |
| Ga0210410_104846442 | 3300021479 | Soil | DAAQALRQFLKNHADHPEAATARRWLERLTVAGKIKNQ |
| Ga0210409_114287532 | 3300021559 | Soil | AAQTLRGFLREHGDRPEAGKARRWLDGLRSSGKIGAE |
| Ga0126371_104675761 | 3300021560 | Tropical Forest Soil | AKSQTAVGQYEDAAQSLRDLVKRYGDRPEAATAQRYLDRLKNDGKIHSN |
| Ga0126371_105504654 | 3300021560 | Tropical Forest Soil | LVAQSLTAVGRYEDAAQSLREFLRAHADRTEAAMARRWLEQLVADGKIRNN |
| Ga0126371_105992173 | 3300021560 | Tropical Forest Soil | LVAQSLTAVGRYEDAAQSLREFLRAHADRTEAAMARRWLERLVADGKIRTN |
| Ga0242655_100040891 | 3300022532 | Soil | VGRYEDAAQALRQFLKNHADHPEAATARRWLERLTVAGKIKNQ |
| Ga0247694_10188011 | 3300024178 | Soil | VGRYEDAAQMLREFVRDHADRREAVTARRWLERLRTNGKIRPI |
| Ga0247673_10056341 | 3300024224 | Soil | DDAARALREFLRDHAERKEAATAQRWLERLIADGKVRAMKN |
| Ga0247680_10339202 | 3300024246 | Soil | QSLSAVGEYDDAARALREFLRDHAERKEAATAQRWLERLIADGKVRAMKN |
| Ga0179589_103404712 | 3300024288 | Vadose Zone Soil | AAQALREFLKSHGDSPEAATARRWLEGLAKNGKIR |
| Ga0207699_100313504 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TAVGRYEDSAQALREFLRRHGERPEAATARRWLDSLAADGKIVVK |
| Ga0207663_100422551 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AVGRYEDAAKTLREFLRDYSNRREAAIARRWLDGLAANGKIH |
| Ga0207700_104514331 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AQALREFLRDYADHREAATARRWLERLSANGKIHAN |
| Ga0207700_113779702 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GQYDDAARTLREFLRDHAECKEVATARRWLETLIADGKVRTIKN |
| Ga0207664_118799282 | 3300025929 | Agricultural Soil | QSLTAVGRFEDAAQVLREFLGDHASTQEAATARRWVEQLAANGKIRSN |
| Ga0207665_103278772 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VGRYEDAAQALREFLRDYADHREAATARRWLERLSANGKIHAN |
| Ga0209155_12849942 | 3300026316 | Soil | DDAAQTLREFLKSHGDRPEAATARRWLDGLVKNGKIRRE |
| Ga0209154_10428051 | 3300026317 | Soil | VGRYDDAALTLRDFLKSHGDRPEAATARRWLDGLVKNGKIRRE |
| Ga0209471_10780132 | 3300026318 | Soil | EDSAETLRQFLKSHGDRPEAMTARRWLEGLAKNGKIRQD |
| Ga0209473_13356202 | 3300026330 | Soil | VGRYEDSAEALRQFLKSNGDRPEAMTARRWLEGLAKNGKIRQD |
| Ga0209158_10302372 | 3300026333 | Soil | RYEDAAQALRDFLKSHGDRPEAATARRWLDGLVKNGKIR |
| Ga0209804_11161602 | 3300026335 | Soil | DAALTLRDFLKSHSDRPEAATARRWLDGLVKNGKIRRE |
| Ga0257163_10242212 | 3300026359 | Soil | DSAKTLREFLKAHGDLPEAATARRWLEGLSKNGKIR |
| Ga0257181_10171611 | 3300026499 | Soil | SLTAVGQYEDSAKTLREFLKNHGDRPEAATARRWLENLASSGKIRRE |
| Ga0209690_10295322 | 3300026524 | Soil | LLVAQSLTAVGRYEDAAQALRDFLKSHGDRPEAATARRWLDGLVKNGKIR |
| Ga0209376_12142372 | 3300026540 | Soil | GRYEDSAEALRQFLKSHGDRPEAMTARRWLEGLAKNGKIRQD |
| Ga0209156_102909232 | 3300026547 | Soil | QSLTAVGRYDDAALTLRDFLKSHGDRPEAATARRWLDGLVKNGKIRRE |
| Ga0209648_101428501 | 3300026551 | Grasslands Soil | VGQYEDSAKTLREFLKNHGDRPEAATARRWLEGLAKNGKIRRE |
| Ga0207815_10348011 | 3300027014 | Tropical Forest Soil | WTASNGKDPRIGLLVAKSLTAVGQYEDAAQKLRDVVKRYGDRPEAVTAQRYLDRLRNDGKIHSN |
| Ga0207948_10075331 | 3300027174 | Forest Soil | LTAVGRYEDAAQVLREFLKDHGDRREAVTARRWLERLAASGKIRAN |
| Ga0207780_10129081 | 3300027313 | Tropical Forest Soil | LLLAQSLTAVGQYEEAAQTLREFLRDHGDRPESATARRWLEQLTASGKIRPN |
| Ga0207780_10629101 | 3300027313 | Tropical Forest Soil | GLLVAKSLTAVGQYEDAAQKLRDVVKRYGDRPEAVTAQRYLDRLRNDGKIHSN |
| Ga0209076_10064253 | 3300027643 | Vadose Zone Soil | VAQSLTAVGRYDDAAQTLREFLKSHGDSPEAATARRWLEGLAKNGKIR |
| Ga0209248_100447711 | 3300027729 | Bog Forest Soil | EAAQALREFLKDHEDRQEAATARKWLDRLAASGKIRTN |
| Ga0209248_100752921 | 3300027729 | Bog Forest Soil | AQSLTAVGRYADAAQALREYVRDHGDRREAATARKWLERLTASGKIRADSN |
| Ga0209656_100496541 | 3300027812 | Bog Forest Soil | LTAVGRYEDAAQALRDFLRNHGDRREASTARRWLERLTASVKIKPSSN |
| Ga0209274_105838831 | 3300027853 | Soil | YEDAAQVLRAFLRDHGDRREAVTVRRWLERLTASAKIRAN |
| Ga0209465_104150752 | 3300027874 | Tropical Forest Soil | LVAQSLAAVGQYEDAAQELREFLRSHSDLREAATARRWLDGLAANGKIRTH |
| Ga0209380_108419151 | 3300027889 | Soil | AQSLTAVGRYEDAAQVLREFLKDHADRREASTARRWLEALTTSAKIRVN |
| Ga0308309_113254741 | 3300028906 | Soil | TAAGKYEDAGQALRDFLKSHSDRPEAPTARRWLERLTTDGKLAKH |
| Ga0265460_123214021 | 3300030740 | Soil | QSLTAVGRYEDAAQVLRAFLRDHGDRREAVTVRRWLERLTASAKIRAN |
| Ga0265765_10261481 | 3300030879 | Soil | AVGRYADAAQELREFVRDHGDRREAATARKWLERLMASGKIRANSN |
| Ga0265760_101505102 | 3300031090 | Soil | SLTAVERYEDAAQVLREFLRDHASTPEAATARRWLEQLAANGKIHSN |
| Ga0310915_102947991 | 3300031573 | Soil | GRYEDAAQSLREFLRAHADRTEAAMARRWLEQLVADGKIRTN |
| Ga0318536_102571131 | 3300031893 | Soil | RYEDAAQSLREFLRAHADRTEAAMARRWLEQLVADGKIRTN |
| Ga0318551_107812172 | 3300031896 | Soil | EDAAQSLREFLRAHADRTEAAMARRWLEQLVADGKIRNN |
| Ga0306923_102887091 | 3300031910 | Soil | VAQSLTAVGRYEDAAQTLRDFLRDHGDRPEAATARRWLDRLSSSGKIRAN |
| Ga0310910_108051212 | 3300031946 | Soil | AVGRYEDAADTLRVFLRDHGDRPEAATARRWLNKLSSSGKIRSN |
| Ga0310909_104595621 | 3300031947 | Soil | SLTAVGQYEEAGQTLREFLRDHGDRPESATAKRWLEQLTASGKIRPN |
| Ga0318533_103199251 | 3300032059 | Soil | AVGRYEDAAQSLREFLRAHADRTEAAMARRWLEQLVADGKIRTN |
| Ga0318540_100420981 | 3300032094 | Soil | EDAAQSLREFLRAHADRTEAAMARRWLEQLVADGKIRTN |
| Ga0311301_124525212 | 3300032160 | Peatlands Soil | AAQVLREFLRDHASTQEAVTARRWLEQLAANRKIRSN |
| Ga0306920_1002309801 | 3300032261 | Soil | RWEEAAQTLRQFLSDHADRPEATTARRWLDQLAASGNIRSN |
| Ga0306920_1004545553 | 3300032261 | Soil | LTAVGRYEEAAQTLREFLRDHGDRPESATAKRWLEQLTASGKIRPN |
| Ga0318519_104480041 | 3300033290 | Soil | AVGRYEDAAETLREFLRDHTDGPARATAQRWIEQLTSAGKIRPR |
| ⦗Top⦘ |