NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044637

Metagenome / Metatranscriptome Family F044637

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044637
Family Type Metagenome / Metatranscriptome
Number of Sequences 154
Average Sequence Length 51 residues
Representative Sequence MGDFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPLLCAAAF
Number of Associated Samples 126
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.92 %
% of genes near scaffold ends (potentially truncated) 96.10 %
% of genes from short scaffolds (< 2000 bps) 89.61 %
Associated GOLD sequencing projects 117
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (56.494 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.377 % of family members)
Environment Ontology (ENVO) Unclassified
(18.831 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.104 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.70%    β-sheet: 0.00%    Coil/Unstructured: 47.30%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 154 Family Scaffolds
PF08445FR47 12.34
PF11716MDMPI_N 4.55
PF00756Esterase 3.90
PF00296Bac_luciferase 3.90
PF07885Ion_trans_2 1.95
PF00355Rieske 1.95
PF00701DHDPS 1.30
PF06941NT5C 0.65
PF00005ABC_tran 0.65
PF13673Acetyltransf_10 0.65
PF03703bPH_2 0.65
PF12833HTH_18 0.65
PF02515CoA_transf_3 0.65
PF13649Methyltransf_25 0.65
PF12679ABC2_membrane_2 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 154 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 3.90
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 2.60
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.65
COG3402Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.65
COG3428Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.65
COG45025'(3')-deoxyribonucleotidaseNucleotide transport and metabolism [F] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms56.49 %
UnclassifiedrootN/A43.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001471|JGI12712J15308_10171979Not Available564Open in IMG/M
3300001593|JGI12635J15846_10170330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1471Open in IMG/M
3300004092|Ga0062389_102468478Not Available689Open in IMG/M
3300004092|Ga0062389_103299191All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300004633|Ga0066395_10986869Not Available513Open in IMG/M
3300005333|Ga0070677_10726086Not Available561Open in IMG/M
3300005336|Ga0070680_100888781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii768Open in IMG/M
3300005354|Ga0070675_100640426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii966Open in IMG/M
3300005364|Ga0070673_100089839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2508Open in IMG/M
3300005434|Ga0070709_10468927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii951Open in IMG/M
3300005436|Ga0070713_100420937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1250Open in IMG/M
3300005436|Ga0070713_100599456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1046Open in IMG/M
3300005437|Ga0070710_10108622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1663Open in IMG/M
3300005437|Ga0070710_10151552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1430Open in IMG/M
3300005457|Ga0070662_100033652All Organisms → cellular organisms → Bacteria3611Open in IMG/M
3300005467|Ga0070706_100540589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1084Open in IMG/M
3300005546|Ga0070696_100698827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii826Open in IMG/M
3300005549|Ga0070704_100677630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii912Open in IMG/M
3300005558|Ga0066698_10791792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii615Open in IMG/M
3300005563|Ga0068855_101355338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii735Open in IMG/M
3300005591|Ga0070761_10554070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae713Open in IMG/M
3300005602|Ga0070762_10378599Not Available908Open in IMG/M
3300005610|Ga0070763_10848357Not Available542Open in IMG/M
3300005610|Ga0070763_10858779Not Available538Open in IMG/M
3300005764|Ga0066903_104017886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii788Open in IMG/M
3300006102|Ga0075015_100076538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1640Open in IMG/M
3300006175|Ga0070712_100462240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. CT_GayMR161058Open in IMG/M
3300006176|Ga0070765_101399617All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300006176|Ga0070765_101415711Not Available655Open in IMG/M
3300006176|Ga0070765_101457298Not Available645Open in IMG/M
3300006804|Ga0079221_10063035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium confluentis1705Open in IMG/M
3300009101|Ga0105247_11852793Not Available503Open in IMG/M
3300009176|Ga0105242_10282335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1508Open in IMG/M
3300009177|Ga0105248_12928475Not Available544Open in IMG/M
3300009520|Ga0116214_1021887All Organisms → cellular organisms → Bacteria2284Open in IMG/M
3300009521|Ga0116222_1399464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae598Open in IMG/M
3300009524|Ga0116225_1306305All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300009839|Ga0116223_10050998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2702Open in IMG/M
3300010376|Ga0126381_104251342Not Available555Open in IMG/M
3300010400|Ga0134122_10100175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2293Open in IMG/M
3300010401|Ga0134121_10656773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii989Open in IMG/M
3300010876|Ga0126361_10199705Not Available803Open in IMG/M
3300010880|Ga0126350_10221580Not Available1028Open in IMG/M
3300010880|Ga0126350_10723900Not Available561Open in IMG/M
3300012198|Ga0137364_10324543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1146Open in IMG/M
3300012210|Ga0137378_10804912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria852Open in IMG/M
3300012349|Ga0137387_10448967Not Available935Open in IMG/M
3300012509|Ga0157334_1042114Not Available600Open in IMG/M
3300012924|Ga0137413_10273546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1169Open in IMG/M
3300012971|Ga0126369_11831656Not Available695Open in IMG/M
3300012986|Ga0164304_11288582Not Available594Open in IMG/M
3300013105|Ga0157369_12377616Not Available537Open in IMG/M
3300016387|Ga0182040_10391274All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300016422|Ga0182039_12238767Not Available504Open in IMG/M
3300017822|Ga0187802_10340168Not Available588Open in IMG/M
3300017926|Ga0187807_1248784Not Available582Open in IMG/M
3300017943|Ga0187819_10193163Not Available1203Open in IMG/M
3300017943|Ga0187819_10613786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia616Open in IMG/M
3300017959|Ga0187779_10143726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1467Open in IMG/M
3300017959|Ga0187779_10438109All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300017970|Ga0187783_10055231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2927Open in IMG/M
3300017973|Ga0187780_11436348Not Available509Open in IMG/M
3300017975|Ga0187782_10693307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii785Open in IMG/M
3300017975|Ga0187782_10894167Not Available689Open in IMG/M
3300017975|Ga0187782_11606264Not Available514Open in IMG/M
3300017993|Ga0187823_10230728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii619Open in IMG/M
3300017995|Ga0187816_10226870Not Available814Open in IMG/M
3300018007|Ga0187805_10120819Not Available1188Open in IMG/M
3300018007|Ga0187805_10202199Not Available907Open in IMG/M
3300018037|Ga0187883_10494450Not Available630Open in IMG/M
3300018086|Ga0187769_10278606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1248Open in IMG/M
3300018086|Ga0187769_11311325Not Available548Open in IMG/M
3300018433|Ga0066667_10348587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1176Open in IMG/M
3300018468|Ga0066662_10537312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium confluentis1076Open in IMG/M
3300019890|Ga0193728_1239752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii734Open in IMG/M
3300021171|Ga0210405_10084753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2498Open in IMG/M
3300021171|Ga0210405_10586537Not Available869Open in IMG/M
3300021401|Ga0210393_10907853Not Available715Open in IMG/M
3300021406|Ga0210386_10254779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1497Open in IMG/M
3300021406|Ga0210386_11083684Not Available681Open in IMG/M
3300021406|Ga0210386_11296207Not Available613Open in IMG/M
3300021407|Ga0210383_10592802Not Available955Open in IMG/M
3300021433|Ga0210391_11528498Not Available511Open in IMG/M
3300021474|Ga0210390_10548277Not Available972Open in IMG/M
3300021478|Ga0210402_10097273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2638Open in IMG/M
3300021478|Ga0210402_10363754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1343Open in IMG/M
3300024331|Ga0247668_1045244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii897Open in IMG/M
3300025898|Ga0207692_10296148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia983Open in IMG/M
3300025900|Ga0207710_10327401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii778Open in IMG/M
3300025906|Ga0207699_10933694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii641Open in IMG/M
3300025910|Ga0207684_11322597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii593Open in IMG/M
3300025916|Ga0207663_10269710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium confluentis1260Open in IMG/M
3300025916|Ga0207663_10717871Not Available792Open in IMG/M
3300025916|Ga0207663_10734675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii783Open in IMG/M
3300025920|Ga0207649_10408691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1017Open in IMG/M
3300025929|Ga0207664_10981579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii757Open in IMG/M
3300025934|Ga0207686_10091289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2011Open in IMG/M
3300025937|Ga0207669_11161827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii653Open in IMG/M
3300025938|Ga0207704_11000359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii707Open in IMG/M
3300026041|Ga0207639_11654331Not Available600Open in IMG/M
3300026118|Ga0207675_101093192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii817Open in IMG/M
3300027029|Ga0208731_1032765Not Available569Open in IMG/M
3300027765|Ga0209073_10063332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1241Open in IMG/M
3300027787|Ga0209074_10295766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium confluentis645Open in IMG/M
3300027855|Ga0209693_10540963Not Available554Open in IMG/M
3300027889|Ga0209380_10433037All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300027905|Ga0209415_10083683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3649Open in IMG/M
3300027911|Ga0209698_11321937Not Available527Open in IMG/M
3300028072|Ga0247675_1033707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii749Open in IMG/M
3300028828|Ga0307312_10119681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1649Open in IMG/M
3300028906|Ga0308309_10133866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1972Open in IMG/M
3300030730|Ga0307482_1021346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1351Open in IMG/M
3300030743|Ga0265461_10366235All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300030763|Ga0265763_1046124Not Available538Open in IMG/M
3300030906|Ga0302314_10606375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1143Open in IMG/M
3300031170|Ga0307498_10129171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii815Open in IMG/M
3300031199|Ga0307495_10043844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii887Open in IMG/M
3300031564|Ga0318573_10091456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1550Open in IMG/M
3300031708|Ga0310686_104507348Not Available905Open in IMG/M
3300031708|Ga0310686_105067278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia938Open in IMG/M
3300031708|Ga0310686_111637586Not Available554Open in IMG/M
3300031708|Ga0310686_113343872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4786Open in IMG/M
3300031708|Ga0310686_117631452Not Available703Open in IMG/M
3300031748|Ga0318492_10164421Not Available1124Open in IMG/M
3300031765|Ga0318554_10398273Not Available781Open in IMG/M
3300031778|Ga0318498_10201636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae902Open in IMG/M
3300031782|Ga0318552_10044375All Organisms → cellular organisms → Bacteria2089Open in IMG/M
3300031797|Ga0318550_10196271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii976Open in IMG/M
3300031805|Ga0318497_10285988Not Available917Open in IMG/M
3300031805|Ga0318497_10852523Not Available511Open in IMG/M
3300031821|Ga0318567_10252142Not Available991Open in IMG/M
3300031835|Ga0318517_10365837Not Available652Open in IMG/M
3300031845|Ga0318511_10554340Not Available534Open in IMG/M
3300031846|Ga0318512_10541238Not Available592Open in IMG/M
3300031860|Ga0318495_10153311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1039Open in IMG/M
3300031910|Ga0306923_12205517All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300032008|Ga0318562_10094193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1693Open in IMG/M
3300032009|Ga0318563_10160949Not Available1206Open in IMG/M
3300032009|Ga0318563_10370213All Organisms → cellular organisms → Bacteria → Terrabacteria group775Open in IMG/M
3300032010|Ga0318569_10180708Not Available976Open in IMG/M
3300032044|Ga0318558_10543421Not Available580Open in IMG/M
3300032074|Ga0308173_11133442Not Available730Open in IMG/M
3300032076|Ga0306924_10589095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1259Open in IMG/M
3300032090|Ga0318518_10681083Not Available523Open in IMG/M
3300032160|Ga0311301_10574911Not Available1636Open in IMG/M
3300032160|Ga0311301_11078083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium1049Open in IMG/M
3300032174|Ga0307470_11661402Not Available536Open in IMG/M
3300032805|Ga0335078_10906751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1058Open in IMG/M
3300032829|Ga0335070_11870756Not Available542Open in IMG/M
3300032896|Ga0335075_10256550All Organisms → cellular organisms → Bacteria2008Open in IMG/M
3300033004|Ga0335084_10075947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3482Open in IMG/M
3300033290|Ga0318519_10594388Not Available672Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil6.49%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.84%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.19%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.60%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.60%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.95%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.95%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.95%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.30%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.30%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.30%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.30%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.30%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.30%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.30%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.30%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.30%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.65%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027029Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030763Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12712J15308_1017197923300001471Forest SoilLGDFEEVVRLQAGIREWLLRTARNGRHDLRGIPAPAVLPLLCAAA
JGI12635J15846_1017033033300001593Forest SoilLGDFEEVERLQAGIRDWLLRSARNGRHELRGIPATGMLP
Ga0062389_10246847823300004092Bog Forest SoilLGDFEEVVRLQAGIREWLLRSARNGRHELRGIPASAVLPLLCAA
Ga0062389_10329919113300004092Bog Forest SoilLGDFEEVLRLQAGIRDWLLRTARHGRHDLRGLPAAAVLPLLCTAAFGPALTEAAELGGARAVAR
Ga0066395_1098686923300004633Tropical Forest SoilVGDFKEVERLQAGIRGWLLRTARSGRHELRGIDVLPMLCAAAFG
Ga0070677_1072608613300005333Miscanthus RhizosphereMGDFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPMLCAAAF
Ga0070680_10088878123300005336Corn RhizosphereMGDFEEVERLQAGIRTWLLRTARNGRHELRGISAPAVLPMLCA
Ga0070675_10064042613300005354Miscanthus RhizosphereMGDFEEVERLQAGIRTWLLRTVRSGRHELRGISAPAVLPMLCAAAFG
Ga0070673_10008983943300005364Switchgrass RhizosphereMGNFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPMLCAAAFGPALADADGPAPGL
Ga0070709_1046892713300005434Corn, Switchgrass And Miscanthus RhizosphereMGAFEEVERLQAGIRAWLLRTARSGRHDLRGIDGPAVLPLLCAA
Ga0070713_10042093733300005436Corn, Switchgrass And Miscanthus RhizosphereMGDFEEVERLQAGIRAWLLRTARSGRHDLRGIDGPAVLPLLCA
Ga0070713_10059945613300005436Corn, Switchgrass And Miscanthus RhizosphereMGDFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPMLC
Ga0070710_1010862233300005437Corn, Switchgrass And Miscanthus RhizosphereMGAFEEVERLQAGIRAWLLRTARSGRHDLRGIDGPAVLPLLCAAAFGPAL
Ga0070710_1015155213300005437Corn, Switchgrass And Miscanthus RhizosphereMGDFEEVERLQAGIRAWLLRTARSGRHDLRGIDGPAVLPLLCAAAFGPAL
Ga0070662_10003365213300005457Corn RhizosphereMGDFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPMLCAAAFGPALA
Ga0070706_10054058913300005467Corn, Switchgrass And Miscanthus RhizosphereMGDFEEVERLQAGIRTWLLRAARSGRHELRGISAPAVLPLL
Ga0070696_10069882713300005546Corn, Switchgrass And Miscanthus RhizosphereMGDFEEVERLQAGIRTWLLRTTRSGRHELRGISAPAVLPMLCAAAFGPALPDADGPA
Ga0070704_10067763033300005549Corn, Switchgrass And Miscanthus RhizosphereMGNFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPMLCAAAFGPALA
Ga0066698_1079179213300005558SoilMGDFEEVERLQAGIRTWLSRTARNGRHELRGISAP
Ga0068855_10135533813300005563Corn RhizosphereMGDFEEVERLQAGIRTWLLRTARNGRHELRGISAPAVLPMLCAAAFGPALAD
Ga0070761_1055407023300005591SoilLGDFEEVERLQAGIREWLLRSARNGRHELRGIPAAGLLPLLCAAAFGPVLADASDLASAA
Ga0070762_1037859913300005602SoilVGVAGLGGFEEVVRLQAGIREWLLRTARNDRHELRGIPAPAVLPLLCAA
Ga0070763_1084835723300005610SoilVGDFEEVERLQAGIRTWLLRTARSDRHELRDIGAPAVLPLLCAAAFGPALADSMAQ
Ga0070763_1085877923300005610SoilVGVAGLGDVEEVVRLQAGIRQWLLRTARNGRHELRGIPAPAVLPL
Ga0066903_10401788613300005764Tropical Forest SoilVGDFEEVERLQAAIRGWLLRMARSGRHDLRGISAPAVLPWLCAAAFGPAMADADGPASA
Ga0075015_10007653833300006102WatershedsVGDFEEVERLQAGIRTWLLRTARSGRHELRDLGAPAVLPLLCAAAF
Ga0070712_10046224013300006175Corn, Switchgrass And Miscanthus RhizosphereMGDFEEVERLQAGIRAWLLRTARSGRHDLRGIDGPAV
Ga0070765_10139961723300006176SoilVRVGVEGLGDFEEVLRLQAGIREWLLRAARHGRRELRGLPAPAVLPLLCAAALGPALADAAGLDGAT
Ga0070765_10141571113300006176SoilVGDFEEVERLQAGIRTWLLGTARSDRHELRDIGAPAVLPLLCAAAFGPALADSMAQAGVARLE
Ga0070765_10145729823300006176SoilLGCYGHVGVAGLGDFEEVVRLQAGIREWLLRTARNGRHELRGIPAPAVLPLLCAAAFGPALTEAADLGG
Ga0079221_1006303513300006804Agricultural SoilVGDFEEVERLQAGIRSWLLRSVRSDRQELRHGGGAAMLRLLCAAAFAPA
Ga0105247_1185279313300009101Switchgrass RhizosphereMGDFEEVERLQAGIRTWLLQTARSGRHELHGISARAVLPMLCAAA
Ga0105242_1028233533300009176Miscanthus RhizosphereMGNFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPMLCAAAFGPALADAGGPAPRVRRPPG*
Ga0105248_1292847523300009177Switchgrass RhizosphereMGDFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPMLCAAAFG
Ga0116214_102188743300009520Peatlands SoilVGDFDEVERLQAGIRTWLLRTARSGRHELRDVGAATVLPLLCAAAFGPALADGSAPAADG
Ga0116222_139946413300009521Peatlands SoilVGDFDEVERLQAGIRTWLLRTARSGRHELRDMGAPAVLPLLCAAAFGPALADGSTARGAGLA
Ga0116225_130630523300009524Peatlands SoilVGDFDEVERLQAGIRTWLLRTARSGRHELRDMGAPAVLPLLCAAAFGPALADGSTA
Ga0116223_1005099813300009839Peatlands SoilVGDFEEVERLQAGIRTWLLRTARSGRHELRDMGAPAVLPLLCAAAFGPALA
Ga0126381_10425134213300010376Tropical Forest SoilVKGLGDFEGVVQLQAGIREWLLRAARNGRHELRGMPAPAVLPLLCAAAFGSAITEAVAEL
Ga0134122_1010017513300010400Terrestrial SoilMGDFEEVERLQAGIRTWLLRTERSGRHELRGISAPAVL
Ga0134121_1065677333300010401Terrestrial SoilMGDFEEVERLQAGIRAWLLRTARSGRHDLRGIDGPAVLPLLCAAAFGPVLADADG
Ga0126361_1019970513300010876Boreal Forest SoilVGDFDEVERLQAGIRTWLLRTARNGRHELRDIGAPAVLPLLCAAAFGPALADGPGSAADGLGSAADGL
Ga0126350_1022158033300010880Boreal Forest SoilVAGLGDFEEVVRLQAGVREWLLRTARNGRDELRGIPAPAVLPLLCAAAFGPALTED
Ga0126350_1072390013300010880Boreal Forest SoilVGDFDEVERLQAGIRTWLLRTARNGRHELRDIGAPAVLPLLCAAAFGPALADGPGSAADGLGSAAGAAG
Ga0137364_1032454313300012198Vadose Zone SoilLVGDFEEVERLRAGIRTWLLRTARSGRHELRGIDGPAVLPLLCAAAFGPALADADGP
Ga0137378_1080491213300012210Vadose Zone SoilLVGDFEEVERLRAGIRTWLLRTARSGRHELRGISAPAMLP
Ga0137387_1044896713300012349Vadose Zone SoilVGDFEEVERLQAGIRAWLLRTARTGRRELRGIGAPAVLPLLCAAAFGPG
Ga0157334_104211423300012509SoilMGDFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPMLCAAAFGPALADADG
Ga0137413_1027354613300012924Vadose Zone SoilMGDFEEVDRLQAGIRTWLLRTARSGRHELRGISAPAVLPLLCGAAFGPALADADGPAPGLAR
Ga0126369_1183165613300012971Tropical Forest SoilVGDFEEVERLQAAIRAWLLQMARSGRHDLRGISAPAVLPWLCAAAF
Ga0164304_1128858223300012986SoilMGDFEEVERLQAGIRTWLLQTARSGRHELHGISARAVLPMLCAAAFGPALADA
Ga0157369_1237761623300013105Corn RhizosphereMGDFEEVERLQAGIRTWLLRTARSGRHELRGISAPA
Ga0182040_1039127413300016387SoilLEQVVQLQAGIREWLLRAARNGRHELRGIPAPAVPPL
Ga0182039_1223876713300016422SoilLGDLEEVARLQAGIREWLLRAARNGCHELRGLPAPAVLPLLCAAAFGPTLTEA
Ga0187802_1034016813300017822Freshwater SedimentVKGLGDFEEVVRLQAGIREWLLRAARNGRHELRGVPAPAVLPLLCAAAFGPTLA
Ga0187807_124878423300017926Freshwater SedimentMGDFEEVERLQAGIREWLLRTSRNGRHELRDIQAPAVPPLLCAAAFSPALATS
Ga0187819_1019316313300017943Freshwater SedimentLGDFEEVVRLQAGIREWLLRAARNGRHELRGVPAPAV
Ga0187819_1061378613300017943Freshwater SedimentVEGLGDFEEVVRLQAGIREWLLRAARNGRHELRGVPASAVLPLLCAAAFGPTLAGVADLRGAAA
Ga0187779_1014372633300017959Tropical PeatlandVGDFEEVERLRAGIRTWLLRSARSGRHDVLDGDAGMLPLLCAAAFGPALAAR
Ga0187779_1043810923300017959Tropical PeatlandLGDLEEVERVQAGIGEWLRRMARSGRHELRGIPASAVLPLLCAAAFGPALADACD
Ga0187783_1005523113300017970Tropical PeatlandMGDFEEVERLQAGIREWLLRTSRNGRHELRDVQAPAVLPLLCAAAFSPALATSGDLASSPAVARI
Ga0187780_1143634813300017973Tropical PeatlandLGDFEGVVRLQAGIREWLLRAARNGRHELRGVPAPAVLPLLCAAAFGPVLAEAADLGGAAAVARAG
Ga0187782_1069330723300017975Tropical PeatlandMGDLEEVERLQAGIREWLLRTAQNGRHELRGIPASHRMAVKM
Ga0187782_1089416723300017975Tropical PeatlandMGDFEEVERLQAGIREWLLRTTRNGRHELRGIQAQAVLPSLCAAAFG
Ga0187782_1160626423300017975Tropical PeatlandMGDFEEVERLQAGIREWLLRTSRNGRHELRDIQAPA
Ga0187823_1023072823300017993Freshwater SedimentMGDFEEVERLQAGIRAWLLRTARSGRHDLRGIDGPAVLPLLCAAAFG
Ga0187816_1022687013300017995Freshwater SedimentLGDFEEVVRLQAGIREWLLRAARNGRHELRGVPAPA
Ga0187805_1012081913300018007Freshwater SedimentVGDFDEVERLQAGIRTWLLRTARSGRHELRDMGAPAVLPLLCAAAFGPALTDG
Ga0187805_1020219933300018007Freshwater SedimentLGDFEEVVRLQAGIREWLLRAARNGRHELRGVPAPAVLPLLCAAAFGPTL
Ga0187883_1049445023300018037PeatlandVGDFDEVERLRAGIRGWLLRSVRSDRQELRHGGGSALLRLLCAAAFGPALAGSGSHGTGA
Ga0187769_1027860613300018086Tropical PeatlandLGDLEEVEQVQAGIREWLHRTASGGRHELRGIPASAVLPLLCAAAFGPALADASDLTSAAAVAGIG
Ga0187769_1131132523300018086Tropical PeatlandLGDLGVEQVQAAIREWLHRTASGGRHELRGIPASAVLPLLCAAAFGPALADASDLTSAAAVAGIG
Ga0066667_1034858713300018433Grasslands SoilMGAFEEVERLQAGIRAWLLRTARSGRHDLRGIDGPAVLPLLCAAAF
Ga0066662_1053731213300018468Grasslands SoilMCRGILVGDFEEVEHLRAGIRSWLLRSARSGRQDLRGGGGSAMLPVL
Ga0193728_123975213300019890SoilMGDFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPLLCAAAF
Ga0210405_1008475323300021171SoilMGDFEEVERLQASIRTWLMRTTRSGRHELRGISAAAVLPLL
Ga0210405_1058653723300021171SoilVGEFDEVERLQAGIRTWLLRTARSGRHELRDAGAADVLPLLCAAAF
Ga0210393_1090785323300021401SoilVGVAGLGDFEEVVRLQAGIREWLLRTARNGRHELRGIPAPAVLPLLCAAAFGPALTEAADLGGTAALARVGV
Ga0210386_1025477933300021406SoilVGVAGLGDFEEVVRLQAGIREWLLRTARNGRHELRGIPAPAVLPLLCAAAFGPALTEAAD
Ga0210386_1108368423300021406SoilMGNFEEVERLQAGIREWLLRTARNGRHELRSIPALAVLPLLCAAAFGPELA
Ga0210386_1129620713300021406SoilVGVAGLGDFEEVVRLQAGIRQWLLRTARNGRHELRGIPAPAVLPLLCAAAFGPALTEAA
Ga0210383_1059280223300021407SoilLGDFEEVVRLQAGIRQWLLRTGRNGRHELRGIPAPAVLPLLCAAAFGPALTEAADLSGA
Ga0210383_1106198723300021407SoilVGVEGLGDLEEVVRLQAGIREWLLRAARNGRHELRDIPAPAVLPLLCAAAFGPTLTEAADLDVAVAVARVMVLS
Ga0210391_1152849823300021433SoilLGDFEEVERLQAGIRDWLLRSARNGRHELRGIPATGMLPLLCAAAF
Ga0210390_1054827713300021474SoilVCRGSLVGDFEEVERLQAGIRTWLLGTARSGRHELRDIGAPAVLP
Ga0210402_1009727313300021478SoilMGDFEEVERLQASIRTWLMRTARSGRHELRGISAPAMLPLLCGAAFGPVLADA
Ga0210402_1036375433300021478SoilVGVAGLGDFEEVVRLQAGIRQWLLRTARNGRHELRGIPAPAVLPLLCAAAFGPALTEAADLGGAAA
Ga0247668_104524433300024331SoilMGDFEEVERLQAGIRTWLLRTARNGRHELRGISAPAVLPMLCAAAFGPAL
Ga0207692_1029614823300025898Corn, Switchgrass And Miscanthus RhizosphereMGDFEEVERLQAGIRAWLLRTARSGRHDLRGIDGPAVLPLLCAAAFGPVL
Ga0207710_1032740113300025900Switchgrass RhizosphereMGNFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPMLCAAAFGPALADA
Ga0207699_1093369413300025906Corn, Switchgrass And Miscanthus RhizosphereMGDFEEVERLQAGIRTWLLRTARSGRHEPRGISAPAVLPMLCAA
Ga0207684_1132259713300025910Corn, Switchgrass And Miscanthus RhizosphereMGDFEEVERLQAGIRTWLLRTTRSGRHELRGISAPAVLPM
Ga0207663_1026971013300025916Corn, Switchgrass And Miscanthus RhizosphereVGDFEEVERLQAGIRSWLLRSVRSDRQELRHGGGAAMLRL
Ga0207663_1071787113300025916Corn, Switchgrass And Miscanthus RhizosphereMGDFEEVERLQAGIRAWLLRTARSGRHDLRGIDGPAVLPLLCAAAFGPVLA
Ga0207663_1073467523300025916Corn, Switchgrass And Miscanthus RhizosphereVCGESLMGDFEEVERLQAGIRAWLLRTARSGRHDLRGIDGPAVLPLLCAAAFG
Ga0207649_1040869113300025920Corn RhizosphereMGDFEEVERLQAGIRTWLLRTTRSGRHELRGISAPAVL
Ga0207664_1098157923300025929Agricultural SoilMGDLEEVERLQAGIRTWLLQTARSGRHELHGISARAVL
Ga0207686_1009128913300025934Miscanthus RhizosphereMGNFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPMLCAAAFGPALADAGGPAP
Ga0207669_1116182713300025937Miscanthus RhizosphereMGNFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPMLCAAA
Ga0207704_1100035923300025938Miscanthus RhizosphereMGDFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVL
Ga0207639_1165433123300026041Corn RhizosphereMGDFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPMLCAAAFGPA
Ga0207675_10109319223300026118Switchgrass RhizosphereMGDFEEVERLQAGIRTWLLRTVRSGRHELRGISAPAVLPMLCAAAFGP
Ga0208731_103276523300027029Forest SoilMGDFEEVERLQAGIREWLLRTARNDRHELRGIPAPAVLPLLCAAAFGS
Ga0209073_1006333233300027765Agricultural SoilMGDFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPLLCAAAFGPALADAE
Ga0209074_1029576613300027787Agricultural SoilVGDFEEVERLQAGIRSWLLRSVRSDRQELRHGGGAAMLRLLCAAAFA
Ga0209693_1054096313300027855SoilMCRGSLVGDFEEVERLQAGIRTWLLRTARSGRHELRDIDAPAVLPLLCAAAFGPALADGLAPAADVAGLG
Ga0209380_1043303713300027889SoilLGDFEEVERLQAGIRDWLLRSARNGRHELRGIPATGMLPLLCAAAFGPVLADASDLASAAAVRRIGVL
Ga0209415_1008368313300027905Peatlands SoilVGDFDEVERLQAGIRTWLLRTARSGRHELRDMGAPAVLPLLCAAAFGPALAGGS
Ga0209698_1132193723300027911WatershedsLGDLEEVVRLQAGIREWLLRAARNGRHELRDIPAPAVLPLL
Ga0247675_103370713300028072SoilMGNFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLPMLCAAAFGPALADADGPE
Ga0307312_1011968143300028828SoilMGDFEEVERLQAGIRTWLLRTARSGRHELHGISAPAVLPLL
Ga0308309_1013386633300028906SoilLGDFEEVERLQAGIRDWLLRSARNGRHELRGIPATGMLPLLCAAAFGPVLADASDLASAAAVRRI
Ga0307482_102134633300030730Hardwood Forest SoilVGVAGLGDFEEVARLQAGIREWLLRTARNGRHELRGIPAPAVLPLLCAA
Ga0265461_1036623523300030743SoilLGDFEEVLRLQAGIRDWLLRSARHGRHELRCLPAAAVPPL
Ga0265763_104612413300030763SoilVCRGSLVGEFEEVERLQAGIRTWLLRTARSGRHELRDIDAAAVLPLLCAV
Ga0302314_1060637533300030906PalsaMGDFDDAARLRAGIREWVLRTARSGRHELGDMPPVTVVSLLCAAAFGPVIG
Ga0307498_1012917133300031170SoilMGDFEEVERLQAGIRTWLLRTARSGRHELRGISAQAVLPLLCAAAFGPALADA
Ga0307495_1004384413300031199SoilMGDFEEVERLQAGIRTWLLRTARSGRHELRGISAQAELPLLCAAAFGP
Ga0318573_1009145633300031564SoilVGDFEEVERLRAGIRGWLLRTARSGRHDLRDISAPAILPLLCAAAFGPALGDAAPGGSA
Ga0310686_10450734813300031708SoilMGDFEEVERLQAGIREWLLRTSRNGRHELRDIRAPAVLPLLCAAAFGSALATSG
Ga0310686_10506727813300031708SoilMVGDFEEVERLQADIREWVLRTVRSGRHELRDVPARAVLPLLCAAAFGAAL
Ga0310686_11163758623300031708SoilMGDFEEVERLQAGIREWLLRTSRNGRRELRDIQAPAVLPLLCAAAFGSALATSGD
Ga0310686_11334387273300031708SoilMCRGSLVGDFEEVERLQAGIRTWLLRTAWSGRHELRDIDAPAVLPLLCAAAFGPALA
Ga0310686_11763145213300031708SoilVLWHVGVAGLGDFEEVVQLQAGIREWLLRTARNGRHELRDIPAPAVLPLLCAAAFGPALTEAAD
Ga0318492_1016442113300031748SoilMGTWGWQELGDFEEVVRLQAGIREWLLRAARNGRHELRGMPAPAAFGLLPLLCAAAFGSAFTK
Ga0318554_1039827323300031765SoilMGTWGWQELGDFEEVVRLQAGIREWLLRAARNGRHELRGMPAPAAFGLLPLLC
Ga0318498_1020163633300031778SoilVGVEGLGDFEEVEGLRAGIREWLRRTARSNGHELSGMPASAVLPLLCAA
Ga0318552_1004437533300031782SoilMGTWGWQELGDFEEVVRLQAGIREWLLRAARNGRHELRGIPAPAVLPLLCAAAFGPAFTEAA
Ga0318550_1019627133300031797SoilVGDFEEVERLQAGIRGWLLRTARNGRHELRGIGAPAVLPLLCAAAFGPAL
Ga0318497_1028598823300031805SoilLGDFEEVVRLQAGIREWLLRTARHGRHELRGIPAPAVLPLL
Ga0318497_1085252313300031805SoilVGDFEEVERLQAGIRAWLLRSARSGRHDLRTGGAGLLPLLCASAFGPALADRPDNSA
Ga0318567_1025214213300031821SoilLGDFEEVVRLQAGIREWLLRAARNGRHELRGIPAPAVPPLLCAAAFGPMLCEAAGLGGVDLG
Ga0318517_1036583723300031835SoilMGTWGWQELGDFEEVVRLQAGIREWLLRAARNGRHELRGMPAPAAFGLLPL
Ga0318511_1055434013300031845SoilVQLQAGIRESLLRAARNGRHELRGMPAPAVLPLLCAAAFGPAFTEAANELGGA
Ga0318512_1054123823300031846SoilMGDFEEVVQLQAGIREWPLRAARNGRHELRGIQAPAVLPLLCAAAFGPMLCEAAGLG
Ga0318495_1015331113300031860SoilVGDFEEVERLQAAIRTWLLRMARNGRHDLRGISAPAVLPLLCGAAFGPAMADADGP
Ga0306923_1220551723300031910SoilMWHVGVEGLGDFDEVVQLQAGIREWLRRAARNGRHDLRGMPAPAASGLLPLLCAAAFGPTLTAAAA
Ga0318562_1009419333300032008SoilVGDFEEVERLQAGIRGWLLRTARNGRHELRGIGAPAVLPLLCAAAFGPALADSPAPGPAR
Ga0318563_1016094913300032009SoilLGDLEEVARLQAGIREWLLRAGRNGRHELRDIPAPAVLPLLC
Ga0318563_1037021323300032009SoilVGDFEEVERLQAGIRRWLQRSARSGRHELHDRGASAVLPLLCAAAFGPVLADVD
Ga0318563_1041259713300032009SoilLGDFDEVVQLQAGIREWLRRAARNGRHDLRGMPAP
Ga0318569_1018070813300032010SoilLGDFEEVVRLQAGIREWLLRAARNGRHELRGMPAPAAFG
Ga0318558_1054342123300032044SoilVGDFEEVERLQAGIRGWLLRTARNGRHELRGIGAPAVLPLLCAAAF
Ga0308173_1113344233300032074SoilVGDFEEVERLQAGIRSWLLRSVRSDRQELRHGGGAAMLRLLCAAAFAP
Ga0306924_1058909533300032076SoilVGVEGLGDFEEVEGLRAGIREWLRRTARSNGHELSGIPASAVLPLLCAAAFGPELADAAN
Ga0318518_1068108323300032090SoilVGDFEEVERLQAGIRAWLLRSARSGRHDLRTGGAGLLPL
Ga0311301_1057491143300032160Peatlands SoilVCRGSLVGDFEEVERLQAGIRTWLLRTARSGRHEL
Ga0311301_1107808333300032160Peatlands SoilMGNFEEVERLQAGIREWLLRTARNGRHELRSIPAPAVLPLLC
Ga0307470_1166140223300032174Hardwood Forest SoilMGDFEEVERLQAGIRTWLLRTARSGRHELRGISAPAVLP
Ga0335078_1090675133300032805SoilVGDFEEVERLQAGIRAWLLRMARSGHHDLRGISGQAVLPLLCAAAFGPALADADGPGPGLARM
Ga0335070_1187075623300032829SoilMCRGSLVGDFEEVERLQAGIRGWLLRSVRSDRQELRHGGAAMLRLLCA
Ga0335075_1025655013300032896SoilVKGLGDSEEVVRLQEGIREWLLRSARNGRHELREIPAPAVPPLLCAAAFGPVLADAAGLD
Ga0335084_1007594753300033004SoilMGDFEEVERLQTGIRTWLLRTARSGRHELRGISAPAVLPLLCAAAF
Ga0318519_1059438813300033290SoilLGDLEEVARLQAGIREWLLRAGRNGRHELRDIPAPAVLPLLCAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.