| Basic Information | |
|---|---|
| Family ID | F044609 |
| Family Type | Metagenome |
| Number of Sequences | 154 |
| Average Sequence Length | 42 residues |
| Representative Sequence | HANFANPAFTDVESIGTTNSPFGKITSTVGTPRLIQFSLRYSF |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.32 % |
| % of genes near scaffold ends (potentially truncated) | 96.75 % |
| % of genes from short scaffolds (< 2000 bps) | 82.47 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.403 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.935 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.169 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.597 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 8.45% Coil/Unstructured: 91.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF00155 | Aminotran_1_2 | 32.47 |
| PF02627 | CMD | 27.27 |
| PF07883 | Cupin_2 | 2.60 |
| PF12867 | DinB_2 | 1.95 |
| PF00156 | Pribosyltran | 1.30 |
| PF13365 | Trypsin_2 | 1.30 |
| PF01844 | HNH | 0.65 |
| PF13185 | GAF_2 | 0.65 |
| PF14667 | Polysacc_synt_C | 0.65 |
| PF02416 | TatA_B_E | 0.65 |
| PF02518 | HATPase_c | 0.65 |
| PF00069 | Pkinase | 0.65 |
| PF00990 | GGDEF | 0.65 |
| PF02668 | TauD | 0.65 |
| PF08899 | DUF1844 | 0.65 |
| PF08388 | GIIM | 0.65 |
| PF01842 | ACT | 0.65 |
| PF07238 | PilZ | 0.65 |
| PF12787 | EcsC | 0.65 |
| PF07805 | Obsolete Pfam Family | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 27.27 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 27.27 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.60 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.65 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.40 % |
| Unclassified | root | N/A | 2.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004092|Ga0062389_102509046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 684 | Open in IMG/M |
| 3300004092|Ga0062389_104993574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 500 | Open in IMG/M |
| 3300004635|Ga0062388_100059231 | All Organisms → cellular organisms → Bacteria | 2546 | Open in IMG/M |
| 3300005174|Ga0066680_10860455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 541 | Open in IMG/M |
| 3300005175|Ga0066673_10535234 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005179|Ga0066684_10012295 | All Organisms → cellular organisms → Bacteria | 4195 | Open in IMG/M |
| 3300005541|Ga0070733_10018755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4312 | Open in IMG/M |
| 3300005548|Ga0070665_100037460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4877 | Open in IMG/M |
| 3300005559|Ga0066700_10010769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4743 | Open in IMG/M |
| 3300005561|Ga0066699_10265023 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300005586|Ga0066691_10394340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300005842|Ga0068858_101497876 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300005995|Ga0066790_10205695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 841 | Open in IMG/M |
| 3300006028|Ga0070717_10727416 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300006041|Ga0075023_100375441 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300006176|Ga0070765_100285956 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300006176|Ga0070765_101743138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300006852|Ga0075433_11918613 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006871|Ga0075434_100836307 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300006903|Ga0075426_10777821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 719 | Open in IMG/M |
| 3300006914|Ga0075436_101560226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300006954|Ga0079219_10054720 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300007255|Ga0099791_10646320 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300009038|Ga0099829_11491273 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300009089|Ga0099828_10533625 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300009093|Ga0105240_12712267 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300009520|Ga0116214_1375167 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300009661|Ga0105858_1236026 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300009698|Ga0116216_10030085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3384 | Open in IMG/M |
| 3300010047|Ga0126382_12140565 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010048|Ga0126373_13027659 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010321|Ga0134067_10042879 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300010343|Ga0074044_10562388 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300010358|Ga0126370_11181907 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300010360|Ga0126372_12915090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300010361|Ga0126378_10052063 | All Organisms → cellular organisms → Bacteria | 3821 | Open in IMG/M |
| 3300010366|Ga0126379_11091838 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300010376|Ga0126381_100133638 | All Organisms → cellular organisms → Bacteria | 3233 | Open in IMG/M |
| 3300010376|Ga0126381_100161009 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
| 3300010376|Ga0126381_103545303 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300010376|Ga0126381_104092889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300010398|Ga0126383_12083145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300012200|Ga0137382_10624461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300012205|Ga0137362_11729241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 512 | Open in IMG/M |
| 3300012207|Ga0137381_10208587 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300012211|Ga0137377_10047275 | All Organisms → cellular organisms → Bacteria | 3964 | Open in IMG/M |
| 3300012285|Ga0137370_10850590 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300012363|Ga0137390_10650952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1018 | Open in IMG/M |
| 3300012532|Ga0137373_10480513 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300012918|Ga0137396_10525628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300012923|Ga0137359_10764097 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300012924|Ga0137413_10921475 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300012925|Ga0137419_10977671 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300012925|Ga0137419_11213702 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300012927|Ga0137416_10662380 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300012927|Ga0137416_12147545 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012931|Ga0153915_12435129 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012957|Ga0164303_10793745 | Not Available | 650 | Open in IMG/M |
| 3300012971|Ga0126369_10079743 | All Organisms → cellular organisms → Bacteria | 2900 | Open in IMG/M |
| 3300012971|Ga0126369_10088253 | All Organisms → cellular organisms → Bacteria | 2772 | Open in IMG/M |
| 3300012977|Ga0134087_10256261 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300012986|Ga0164304_11863953 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300013306|Ga0163162_11281640 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300013306|Ga0163162_11501722 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300015193|Ga0167668_1089363 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300015241|Ga0137418_10434280 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300015373|Ga0132257_100075023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3836 | Open in IMG/M |
| 3300016270|Ga0182036_10054186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2535 | Open in IMG/M |
| 3300016270|Ga0182036_11521035 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300016357|Ga0182032_11667144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300016371|Ga0182034_10003104 | All Organisms → cellular organisms → Bacteria | 8542 | Open in IMG/M |
| 3300017823|Ga0187818_10444012 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300017936|Ga0187821_10310007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300017955|Ga0187817_10697835 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300017973|Ga0187780_10048790 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
| 3300018007|Ga0187805_10622615 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300018058|Ga0187766_10940943 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300018085|Ga0187772_11030943 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300018085|Ga0187772_11360575 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300018433|Ga0066667_10053745 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
| 3300018433|Ga0066667_11156963 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300020199|Ga0179592_10370454 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300020579|Ga0210407_10131065 | All Organisms → cellular organisms → Bacteria | 1922 | Open in IMG/M |
| 3300020580|Ga0210403_10542724 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300020583|Ga0210401_10669666 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300021046|Ga0215015_10014607 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
| 3300021168|Ga0210406_10445796 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300021171|Ga0210405_10992575 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300021180|Ga0210396_11670570 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300021402|Ga0210385_10128547 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300021405|Ga0210387_10652043 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300021420|Ga0210394_10723385 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300021475|Ga0210392_10296081 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300021478|Ga0210402_10136384 | All Organisms → cellular organisms → Bacteria | 2228 | Open in IMG/M |
| 3300021478|Ga0210402_10182548 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| 3300021478|Ga0210402_11528280 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300021479|Ga0210410_11191951 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300024224|Ga0247673_1045241 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300024284|Ga0247671_1080757 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300024287|Ga0247690_1046787 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300025910|Ga0207684_10990505 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300025922|Ga0207646_11731975 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300025934|Ga0207686_10465793 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300026475|Ga0257147_1027004 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300026523|Ga0209808_1010458 | All Organisms → cellular organisms → Bacteria | 4701 | Open in IMG/M |
| 3300026542|Ga0209805_1100348 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300026542|Ga0209805_1327663 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300026557|Ga0179587_10508940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300026941|Ga0207741_1011778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300027480|Ga0208993_1092730 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300027737|Ga0209038_10070053 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300027748|Ga0209689_1014726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5014 | Open in IMG/M |
| 3300027824|Ga0209040_10439171 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300027825|Ga0209039_10292470 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300027855|Ga0209693_10120296 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300027905|Ga0209415_10812159 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300028646|Ga0302159_10036606 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300028871|Ga0302230_10119571 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300029990|Ga0311336_10665214 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300030043|Ga0302306_10073396 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300031128|Ga0170823_13742481 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300031231|Ga0170824_124408556 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300031474|Ga0170818_115507571 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031564|Ga0318573_10640809 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031708|Ga0310686_104062642 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031708|Ga0310686_118751214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sanguinis | 662 | Open in IMG/M |
| 3300031715|Ga0307476_10550804 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300031716|Ga0310813_12156843 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031753|Ga0307477_10445651 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300031754|Ga0307475_11149053 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300031771|Ga0318546_10343017 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300031796|Ga0318576_10215908 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300031820|Ga0307473_10248147 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300031823|Ga0307478_10622442 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300031962|Ga0307479_10575450 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300032051|Ga0318532_10313269 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300032094|Ga0318540_10574557 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300032174|Ga0307470_10437039 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300032174|Ga0307470_10880367 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300032174|Ga0307470_11803315 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300032180|Ga0307471_100069258 | All Organisms → cellular organisms → Bacteria | 3033 | Open in IMG/M |
| 3300032180|Ga0307471_100144987 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300032180|Ga0307471_102579787 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300032756|Ga0315742_12002237 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300032770|Ga0335085_12291654 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300032782|Ga0335082_11228002 | Not Available | 617 | Open in IMG/M |
| 3300032783|Ga0335079_11112911 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300032829|Ga0335070_10028554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6378 | Open in IMG/M |
| 3300032892|Ga0335081_10293550 | All Organisms → cellular organisms → Bacteria | 2159 | Open in IMG/M |
| 3300032955|Ga0335076_10035661 | All Organisms → cellular organisms → Bacteria | 4985 | Open in IMG/M |
| 3300033134|Ga0335073_11860728 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300033158|Ga0335077_11208891 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.44% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.19% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.25% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.60% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.60% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.30% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.30% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.30% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.30% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.65% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.65% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062389_1025090462 | 3300004092 | Bog Forest Soil | WNHVNFANPAVTDVESISLPNSPFGKITSDLGTPRLIQFSLRYTF* |
| Ga0062389_1049935742 | 3300004092 | Bog Forest Soil | WNHVNFANPAVTDVESISLPNSPFGKITSDLGTPRLIQFSLRYMF* |
| Ga0062388_1000592313 | 3300004635 | Bog Forest Soil | WNHANFGNPSVTDVETIGGPSSPFGKITSTVGTPRLIQFSLRYSF* |
| Ga0066680_108604551 | 3300005174 | Soil | WNHTNFGNPSVTDIEAGGAFGKIVQTVGTPRLIQFSLRWAF* |
| Ga0066673_105352342 | 3300005175 | Soil | FANPGNGTATDVEIPGSFGRIFSTVGTPRLIQFSLRYAF* |
| Ga0066684_100122956 | 3300005179 | Soil | IWNHTNFANPAINDVENPGAFGRIFSTVGTPRLIQFSLRYAF* |
| Ga0070733_100187556 | 3300005541 | Surface Soil | FASPAFTDVESPSNFGQITNTTGTPRLIQFSLRYAF* |
| Ga0070665_1000374601 | 3300005548 | Switchgrass Rhizosphere | ANFANPVSTDVENPGSFGFITSTKGVPRLIQFSLRYSF* |
| Ga0066700_100107691 | 3300005559 | Soil | PTVTDVETIGGANSPFGKITSTVGTPRLVQFSLRYAF* |
| Ga0066699_102650233 | 3300005561 | Soil | NIWNHANFANPASTDVQNPGAFGKIVSTVGTPRLIQFSLRYAF* |
| Ga0066691_103943402 | 3300005586 | Soil | NHTNFGNPSVTDIEAGGAFGKIVQTVGTPRLIQFSLRWAF* |
| Ga0068858_1014978761 | 3300005842 | Switchgrass Rhizosphere | HANFANPAINDVETITHDASGNPTSGGPFGKIFSTLGTPRLIQFSLKLAF* |
| Ga0066790_102056951 | 3300005995 | Soil | NFANPSSTEISNPAFGKIFSTVGTPRLIQFSLRYAF* |
| Ga0070717_107274161 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TADFFNVWNHTNFANPSVTDVEAGSAFGKIIGTVGTPRLIQFSLRWAF* |
| Ga0075023_1003754411 | 3300006041 | Watersheds | FNHPSFASPFFVDVENPKSLGKITNTVGTPRLIQFSLRYSY* |
| Ga0070765_1002859562 | 3300006176 | Soil | NFGNPAFTDVEGGNFGKITSTVGTPRLIQFSLRYAF* |
| Ga0070765_1017431381 | 3300006176 | Soil | ANPSFLDVESIGTTNSPFGKITSTVGTPRLIQFSLRYSF* |
| Ga0075433_119186131 | 3300006852 | Populus Rhizosphere | NPAINDVEVGTGPGSPFGKIFSTVGTPRLIQFSLRYAF* |
| Ga0075434_1008363073 | 3300006871 | Populus Rhizosphere | NPVINDVEVGTGPGSPFGKIFSAVGTPRLIQFSLRYAF* |
| Ga0075426_107778212 | 3300006903 | Populus Rhizosphere | FANPAFTDVEVGSAFGKIFNSTGTPRLIQFSLRWAF* |
| Ga0075436_1015602262 | 3300006914 | Populus Rhizosphere | NPAINDVENPGAFGQIISTVGTPRLIQFSLRYAF* |
| Ga0079219_100547201 | 3300006954 | Agricultural Soil | NHPNFGNPVQTDVSFPAGSFALINSTVGTPRLIQFQLRYSF* |
| Ga0099791_106463201 | 3300007255 | Vadose Zone Soil | ILNHANFANPVINDVETIGVPNSPFGKIFSTVGTPRLIQFSLRYSF* |
| Ga0099829_114912732 | 3300009038 | Vadose Zone Soil | NPAVNDVETIGVPNSPFGKITSTVGTPRLIQFSLRYAF* |
| Ga0099828_105336252 | 3300009089 | Vadose Zone Soil | DNPTVTDVETIGTPNSPFGKITGTVGTPRLIQFSLRYAF* |
| Ga0105240_127122672 | 3300009093 | Corn Rhizosphere | NFASPAFNDVENPGAFGKIFSTVGTPRLIQFQLRYSF* |
| Ga0116214_13751672 | 3300009520 | Peatlands Soil | AVTDVETIGLPNSPFGKIISDRGVPRLIQFSLRYAF* |
| Ga0105858_12360262 | 3300009661 | Permafrost Soil | HANFANPSVTDLESIGTTNSPFGKITSTIGTPRLIQFSLRYAF* |
| Ga0116216_100300851 | 3300009698 | Peatlands Soil | IWNHANFGNPAITDVETTGGGTLLQSQTPFGKITQTVGTPRLIQFSLRWAF* |
| Ga0126382_121405652 | 3300010047 | Tropical Forest Soil | FNIWNHANFGNPAVTDVENPSALGKIISTVGTPRLIQFSLRYAF* |
| Ga0126373_130276592 | 3300010048 | Tropical Forest Soil | HANFASPAQSDVENASTFSKITQTVGTPRLIQFSLRYAF* |
| Ga0134067_100428793 | 3300010321 | Grasslands Soil | WNHANFGNPAQADVENPSTFGKITQTVGTPRLIQFSLRWAF* |
| Ga0074044_105623881 | 3300010343 | Bog Forest Soil | FGNPQITDVEAISTGAFGKINTTLGQPRLIQFSLRYSF* |
| Ga0126370_111819072 | 3300010358 | Tropical Forest Soil | VEIIGANPATSPFGKIFSTVGTPRLIQFALRYAF* |
| Ga0126372_129150901 | 3300010360 | Tropical Forest Soil | FFNIWNHANFANPAFTDVEMDSAFGKIFNSTRTPRLIQFSLR* |
| Ga0126378_100520631 | 3300010361 | Tropical Forest Soil | PNFANPASTDFENQGAFAKIVSTLGNPRVIQFSLRYAF* |
| Ga0126379_110918381 | 3300010366 | Tropical Forest Soil | HANFGNPTVTDVETIGLPNSPFGKITSTLGTPRLIQFSLRLAF* |
| Ga0126381_1001336381 | 3300010376 | Tropical Forest Soil | FGNPTVTDVETIGGANSPFGKITSTVGTPRLIQFSLRYAY* |
| Ga0126381_1001610094 | 3300010376 | Tropical Forest Soil | VTDVETIGLTNSPFGRITSTVGTPRLIQFSLRLAF* |
| Ga0126381_1035453031 | 3300010376 | Tropical Forest Soil | MRFTEDFFNLWNHANFANPAFTDVEVGSASGKIFNSTGTPRLIQSSLRRAF* |
| Ga0126381_1040928891 | 3300010376 | Tropical Forest Soil | ANFANPAFTDVEVGSAFGKIFNSTGTPRLIQFSLRWAF* |
| Ga0126383_120831452 | 3300010398 | Tropical Forest Soil | ALNFLNHANFANPSITDVETINAVDPSASPFGKIFSTVGTPRLIQFSLRLSF* |
| Ga0137382_106244612 | 3300012200 | Vadose Zone Soil | FNIWNHANFANPAINDVENPGPFGKIFSTVGTPRLIQFSLRYAF* |
| Ga0137362_117292411 | 3300012205 | Vadose Zone Soil | DFFNIWNHTNFGNPAANDVESIGVPNSPFGKIISTVGTPRLIQFSLRYAF* |
| Ga0137381_102085871 | 3300012207 | Vadose Zone Soil | NFANPAQADVENPATFGKITQTVGTPRLIQFSIRWAF* |
| Ga0137377_100472755 | 3300012211 | Vadose Zone Soil | FANPAINDVETIGVPNSPFGKIFSTVGTPRLIQFSLRYSF* |
| Ga0137370_108505902 | 3300012285 | Vadose Zone Soil | NFANPSINDVETITHDGSGNPTSDGPFGKIFSTVGTPRLIQFSLRYSF* |
| Ga0137390_106509523 | 3300012363 | Vadose Zone Soil | FSNPSATDVEAIGLPNSPFGKITSALGTPRLIQFSLRYSF* |
| Ga0137373_104805131 | 3300012532 | Vadose Zone Soil | HANFGNPTQTDVSFQEGSFARINSTVGTPRLIQFQLRYAF* |
| Ga0137396_105256281 | 3300012918 | Vadose Zone Soil | ANFANPAFNDVENPGPFGKIFSTVGTPSLIQFSLRYAF* |
| Ga0137359_107640971 | 3300012923 | Vadose Zone Soil | NIWNHANFASPASNDVEIPGAFGKINSTVGTPRLIQLSLRYAF* |
| Ga0137413_109214751 | 3300012924 | Vadose Zone Soil | NIWNHANFANPPINDVETITHDALNNPTKDGPFGKIFSTVGTPRLIQFSLRLAF* |
| Ga0137419_109776711 | 3300012925 | Vadose Zone Soil | NPAINDVETIGVPNSPFGKIFSTVGTPRLIQFSLRYSF* |
| Ga0137419_112137021 | 3300012925 | Vadose Zone Soil | NHVNFANPAINDVEVGTGPNSPFGKIFSTVGTPRLIQFSLRYAF* |
| Ga0137416_106623801 | 3300012927 | Vadose Zone Soil | NFANPAINDVENLGAFGQIISTVGTPRLIQFSLRYAF* |
| Ga0137416_121475451 | 3300012927 | Vadose Zone Soil | NHANFANPALTDIGAGAGFGKIFSTTGTPRLIQFSLRLAF* |
| Ga0153915_124351291 | 3300012931 | Freshwater Wetlands | HVNFSNPTFTDVESPANFGYITTTKGTPRLIQFSLRWAF* |
| Ga0164303_107937451 | 3300012957 | Soil | NPVSTDVENPGAFGFITSTRGVPRLIQFSLRYSF* |
| Ga0126369_100797435 | 3300012971 | Tropical Forest Soil | ANPSITDVETIGVPNSPFGQIFATTGTPRLIQFSLRLAF* |
| Ga0126369_100882531 | 3300012971 | Tropical Forest Soil | DFFNVWNHVNFANPAINDVQVDTGAGSPFGKIFSTVGTPRLIQFSLRYAF* |
| Ga0134087_102562611 | 3300012977 | Grasslands Soil | VNFANPSINDVETITHDNLGNPTSDGPFGKIFSTVGTPRLIQFSLRYTF* |
| Ga0164304_118639531 | 3300012986 | Soil | FASPAFTDVESPGNFGQITNTKGTPRLIQLSLRWAF* |
| Ga0163162_112816401 | 3300013306 | Switchgrass Rhizosphere | SPAFNDVENPGAFGKIFSTVGTPRLIQFQLRYSF* |
| Ga0163162_115017221 | 3300013306 | Switchgrass Rhizosphere | NHANFANPAVTDVENPAAFGRIFSTVGTPRLIQFSLRYAF* |
| Ga0167668_10893632 | 3300015193 | Glacier Forefield Soil | HVNFAGPAVTDVENPGAFGKIVSTVGTPRLIQFSLRYAF* |
| Ga0137418_104342801 | 3300015241 | Vadose Zone Soil | NHANFASPTSADVENPGAFGKINSTVGTPRLIQLSLRYAF* |
| Ga0132257_1000750231 | 3300015373 | Arabidopsis Rhizosphere | HTNFGNPVQNDVSFSAGSFALINSTVGTPRLIQFQLRYSF* |
| Ga0182036_100541861 | 3300016270 | Soil | IWNHANFANPPITDVETIGPNSPFGQIFSTTGTPRLIQFSLRFGF |
| Ga0182036_115210352 | 3300016270 | Soil | TDFFNVWNHANFANPPINDVETISHDAAGNPTNDGPFGKIFSTVGTPGLIQFSLRLAF |
| Ga0182032_116671442 | 3300016357 | Soil | NHANFANPPITDVETIGPNSPFGQIFSTTGTPRLIQFSLRFGF |
| Ga0182034_100031041 | 3300016371 | Soil | ANFANPVATDVESPGNFGVITSTKGVPRLIQFSLRYSF |
| Ga0187818_104440122 | 3300017823 | Freshwater Sediment | FNIWNHANFANPPLTDVETITHDAAGNPTNAGPFGKIFSTLGTPRLIQFSLRLAF |
| Ga0187821_103100071 | 3300017936 | Freshwater Sediment | HASFANPAVTDVENPGAFGKILNTVGTPRLIQFSLRWAF |
| Ga0187817_106978351 | 3300017955 | Freshwater Sediment | TDMFNMWNHANFANPAVTDVETISEPNSPFGKIVSSRGVPRLIQFSLRYAF |
| Ga0187780_100487903 | 3300017973 | Tropical Peatland | LIANFFNIWNHANFANPSITDVETFNPSNPSASPFGKIFSAVGNPRLIQFSLRLAF |
| Ga0187805_106226151 | 3300018007 | Freshwater Sediment | NFANPAITDVETINLANPSASPFGKIFSTTGTPRLIQFSLRLAF |
| Ga0187766_109409431 | 3300018058 | Tropical Peatland | ANPSITDVETINPNNPSASPFGKIFSTVGNPRLIQFSLRLAF |
| Ga0187772_110309431 | 3300018085 | Tropical Peatland | ITDVETISEPNSPFGKIFSTTGTPRLIQFSLRLAF |
| Ga0187772_113605751 | 3300018085 | Tropical Peatland | TDFFNIWNHANFANPAVTDVETIPLPNSPFGKIVSDRGVPRLIQFSLRYAF |
| Ga0066667_100537453 | 3300018433 | Grasslands Soil | NHANFGNPTVNDAETIPLSNSPFGKIISTVGTPRLIQFSLRYAF |
| Ga0066667_111569631 | 3300018433 | Grasslands Soil | QNMRFTVDFFNIWNHANFASPSSNDVENPGAFGKIVSTVGNPRLIQLSLRWAF |
| Ga0179592_103704541 | 3300020199 | Vadose Zone Soil | WNHANFANPSINDVETIGINPATSPFGKIFSTVGTPRLIQFSLRYAF |
| Ga0210407_101310653 | 3300020579 | Soil | FANPSVTDVQNPAAFGRIFATVGTPRLIQFSLRYAF |
| Ga0210403_105427242 | 3300020580 | Soil | TTDFFNIWNHANFANPSLTDINSGAGFGKIFSTVGTPRLIQFSLRLTF |
| Ga0210401_106696662 | 3300020583 | Soil | HANFGNPAFTDVEGGNFGKITSTVGTPRLIQFSLRYAF |
| Ga0215015_100146074 | 3300021046 | Soil | LGDVYKRQIWNHANFGNPSVNDVETIGVANSPFGKIISTVGTPRLIQFSLRYAF |
| Ga0210406_104457962 | 3300021168 | Soil | HVNFANPVSTDVESPGNFGLITSAKGVPRLIQFSLRYSF |
| Ga0210405_109925752 | 3300021171 | Soil | AINDVETIGGPGSPFGKIFSTVGTPRLIQFSLRLSF |
| Ga0210396_116705701 | 3300021180 | Soil | HANFANPAFTDVESIGTTNSPFGKITSTVGTPRLIQFSLRYSF |
| Ga0210385_101285474 | 3300021402 | Soil | FANPAFTDVEGGNFGKITSTVGAPRLIQFSLRYSF |
| Ga0210387_106520433 | 3300021405 | Soil | PSFLDVESIGTTNSPFGKITSTVGTPRLIQFSLRYSF |
| Ga0210394_107233852 | 3300021420 | Soil | NHVNFANPAVTDVESISLPNSPFGKITSDLGTPRLIQFSLRYMF |
| Ga0210392_102960811 | 3300021475 | Soil | NHTNFASPAFTDVESSSNFGQITSTKGTPRLIQFSLRYAF |
| Ga0210402_101363841 | 3300021478 | Soil | HANFANPQINDVETIGGPFGKIFSTVGTPRLIQFSLRLAF |
| Ga0210402_101825481 | 3300021478 | Soil | IFNHANFANPAINDVETITHDAGGNPTFGGPFGKIFSTVGTPRLIQFSLKLAF |
| Ga0210402_115282802 | 3300021478 | Soil | WNHANFANPSVTDVQNPAAFGRIFATVGTPRLIQFSLRYAF |
| Ga0210410_111919511 | 3300021479 | Soil | FASPAQADVENSSTFSRITQTVGTPRLIQFSLRYAF |
| Ga0247673_10452411 | 3300024224 | Soil | WNHANFANPAFTDVEGGNFGKITSTVGTPRLIQFSLRYAF |
| Ga0247671_10807572 | 3300024284 | Soil | HANFFNPAFTDVEGGNFGKITSTVGTSRLIQFSLRYAF |
| Ga0247690_10467872 | 3300024287 | Soil | ANFFNPAFTDVEGGNFGKITSTVGTSRLIQFSLRYAF |
| Ga0207684_109905052 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | NPAINDVETIGVPNSPFGKIFSTVGTPRLIQFSLRYSF |
| Ga0207646_117319752 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PAINDVETIGVPNSPFGKIFSTVGTPRLIQFSLRYSF |
| Ga0207686_104657931 | 3300025934 | Miscanthus Rhizosphere | NPAINDVEVGSGPGSPFGRIFSTVGTPRLIQFSLRYSF |
| Ga0257147_10270042 | 3300026475 | Soil | NPSGTDVESISLANSPFGKITSTLGTPRLIQFSLRYAF |
| Ga0209808_10104581 | 3300026523 | Soil | ANFANPGNGTATDVEIPGSFGRIFSTVGTPRLIQFSLRYAF |
| Ga0209806_10249514 | 3300026529 | Soil | ANPSINDVETITHDNLGNPTSDGPFGKIFSTVGTPRLIQFSLRYTF |
| Ga0209805_11003481 | 3300026542 | Soil | NIWNHANFANPASTDVQNPGAFGKIVSTVGTPRLIQFSLRYAF |
| Ga0209805_13276631 | 3300026542 | Soil | FNIWNHANFANPGNGTATDVEIPGSFGRIFSTVGTPRLIQFSLRYAF |
| Ga0179587_105089401 | 3300026557 | Vadose Zone Soil | NHANFANPAFNDVENPGPFGKIFSTVGTPRLIQFSLRYAF |
| Ga0207741_10117782 | 3300026941 | Tropical Forest Soil | IWNHANFANPAITDVETIGPNSPFGQIFSTTGTPRLIQFSLRFGF |
| Ga0208993_10927302 | 3300027480 | Forest Soil | WNHANFANPGNGTATDVEITGSFGRIFSTVGTPRLIQFSLRYAF |
| Ga0209038_100700531 | 3300027737 | Bog Forest Soil | PAVTDVETAGTPNSPFGKIVSTNGQPRLIQFSLRYSF |
| Ga0209689_10147267 | 3300027748 | Soil | ANFGNPTVTDVETIGGANSPFGKITSTVGTPRLVQFSLRYAF |
| Ga0209040_104391711 | 3300027824 | Bog Forest Soil | AASANFANPAFTDVEGGNFGRITSTVGAPRLIQFSLRYAF |
| Ga0209039_102924701 | 3300027825 | Bog Forest Soil | IWNHANFANPSINDVETIGPGSPFGKIFSTVGTPRLIQFSLRLAF |
| Ga0209693_101202961 | 3300027855 | Soil | FNMWNHANFGNPTVTDVETIGPNSPFGKITSTVGTPRLIQFSLRYSF |
| Ga0209415_108121592 | 3300027905 | Peatlands Soil | MWNHANFANPAVTDVETIALPNSPFGKIISSRGVPRLIQFSLRYAF |
| Ga0302159_100366063 | 3300028646 | Fen | FNIWNHANFASPASNDVENPGPFGKIQSTVGTPRLIQFQLRYAF |
| Ga0302230_101195711 | 3300028871 | Palsa | GNPQVTDVETIGPDSPFGKINTTVGQPRLIQFSLRYSF |
| Ga0311336_106652142 | 3300029990 | Fen | FTADFFNIWNHANFSSPSLNDVENPGAFGKIFSTVGTPRLVQLQLRYSF |
| Ga0302306_100733961 | 3300030043 | Palsa | FDIWNHPNFGNPQVTDVETIGPDSPFGKINTTVGQPRLIQFSLRYSF |
| Ga0170834_1077358691 | 3300031057 | Forest Soil | FANPPINDVETITHDAGGNPTFGGPFGKIFSTVGTPRLIQFSLKLAF |
| Ga0170823_137424812 | 3300031128 | Forest Soil | SATDVEAIGLPNSPFGKITSALGTPRLIQFSLRYAF |
| Ga0170824_1244085561 | 3300031231 | Forest Soil | WNHANFANPALTDIGAGSGFGKIFSTTGTPRLIQFSLRYAF |
| Ga0170818_1155075711 | 3300031474 | Forest Soil | IWNHANFGNPSVNDVETIPLPNSPFGKITSTVGTPRLIQLSLRYAF |
| Ga0318573_106408092 | 3300031564 | Soil | HANFASPAQSDVENASTFSKITQTVGTPRLIQFSLRYAF |
| Ga0310686_1040626422 | 3300031708 | Soil | NFGNPAFTDVEGGSFGKITSTVGTPRLIQFSLRYAF |
| Ga0310686_1187512141 | 3300031708 | Soil | MRLFWSVFSSPAFVDVESQRNFGQITSTQGTPRLVQFAGRIAF |
| Ga0307476_105508041 | 3300031715 | Hardwood Forest Soil | ANPVATDVESAGNFGVITSTKGVPRLIQFSLRYSF |
| Ga0310813_121568431 | 3300031716 | Soil | NQSSQTDVENPGAFGKITSTVGTPRLIQFSLRYAF |
| Ga0307477_104456512 | 3300031753 | Hardwood Forest Soil | WNHANFGNPAFTDVEGGNFGKITSTVGAPRLIQLSLRYAF |
| Ga0307475_111490533 | 3300031754 | Hardwood Forest Soil | IWNHANFANPTFTDISNPAFGKIFSTVGTPRLIQFSLRYAF |
| Ga0318546_103430171 | 3300031771 | Soil | HPNFGNPAVTDVETIGAPNSPFGKITSTVGTPRLIQFSLRLSF |
| Ga0318576_102159083 | 3300031796 | Soil | IWNHANFASPAQSDVENASTFSKITQTVGTPRLIQFSLRYAF |
| Ga0307473_102481471 | 3300031820 | Hardwood Forest Soil | DFFNIWNHVNFASPSLNDVENPAAFGKINSTVGTPRLIQLSLRYAF |
| Ga0307478_106224421 | 3300031823 | Hardwood Forest Soil | VWNHANFANPTFTDISNPAFGKIFSTVGTPRLIQFSLRYAF |
| Ga0307479_105754503 | 3300031962 | Hardwood Forest Soil | PNFGNPAVTDVETAGVTNSPFGKITSATGTPRLIQFSLRYAF |
| Ga0318532_103132692 | 3300032051 | Soil | IWNHTNFANPAINDVEVGTGPGSPFGKIFSTVGTPRLIQFSLRYAF |
| Ga0318540_105745572 | 3300032094 | Soil | IWNHANFANPAVNDVETIGTQNSPFGKITTTVGTSRLIQFSLRLAF |
| Ga0307470_104370391 | 3300032174 | Hardwood Forest Soil | PSINDVETIGTNPATSPFGKIFSTVGTPRLIQFSLRYAF |
| Ga0307470_108803671 | 3300032174 | Hardwood Forest Soil | ANPAINDVETIGVPNSPFGKIFSTVGTPRLIQFSLRYSF |
| Ga0307470_118033152 | 3300032174 | Hardwood Forest Soil | NFGNPSSNDVENPGAFGKIVSTVGTPRLIQFQLRYAF |
| Ga0307471_1000692581 | 3300032180 | Hardwood Forest Soil | NIWNHANFSNPASTDVESIPLSNSPFGKIISTVGTPRLIQFSLRYAF |
| Ga0307471_1001449871 | 3300032180 | Hardwood Forest Soil | ANFGNPSSNDVENPGAFGKIVSTVGTPRLIQFQLRYAF |
| Ga0307471_1025797871 | 3300032180 | Hardwood Forest Soil | WNHANFGNPSVNDVETISLPNSPFGRITSTVGTPRLIQLSLRYAF |
| Ga0315742_120022372 | 3300032756 | Forest Soil | VNFGNPAFTDVEGGSFGKITSTVGTPRLIQFSLRYAF |
| Ga0335085_122916542 | 3300032770 | Soil | NHANFANPVSTDVESPGNFGFITSAKGVPRLIQFSLRYAF |
| Ga0335082_112280022 | 3300032782 | Soil | NHANFANPVATDVESPGNFGVITSTKGVPRLIQFSVRLSF |
| Ga0335079_111129112 | 3300032783 | Soil | SNPVATDVESPGNFGVITSTKGVPRLIQFSLRYAF |
| Ga0335070_100285549 | 3300032829 | Soil | TDVETINASDPSASPFGKIFSTVGTPRLIQFSLRLSF |
| Ga0335081_102935501 | 3300032892 | Soil | FANPAFTDVEVGSAFGKIFNSTGTPRLMQFSLRWAF |
| Ga0335076_100356611 | 3300032955 | Soil | ITDVETLGEANSPFGKINSTVGNPRLIQFQLRYAF |
| Ga0335073_118607281 | 3300033134 | Soil | NFANPAVTDVETINLSDPAASPFGKIVSTVGNPRLIQFSLRYSF |
| Ga0335077_112088911 | 3300033158 | Soil | LWNHTNFSNPSGTDVESIGLANSPFGKITSTAGTPRLIQFSLRYAF |
| ⦗Top⦘ |