| Basic Information | |
|---|---|
| Family ID | F044603 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 154 |
| Average Sequence Length | 46 residues |
| Representative Sequence | GLGPFPTRVGVNFDELLQSLGVPAAPNRAQSAFGLLPAGYPANW |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.05 % |
| % of genes from short scaffolds (< 2000 bps) | 87.01 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.727 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.117 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.403 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.72% β-sheet: 0.00% Coil/Unstructured: 90.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF04075 | F420H2_quin_red | 9.09 |
| PF01844 | HNH | 4.55 |
| PF00440 | TetR_N | 3.25 |
| PF03795 | YCII | 2.60 |
| PF00583 | Acetyltransf_1 | 1.95 |
| PF04679 | DNA_ligase_A_C | 1.95 |
| PF08044 | DUF1707 | 1.95 |
| PF00891 | Methyltransf_2 | 1.30 |
| PF00005 | ABC_tran | 1.30 |
| PF00291 | PALP | 1.30 |
| PF02518 | HATPase_c | 0.65 |
| PF13649 | Methyltransf_25 | 0.65 |
| PF12681 | Glyoxalase_2 | 0.65 |
| PF13560 | HTH_31 | 0.65 |
| PF12773 | DZR | 0.65 |
| PF12900 | Pyridox_ox_2 | 0.65 |
| PF13468 | Glyoxalase_3 | 0.65 |
| PF00664 | ABC_membrane | 0.65 |
| PF00561 | Abhydrolase_1 | 0.65 |
| PF01554 | MatE | 0.65 |
| PF00933 | Glyco_hydro_3 | 0.65 |
| PF03171 | 2OG-FeII_Oxy | 0.65 |
| PF12697 | Abhydrolase_6 | 0.65 |
| PF07690 | MFS_1 | 0.65 |
| PF01370 | Epimerase | 0.65 |
| PF01425 | Amidase | 0.65 |
| PF13365 | Trypsin_2 | 0.65 |
| PF12833 | HTH_18 | 0.65 |
| PF03734 | YkuD | 0.65 |
| PF12802 | MarR_2 | 0.65 |
| PF07729 | FCD | 0.65 |
| PF00294 | PfkB | 0.65 |
| PF06210 | DUF1003 | 0.65 |
| PF13561 | adh_short_C2 | 0.65 |
| PF00196 | GerE | 0.65 |
| PF00731 | AIRC | 0.65 |
| PF14226 | DIOX_N | 0.65 |
| PF05593 | RHS_repeat | 0.65 |
| PF03551 | PadR | 0.65 |
| PF04203 | Sortase | 0.65 |
| PF12695 | Abhydrolase_5 | 0.65 |
| PF12680 | SnoaL_2 | 0.65 |
| PF07859 | Abhydrolase_3 | 0.65 |
| PF03781 | FGE-sulfatase | 0.65 |
| PF01593 | Amino_oxidase | 0.65 |
| PF13180 | PDZ_2 | 0.65 |
| PF02720 | DUF222 | 0.65 |
| PF02371 | Transposase_20 | 0.65 |
| PF00890 | FAD_binding_2 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.60 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.95 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.65 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.65 |
| COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.65 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.65 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.65 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.65 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.65 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.65 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.38 % |
| Unclassified | root | N/A | 26.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_117102329 | Not Available | 597 | Open in IMG/M |
| 3300004091|Ga0062387_101271971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 580 | Open in IMG/M |
| 3300005159|Ga0066808_1008605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 889 | Open in IMG/M |
| 3300005335|Ga0070666_11526259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
| 3300005445|Ga0070708_100651196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 993 | Open in IMG/M |
| 3300005455|Ga0070663_100555594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 960 | Open in IMG/M |
| 3300005467|Ga0070706_101165383 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005468|Ga0070707_100023509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5830 | Open in IMG/M |
| 3300005529|Ga0070741_10362061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1342 | Open in IMG/M |
| 3300005536|Ga0070697_101636163 | Not Available | 576 | Open in IMG/M |
| 3300005560|Ga0066670_10456801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 787 | Open in IMG/M |
| 3300005560|Ga0066670_10757213 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005561|Ga0066699_10657112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 751 | Open in IMG/M |
| 3300005564|Ga0070664_101764812 | Not Available | 587 | Open in IMG/M |
| 3300005610|Ga0070763_10872010 | Not Available | 535 | Open in IMG/M |
| 3300005764|Ga0066903_100985308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1538 | Open in IMG/M |
| 3300005764|Ga0066903_102222767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1058 | Open in IMG/M |
| 3300005764|Ga0066903_103218749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Labedaea → Labedaea rhizosphaerae | 883 | Open in IMG/M |
| 3300005764|Ga0066903_108387761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300005841|Ga0068863_100554042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1135 | Open in IMG/M |
| 3300005898|Ga0075276_10136003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300005900|Ga0075272_1088906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300005921|Ga0070766_10991329 | Not Available | 578 | Open in IMG/M |
| 3300006028|Ga0070717_10899673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 806 | Open in IMG/M |
| 3300006059|Ga0075017_101128382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300006176|Ga0070765_100572131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1064 | Open in IMG/M |
| 3300006237|Ga0097621_102417634 | Not Available | 503 | Open in IMG/M |
| 3300006755|Ga0079222_10881552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 747 | Open in IMG/M |
| 3300006755|Ga0079222_11263773 | Not Available | 668 | Open in IMG/M |
| 3300006806|Ga0079220_10537516 | Not Available | 811 | Open in IMG/M |
| 3300006854|Ga0075425_100898860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1012 | Open in IMG/M |
| 3300006893|Ga0073928_10281962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. | 1256 | Open in IMG/M |
| 3300006904|Ga0075424_102004504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
| 3300009038|Ga0099829_10438243 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300009038|Ga0099829_10985561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
| 3300009101|Ga0105247_10690161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 767 | Open in IMG/M |
| 3300009792|Ga0126374_10120745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1532 | Open in IMG/M |
| 3300010046|Ga0126384_10574574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 983 | Open in IMG/M |
| 3300010046|Ga0126384_12392709 | Not Available | 511 | Open in IMG/M |
| 3300010325|Ga0134064_10349417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300010337|Ga0134062_10214851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 882 | Open in IMG/M |
| 3300010337|Ga0134062_10812588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 501 | Open in IMG/M |
| 3300010358|Ga0126370_10033666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3114 | Open in IMG/M |
| 3300010358|Ga0126370_12040038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 561 | Open in IMG/M |
| 3300010358|Ga0126370_12271117 | Not Available | 536 | Open in IMG/M |
| 3300010360|Ga0126372_10114065 | Not Available | 2069 | Open in IMG/M |
| 3300010360|Ga0126372_10159495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1817 | Open in IMG/M |
| 3300010361|Ga0126378_10324899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1645 | Open in IMG/M |
| 3300010366|Ga0126379_10108317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2491 | Open in IMG/M |
| 3300010376|Ga0126381_100806157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1348 | Open in IMG/M |
| 3300010376|Ga0126381_101437079 | Not Available | 997 | Open in IMG/M |
| 3300010379|Ga0136449_103793792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300010398|Ga0126383_10032856 | Not Available | 4139 | Open in IMG/M |
| 3300010880|Ga0126350_10681421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2096 | Open in IMG/M |
| 3300011270|Ga0137391_10024816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4982 | Open in IMG/M |
| 3300012176|Ga0153952_1051345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 940 | Open in IMG/M |
| 3300012189|Ga0137388_10051729 | All Organisms → cellular organisms → Bacteria | 3335 | Open in IMG/M |
| 3300012198|Ga0137364_10140534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1738 | Open in IMG/M |
| 3300012199|Ga0137383_10256126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1282 | Open in IMG/M |
| 3300012205|Ga0137362_11298081 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012210|Ga0137378_10487098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1140 | Open in IMG/M |
| 3300012948|Ga0126375_11579109 | Not Available | 564 | Open in IMG/M |
| 3300012961|Ga0164302_10711784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 745 | Open in IMG/M |
| 3300016319|Ga0182033_10056499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2690 | Open in IMG/M |
| 3300016357|Ga0182032_11097067 | Not Available | 682 | Open in IMG/M |
| 3300016371|Ga0182034_11198859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
| 3300016404|Ga0182037_11690782 | Not Available | 564 | Open in IMG/M |
| 3300017822|Ga0187802_10298797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 627 | Open in IMG/M |
| 3300017926|Ga0187807_1089112 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300017926|Ga0187807_1151170 | Not Available | 742 | Open in IMG/M |
| 3300017947|Ga0187785_10783137 | Not Available | 506 | Open in IMG/M |
| 3300017970|Ga0187783_10004337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10507 | Open in IMG/M |
| 3300017972|Ga0187781_11133208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300018029|Ga0187787_10396686 | Not Available | 543 | Open in IMG/M |
| 3300018058|Ga0187766_10438893 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 870 | Open in IMG/M |
| 3300018058|Ga0187766_10487808 | Not Available | 828 | Open in IMG/M |
| 3300018058|Ga0187766_11450225 | Not Available | 505 | Open in IMG/M |
| 3300020582|Ga0210395_10097391 | All Organisms → cellular organisms → Bacteria | 2174 | Open in IMG/M |
| 3300021170|Ga0210400_11048048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 662 | Open in IMG/M |
| 3300021171|Ga0210405_11012308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 626 | Open in IMG/M |
| 3300021180|Ga0210396_10969065 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Haloferacaceae → Haloplanus → unclassified Haloplanus → Haloplanus sp. GDY1 | 722 | Open in IMG/M |
| 3300021180|Ga0210396_11418364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
| 3300021401|Ga0210393_10903282 | Not Available | 717 | Open in IMG/M |
| 3300021402|Ga0210385_11187771 | Not Available | 585 | Open in IMG/M |
| 3300021404|Ga0210389_11236387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 574 | Open in IMG/M |
| 3300021407|Ga0210383_11781803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 502 | Open in IMG/M |
| 3300021560|Ga0126371_10742413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1129 | Open in IMG/M |
| 3300022527|Ga0242664_1159306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
| 3300025905|Ga0207685_10038394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1770 | Open in IMG/M |
| 3300025910|Ga0207684_10318724 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300026340|Ga0257162_1044281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300027029|Ga0208731_1032372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 572 | Open in IMG/M |
| 3300027895|Ga0209624_10517641 | Not Available | 794 | Open in IMG/M |
| 3300027915|Ga0209069_10364364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 783 | Open in IMG/M |
| 3300029636|Ga0222749_10221496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 953 | Open in IMG/M |
| 3300030730|Ga0307482_1175582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella | 638 | Open in IMG/M |
| 3300031545|Ga0318541_10631280 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031561|Ga0318528_10449453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300031573|Ga0310915_10269654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1200 | Open in IMG/M |
| 3300031573|Ga0310915_10946810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300031640|Ga0318555_10366257 | Not Available | 781 | Open in IMG/M |
| 3300031640|Ga0318555_10540734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
| 3300031682|Ga0318560_10309265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
| 3300031708|Ga0310686_103574267 | Not Available | 1648 | Open in IMG/M |
| 3300031708|Ga0310686_119311888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 693 | Open in IMG/M |
| 3300031713|Ga0318496_10193008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
| 3300031719|Ga0306917_10135929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1809 | Open in IMG/M |
| 3300031719|Ga0306917_11524873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300031723|Ga0318493_10711950 | Not Available | 563 | Open in IMG/M |
| 3300031736|Ga0318501_10510932 | Not Available | 656 | Open in IMG/M |
| 3300031748|Ga0318492_10817480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300031751|Ga0318494_10407159 | Not Available | 789 | Open in IMG/M |
| 3300031751|Ga0318494_10788508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 557 | Open in IMG/M |
| 3300031765|Ga0318554_10038643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2585 | Open in IMG/M |
| 3300031765|Ga0318554_10533869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300031771|Ga0318546_10126239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1705 | Open in IMG/M |
| 3300031781|Ga0318547_10659897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300031782|Ga0318552_10042474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2131 | Open in IMG/M |
| 3300031795|Ga0318557_10479582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300031796|Ga0318576_10308499 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300031799|Ga0318565_10059972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1782 | Open in IMG/M |
| 3300031805|Ga0318497_10741597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. Leaf395 | 551 | Open in IMG/M |
| 3300031846|Ga0318512_10328395 | Not Available | 763 | Open in IMG/M |
| 3300031897|Ga0318520_10033028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2603 | Open in IMG/M |
| 3300031897|Ga0318520_10535909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
| 3300031912|Ga0306921_11499530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae | 737 | Open in IMG/M |
| 3300031912|Ga0306921_12353165 | Not Available | 557 | Open in IMG/M |
| 3300031941|Ga0310912_11284397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
| 3300031942|Ga0310916_10613034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 924 | Open in IMG/M |
| 3300032010|Ga0318569_10071434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1536 | Open in IMG/M |
| 3300032010|Ga0318569_10081051 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300032010|Ga0318569_10352764 | Not Available | 686 | Open in IMG/M |
| 3300032039|Ga0318559_10170962 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300032043|Ga0318556_10109028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1407 | Open in IMG/M |
| 3300032059|Ga0318533_10636224 | Not Available | 783 | Open in IMG/M |
| 3300032063|Ga0318504_10068650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1534 | Open in IMG/M |
| 3300032063|Ga0318504_10504077 | Not Available | 580 | Open in IMG/M |
| 3300032065|Ga0318513_10491312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300032065|Ga0318513_10679879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300032066|Ga0318514_10462769 | Not Available | 674 | Open in IMG/M |
| 3300032068|Ga0318553_10631725 | Not Available | 560 | Open in IMG/M |
| 3300032090|Ga0318518_10473166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300032205|Ga0307472_101677847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300032261|Ga0306920_101271472 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300032261|Ga0306920_102115106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 785 | Open in IMG/M |
| 3300032770|Ga0335085_10062128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4985 | Open in IMG/M |
| 3300032783|Ga0335079_11230603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300032828|Ga0335080_10275786 | Not Available | 1832 | Open in IMG/M |
| 3300032892|Ga0335081_10179275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 2971 | Open in IMG/M |
| 3300033290|Ga0318519_10028253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2612 | Open in IMG/M |
| 3300034819|Ga0373958_0084544 | Not Available | 723 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.49% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.19% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.60% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.30% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.30% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.30% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.30% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.30% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.65% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.65% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.65% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005159 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
| 3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012176 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1171023293 | 3300000956 | Soil | IAGLGPFPTRIGVNFDQLLHSLGVPAAPNRTQPAHGLLPAGYPASW* |
| Ga0062387_1012719712 | 3300004091 | Bog Forest Soil | AGAIGGGGPFPTTVGVNFDELLTSLGVPAAPNRYQPASGLLPPNYPSS* |
| Ga0066808_10086052 | 3300005159 | Soil | AGAIAGLGPFPTRIGVNFDELLQSLGVSAAPNRAQPAFGLLPAGYPANW* |
| Ga0070666_115262592 | 3300005335 | Switchgrass Rhizosphere | AEAGGVGGNGPFPTRIGLSFEELLQSLGVPTAPNRTQAPYGLLPPDYPAIGT* |
| Ga0070708_1006511962 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ANGPFPTRVGESFDVLLQSLGVPAAPNSGQTGFGLLPPNYPS* |
| Ga0070663_1005555943 | 3300005455 | Corn Rhizosphere | GNGPFPTRIGLSFEELLQSLGVPTAPNRTQAPYGLLPPDYPAIGT* |
| Ga0070706_1011653831 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GIGANGPFPTRVGESFDVLLQSLGVPAAPNSGQTGFGLLPPNYPS* |
| Ga0070707_1000235098 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GPFPTRVGESFDVLLQSLGVPAAPNSGQTGFGLLPPNYPS* |
| Ga0070741_103620612 | 3300005529 | Surface Soil | SELSEAGGIGGGGPFPTRVGVSFDGLLRSLGVPAAPNAADAASGILPAGYPAG* |
| Ga0070697_1016361631 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EAGAIAGLGPFPTRVGVNFDELLRSLGVPAAPNRAQPAFGLLPAGYPANW* |
| Ga0066670_104568012 | 3300005560 | Soil | IGLSFEELLQSLGAPTGPNRTQAPFGLLPPGYPPIGT* |
| Ga0066670_107572131 | 3300005560 | Soil | AGGIGGLGPFPTRIGANFDELLQSLGVRAAPNRAQPAHGLLPVGYPASWR* |
| Ga0066699_106571121 | 3300005561 | Soil | PFPTRIGLSFEELLQSLGAPTAPNRTQAPFGVLPPGYPAIGT* |
| Ga0070664_1017648121 | 3300005564 | Corn Rhizosphere | PEAGAIAGLGPFPTRVGVNFDELLQSLGVPAAPNRAQSAFGLLPAGYPANW* |
| Ga0070763_108720102 | 3300005610 | Soil | AAAAGGIGAFGPFPTKVGFNFDQLLQSLGVPPAPNADDPASGLLPSNYPANGG* |
| Ga0066903_1009853083 | 3300005764 | Tropical Forest Soil | AGGIAGLGPFPTRVGVNFDQLLRSLGVAAAPNRTQPAHGLLPAGYPASW* |
| Ga0066903_1022227671 | 3300005764 | Tropical Forest Soil | IGGGGPFPTRVGANFDELLQALGVPAAPTPLEPAYGTLPANYPATW* |
| Ga0066903_1032187492 | 3300005764 | Tropical Forest Soil | GLATSQLTEAAAIGSGGFPAVVGVNFDELLISLGAPPAPNRYQPAYGYLPVSYPTSW* |
| Ga0066903_1083877612 | 3300005764 | Tropical Forest Soil | PTRIGLNFEELLQSLGVPAAPNRDQSPYGLLPANYPPVRG* |
| Ga0068863_1005540421 | 3300005841 | Switchgrass Rhizosphere | PFPTRVGVNFDELLQSLGVPAAPNRAQSAFGLLPAGYPANW* |
| Ga0075276_101360031 | 3300005898 | Rice Paddy Soil | PTMIGMNFDQMLQSLGVPAGNNATQTAYGTLPAGYPASG* |
| Ga0075272_10889062 | 3300005900 | Rice Paddy Soil | GGISGNGPFPTSIGLNFEELLQSLGVPAGNNRDQAVYGILPPNYPAIQP* |
| Ga0070766_109913291 | 3300005921 | Soil | IGGGGPFPTTIGLNFDELLISLGVTAAPNRYQIASGLLPPNYPAY* |
| Ga0070717_108996732 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LGPFPTRIGVNFDELLQSLGVPAAPNRAQSQYGLLPAGYPASWG* |
| Ga0075017_1011283821 | 3300006059 | Watersheds | PEAGGISGTGPFPTKIGVNFEELLQSLGVPAAPNRTQPAYGLLPASYPAN* |
| Ga0070765_1005721311 | 3300006176 | Soil | VGGNGPFPTRIGLSFEELLQSLGAPTAPNRTQALFGLLPPGYPAIGT* |
| Ga0097621_1024176341 | 3300006237 | Miscanthus Rhizosphere | GLGPFPTRVGVNFDELLQSLGVPAAPNRAQSAFGLLPAGYPANW* |
| Ga0079222_108815523 | 3300006755 | Agricultural Soil | IGLSFETLLQSLGVPTVPNRTQAPYGLLPPGYPAIGT* |
| Ga0079222_112637732 | 3300006755 | Agricultural Soil | ESELPEAGGIGGLGPFPTRIGLNFDELLHSLGVPAAPNRAQPPHGLLPAGYPASWR* |
| Ga0079220_105375162 | 3300006806 | Agricultural Soil | LPEAGSIGGLGPFPTRVGVNFDQLLQSLGVPAAPNRTEAASGLLPAGYPASW* |
| Ga0075425_1008988602 | 3300006854 | Populus Rhizosphere | AESQLPEAGAIAGLGPFPTRVGVNFDELLRSLGVPAAPNRAQPAFGLLPAGYPANW* |
| Ga0073928_102819623 | 3300006893 | Iron-Sulfur Acid Spring | LSAESELPQAGGIGGLGPFPTRIGVNFDELLHSLGVPAAPNRAQPEYGLLPAGYPASW* |
| Ga0075424_1020045041 | 3300006904 | Populus Rhizosphere | ESQLAEAGGVGGNGPFPTRIGLSFETLLQSLGVPTAPNRTQAPYGLLPPGYPAIGT* |
| Ga0099829_104382431 | 3300009038 | Vadose Zone Soil | GGIGGLGPFPTRIGVNFDELLRSLGVPAAPNRAQPAYGLLPAGYPASWR* |
| Ga0099829_109855611 | 3300009038 | Vadose Zone Soil | GGISGGDPIPTRVGVNFDELLQSLGVPASPDATQPAYGLLPAGYPVSWK* |
| Ga0105247_106901611 | 3300009101 | Switchgrass Rhizosphere | TRVGVNFDELLRSLGVPAAPNRAQPAFGLLPAGYPANW* |
| Ga0126374_101207451 | 3300009792 | Tropical Forest Soil | QAGGIGANGPFPTRVGVSFDVLLQSLGVPAAPNSGEPAFGLLPPNYPA* |
| Ga0126384_105745741 | 3300010046 | Tropical Forest Soil | RVGANFDELLQALGVPAAPNRAEPQHGLLPAGYPASWK* |
| Ga0126384_123927091 | 3300010046 | Tropical Forest Soil | RIGVNFDQLLHSLGVAAAPNRTQPAHGLLPAGYPASW* |
| Ga0134064_103494171 | 3300010325 | Grasslands Soil | AGGIGGLGPFPTRVGLNFDELLQSLGVPAAPNRAQTPHGLLPVGYPASWR* |
| Ga0134062_102148513 | 3300010337 | Grasslands Soil | GGVGGNGPFPTRIGLNFEELLQSVGVPAAPNRTQAPYGLLPPGYPAIGT* |
| Ga0134062_108125882 | 3300010337 | Grasslands Soil | VGGNGPFPTRIGLNFEELLQSLGVPAAPNRDQAPFGLLPPNYPVIGA* |
| Ga0126370_100336667 | 3300010358 | Tropical Forest Soil | GIGGAGPFPTRVGVNFDELLHSLGVPAAPNLTEPAYGLLPSNYPTRW* |
| Ga0126370_120400382 | 3300010358 | Tropical Forest Soil | GVNFDELLHALGVPAAPNFTDPVYGTLPIGYPAWK* |
| Ga0126370_122711172 | 3300010358 | Tropical Forest Soil | AGGIAGLGPFPTRIGVNFDQLLQSLGVPAAPNRTQPASGLLPAGYPASW* |
| Ga0126372_101140653 | 3300010360 | Tropical Forest Soil | GPFPTRIGVNFDQLLQSLGVPAAPNRTQLAYGLLPVGYPASW* |
| Ga0126372_101594951 | 3300010360 | Tropical Forest Soil | IGGLGPFPTRVGVNFDELLQALGVPAAPNRAQPPNGLLPFGYPASWK* |
| Ga0126378_103248991 | 3300010361 | Tropical Forest Soil | AGGIGGGGPFPTRVGANFDELLQALGVPAAPTPLEPAYGTLPANYPATW* |
| Ga0126379_101083171 | 3300010366 | Tropical Forest Soil | TRVGANFDELLQALGVPAAPNRAEPQHGLLPAGYPASWK* |
| Ga0126381_1008061573 | 3300010376 | Tropical Forest Soil | AGSIGGGGPFPTRIGVNFEELLQSLGVPTAPNRALLPYGLLPANYPAMLA* |
| Ga0126381_1014370791 | 3300010376 | Tropical Forest Soil | GLGPFPTKVGVNFDELLQSLGVTAAPNRTQPAFGLLPAGYPASW* |
| Ga0136449_1037937923 | 3300010379 | Peatlands Soil | LEAGGINGGGPFPTRIGVNFEELLQSLGVPAAPNRTQPAYGLLPASYPAN* |
| Ga0126383_100328562 | 3300010398 | Tropical Forest Soil | EAGGIGGGGPFPTRVGANFDELLQALGVPAAPTPLEPAYGTLPANYPATW* |
| Ga0126350_106814213 | 3300010880 | Boreal Forest Soil | QAGGISGGGPFPTMVGLNFEELLQSLGVPAAPNRDQTAYGLLPANYPAIQG* |
| Ga0137391_100248161 | 3300011270 | Vadose Zone Soil | GVSGNGPFPTRIGVNFDELLQSLGVPAAPNRTQPAYGLLPASYPAN* |
| Ga0153952_10513452 | 3300012176 | Attine Ant Fungus Gardens | PEAGAIGGGGPFPTTVGVNFDEVLTSLGVPVAPNRYQPASGLLPPNYPAN* |
| Ga0137388_100517291 | 3300012189 | Vadose Zone Soil | GGVRGNGPFTTRIGVNFDELLQSLRVPAAPNRTQPAYGLLPARYPAN* |
| Ga0137364_101405341 | 3300012198 | Vadose Zone Soil | GPFPTRIGLNFEELLQSLGVPAAPNRDQAPFGLLPPNYPVTGA* |
| Ga0137383_102561261 | 3300012199 | Vadose Zone Soil | LAEAGGVGGNGPFPTRIGLNFEELLQSVGVPAAPNRTQAPYGLLPPGYPAIGT* |
| Ga0137362_112980812 | 3300012205 | Vadose Zone Soil | IGGGGPFPTTIGLNFDELLISLGVTAAPNRYQPASGLLPPNYPAH* |
| Ga0137378_104870983 | 3300012210 | Vadose Zone Soil | FPTMIGLSFEEMLQSLGVPTAPNRTQAPYGLLPPGYPPIGA* |
| Ga0126375_115791092 | 3300012948 | Tropical Forest Soil | GGIAGLGPFPTRIGVNFDELLQSLGVPAAPNRAQLAYGLLLVGYPARW* |
| Ga0164302_107117841 | 3300012961 | Soil | LAEAGGVGGNGPFPTRIGLSFEELLQSLGVPTAPNRTQAPYGLLPPDYPAIGT* |
| Ga0182033_100564991 | 3300016319 | Soil | GLNFEALLVSLGVPAAPNRDQIGSGILTASYPASW |
| Ga0182032_110970671 | 3300016357 | Soil | AGGLGFFPTAVGVNFDLLLQSLGVPAAPNFGQTASGYVPAIYPANGG |
| Ga0182034_111988592 | 3300016371 | Soil | LPEAGSVGGNGPFPTRIGLNFEELLQSVGVPAAPNRDQSAYGLLPASYPAIEG |
| Ga0182037_116907821 | 3300016404 | Soil | AGSIAGLGPFPTRVGVNFDELLQSLGVPGAPNRTQLAFGLLPASYPASW |
| Ga0187802_102987971 | 3300017822 | Freshwater Sediment | QLPEAGAIGGGGPFPTTVGVNFDELLTSLGVPTAPNRYQPASGFLPPNYPAS |
| Ga0187807_10891123 | 3300017926 | Freshwater Sediment | EAGGIGGAGPFPTVVGTNFDALLQSLGVPAAPNYGEPASGLLPANYPTSYPPNS |
| Ga0187807_11511702 | 3300017926 | Freshwater Sediment | GGDGPFPTQVGVNFDELLVALGVPSAPNIGDQASGLLPPNYPTQWTAG |
| Ga0187785_107831371 | 3300017947 | Tropical Peatland | AIGGLGPFPTRVGVNFDKLLQSLGVTAAPNRTQPPFGLLPAGYPASW |
| Ga0187783_100043371 | 3300017970 | Tropical Peatland | GPFPTMIGLNMDELLIWLGVTPAPNRYEQAFGLLPPNYPQVGG |
| Ga0187781_111332082 | 3300017972 | Tropical Peatland | FPTMVGLNFEELLQSLGAPTAPNRYQTAYGLLPPNYPAIQG |
| Ga0187787_103966861 | 3300018029 | Tropical Peatland | GVNFDQLLQSLGVPAAPNRTQPASGLLPAGYPASW |
| Ga0187766_104388931 | 3300018058 | Tropical Peatland | PFPTRVGVDFDELLQSLGVPAAPNRTQPAFGLLPAGYPSSW |
| Ga0187766_104878081 | 3300018058 | Tropical Peatland | LPEAGAIGGLGPFPTRVGVNFDKLLQSLGVTAAPNRTQPPFGLLPAGYPASW |
| Ga0187766_114502252 | 3300018058 | Tropical Peatland | GDGPFPTMIGVNFDELLESLGVPAAPNRDDYAYGILPANYPANGG |
| Ga0210399_111576032 | 3300020581 | Soil | VGVNFDELLISLGVTAAPNRYQPASGLLPPNYPTS |
| Ga0210395_100973911 | 3300020582 | Soil | ESQLPEAGAIGGGGPFPTTVGVNFDELLISLGVTAAPNRYQPASGLLPPNYPTS |
| Ga0210400_110480482 | 3300021170 | Soil | IGGGGPFPTTVGVNFDEVLTSLGVPVAPNRYQPASGLLPPNYPAN |
| Ga0210405_110123082 | 3300021171 | Soil | ESQLPEAGSVGGNGPFPTRIGLNFEELLQSLGVPAAPNRYQAAYGLLPPDYPVIGD |
| Ga0210396_109690652 | 3300021180 | Soil | ELPEAGGIGGGGPFPTRVGLNFDQLLQLLGAPAAPNAAQTAYGLLPANYPTVWK |
| Ga0210396_114183642 | 3300021180 | Soil | GVGGNGPFPTRIGLSFEELLQSLGAPTAPNRTQAPFGLLPPGYPAIGV |
| Ga0210393_109032821 | 3300021401 | Soil | GGGGPFPTTVGVSFDVLLTSLGVTAAPNRYQPASGLLPANYPPS |
| Ga0210385_111877711 | 3300021402 | Soil | TPEAGGIGGGGPFPTTIGLNFDELLISLGVTAAPNRYQIASGLLPPNYPAY |
| Ga0210389_112363871 | 3300021404 | Soil | TRIGLNFEELLQSLGVPAAPNRYQAPYGLLPPSYPAIGD |
| Ga0210383_117818031 | 3300021407 | Soil | TTVGVNFDEVLTSLGVPVAPNRYQPASGLLPPNYPAN |
| Ga0210410_113621351 | 3300021479 | Soil | IGLNFDELLISLGVTPAPNRYQIASGLLPSNYPAN |
| Ga0126371_107424131 | 3300021560 | Tropical Forest Soil | EAGGIGGIGPFPTRIGVNFDALLQSLGVPAAPNRTQPPFGLLPVGYPASW |
| Ga0242664_11593061 | 3300022527 | Soil | IGGGGPFPTTVGVNFDELLISLGVTAAPNRYQPASGLLPPNYPTS |
| Ga0207685_100383944 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | PFPTRIGLSFEELLQSLGVPTAPNRTQAPYGLLPPDYPAIGT |
| Ga0207684_103187241 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LAESVLPQAGGIGANGPFPTRVGESFDVLLQSLGVPAAPNSGQTGFGLLPPNYPS |
| Ga0257162_10442811 | 3300026340 | Soil | GGIAGLGPFPTRVGVNFDELLQSLGVPAAPNRTQPAYGLLPAAYPAIW |
| Ga0208731_10323722 | 3300027029 | Forest Soil | VSAESQLPEAGAIGGGGPFPTTVGVNFDELLISLGVTAAPNRYQPASGLLPPNYPTS |
| Ga0209624_105176411 | 3300027895 | Forest Soil | TTVGVSFDVLLTSLGVTAAPNRYQPASGLLPANYPAP |
| Ga0209069_103643641 | 3300027915 | Watersheds | SQLVEAGGVGGNGPFPTMIGLSFEELLQSLEVPTAPNRTQAPYGLLPPGYPPIGA |
| Ga0222749_102214961 | 3300029636 | Soil | RIGLSFEELLQSLGAPTAPNRTQAPFGLLPPGYPAIGT |
| Ga0307482_11755822 | 3300030730 | Hardwood Forest Soil | GDNGPFPSMVGVSFDELLVSLGAPAAPNFGQSAFGLLPPGYPPG |
| Ga0318541_106312801 | 3300031545 | Soil | GFFPTAVGVNFDLLLQSLGVPAAPNFGQTASGYVPAIYPANGG |
| Ga0318528_104494531 | 3300031561 | Soil | VGGNGPFPTRIGLNFEALLQSLGVPAAPNRDQSSYGLLPANYPPIRA |
| Ga0310915_102696543 | 3300031573 | Soil | EAGGLGFFPTAVGVNFDLLLQSLGVPAAPNFGQTASGYVPAIYPANGG |
| Ga0310915_109468102 | 3300031573 | Soil | IGGYGPFPTRVGANFDELLQMLGVPAAPNAGDVAYGILPANYPAIWP |
| Ga0318555_103662572 | 3300031640 | Soil | AAGGIGGYGPFPTRIGANFDELLQMLGVPAAPNAGDIAYGLLPAGYPTSWR |
| Ga0318555_105407341 | 3300031640 | Soil | RIGLNFEALLQSLGVPAAPNRDQSSYGLLPANYPPIRA |
| Ga0318560_103092652 | 3300031682 | Soil | PEAGSIAGLGPFPTRVGVNFDELLQSLGVPGAPNRTQLAFGLLPASYPASW |
| Ga0310686_1035742673 | 3300031708 | Soil | IGGAGPFPTTIGLNFDELLISLGVTAAPNRYQTASGLLPSNYPPN |
| Ga0310686_1193118882 | 3300031708 | Soil | PQAGGISGGGPFPTVVGLNFEELLQSLGVPAAPNRDQTAYGLLPANYPAIQG |
| Ga0318496_101930081 | 3300031713 | Soil | AESQLAEAGSVGGNGPFPTRIGLSFEELLQSVGVPAAPNRDQYPYGLLPANYPPIG |
| Ga0307474_107353592 | 3300031718 | Hardwood Forest Soil | FPTTIGLNFDELLISLGVTPAPNRYQIASGLLPSNYPAN |
| Ga0306917_101359291 | 3300031719 | Soil | AESELPEAGGIGGYGPFPTRVGANFDELLVSLGVPAAPNYGQTEYGILPLAYPGW |
| Ga0306917_115248732 | 3300031719 | Soil | PTRIGLSFEELLQSVGVPAAPNRDQYPYGLLPANYPPIG |
| Ga0318493_107119501 | 3300031723 | Soil | NGASAESELMAAGGIGGYGPFPTRIGANFDELLQMLGVPAAPNAGDIAYGLLPAGYPTSW |
| Ga0318501_105109321 | 3300031736 | Soil | ATAPEAGGLGFFPTAVGVNFDLLLQSLGVPAAPNFGQTASGYVPAIYPANGG |
| Ga0318492_108174802 | 3300031748 | Soil | LGPFPTKVGVNFDELLQSLGVPGAPNRTQLAFGLLPASYPASW |
| Ga0318494_104071591 | 3300031751 | Soil | ESELMAAGGIGGYGPFPTRIGANFDELLQMLGVPAAPNAGDIAYGLLPAGYPTSWR |
| Ga0318494_107885081 | 3300031751 | Soil | VGLNFEELLQSLGVPAAPNRDQRPYGLLPAGYPISWK |
| Ga0318554_100386431 | 3300031765 | Soil | AEAPEAGGLGPFPTMVGVNFDELLQSLGVPAAPNFGQPASGYLPAIYPANGR |
| Ga0318554_105338691 | 3300031765 | Soil | GLNFEELLQSVGVPVAPNHDQSAYGLLPASYPAIEG |
| Ga0318546_101262393 | 3300031771 | Soil | ELAVAGGIGGYGPFPTRVGANFDELLQMLGVPAAPNAGDVAYGILPANYPAIWP |
| Ga0318547_106598972 | 3300031781 | Soil | ESQLAEAGSVGGNGPFPTRIGLSFEELLQSVGVPAAPNRDQFPYGLLPANYPPIG |
| Ga0318552_100424744 | 3300031782 | Soil | RFFPTAVGVNFDLLLQSLGVPAAPNFGQTASGYVPAIYPANGG |
| Ga0318557_104795822 | 3300031795 | Soil | GGIGGWGPFPTRVGANFDALLVSLGVPAAPNYGQTEYGILPLTYPASW |
| Ga0318576_103084993 | 3300031796 | Soil | IGMNFDQLLQSLGVPAAPNRTQSAPNRTQSASGLLPVGYPASW |
| Ga0318565_100599721 | 3300031799 | Soil | FPTRVGVNFDELLQSLGVPGAPNRTQLASGLLPASYPASW |
| Ga0318497_107415971 | 3300031805 | Soil | FPTRIGLNFEALLQSVGVPAAPNRDQSAYGLLPASYPAIEG |
| Ga0318512_103283951 | 3300031846 | Soil | AGAIGGLGPFPTRVGLNFEELLQSLGVPAAPNRTQPPHGLLPAGYPPAWR |
| Ga0318520_100330281 | 3300031897 | Soil | FGTRGGIGGLGPFPTRIGMNFDQLLQSLGVPAAPNRTQSASGLLPVGYPASW |
| Ga0318520_105359092 | 3300031897 | Soil | QLAEAGSVGGNGPFPTRIGLSFEELLQSVGVPAAPNRDQYPYGLLPANYPPIG |
| Ga0306921_114995301 | 3300031912 | Soil | LPQAGAIGGLGPFPTRIGVNFDELLQSLGAPAAPNRAQSPFGILPAGYPASWR |
| Ga0306921_123531651 | 3300031912 | Soil | IGGLGPFPTRVGVNFDQLLQSLGVSAAPNRTQAASGILPAGYPARW |
| Ga0310912_112843972 | 3300031941 | Soil | TRIGLNFEALLQSLGVPAAPNRDQSSYGLLPANYPPIRA |
| Ga0310916_106130343 | 3300031942 | Soil | ESQLPEAGSVGGNGPFPTRIGLNFEALLQSLGVPAAPNRDQSSYGLLPANYPPIRA |
| Ga0318569_100714342 | 3300032010 | Soil | PFPTMVGVNFDELLQSLGVPAAPNFGQPASGYLPAIYPANGR |
| Ga0318569_100810511 | 3300032010 | Soil | PEAGGIGGLGPFPTRIGMNFDELLHSLGVPAAPNRTQSANGILPVGYPASW |
| Ga0318569_103527642 | 3300032010 | Soil | SELPEAGSIAGLGPFPTRVGVNFDSLLQSLGVPGAPNRTQLAFGLLPANYPASW |
| Ga0318559_101709621 | 3300032039 | Soil | GLNFEELLQSLGVPAAPNRTQPPHGLLPAGYPPAWR |
| Ga0318556_101090283 | 3300032043 | Soil | LGPVPTRIGMNFDQLLQSLGVPAAPNRTQSASGLLPVGYPASW |
| Ga0318533_106362243 | 3300032059 | Soil | PQAGGIGGLGPFPTRIGVNFDELLQSLGVPGAPNRAQSQHGLLPAGYPASWR |
| Ga0318504_100686501 | 3300032063 | Soil | VGVNFDELLQSLGVPAAPNFGQPASGFLPAIYPANGR |
| Ga0318504_105040772 | 3300032063 | Soil | IGLNFDELLQSLGVPAAPNRAQPPHGLLPAGYPASWR |
| Ga0318513_104913122 | 3300032065 | Soil | SAESELPEAGGIGGLGPFPTRIGMNFDELLHSLGVPAAPNRTQSANGILPVGYPASW |
| Ga0318513_106798791 | 3300032065 | Soil | GGWGPFPTRVGANFDALLVSLGVPAAPNYGQTEYGILPLTYPASW |
| Ga0318514_104627692 | 3300032066 | Soil | FPTRVGVNFDSLLQSLGVPGAPNRTQLAFGLLPANYPASW |
| Ga0318553_106317252 | 3300032068 | Soil | LGPFPTRVGLNFEELLQSLGVPAAPNRTQPPHGLLPAGYPPAWR |
| Ga0318518_104731662 | 3300032090 | Soil | PTRIGLNFEALLQSLGVPAAPNRDQSSYGLLPANYPPIRA |
| Ga0307472_1016778471 | 3300032205 | Hardwood Forest Soil | LNFEELLQSLGVPAAPNRDQYPYGLLPANYPPIRG |
| Ga0306920_1012714723 | 3300032261 | Soil | VGLNFEELLQSLGVPAAPNRTQPPHGLLPAGYPPAWR |
| Ga0306920_1021151062 | 3300032261 | Soil | AELPQAGAIGGLGPFPTRIGVNFDDLLVALGEPAAPNHDQHAYGLLPAGYPTSWR |
| Ga0335085_100621281 | 3300032770 | Soil | EAGSVGGNGPFPTRIGLNFEELLQSVGVPAAPNRYQSPYGLLPARYPPDGG |
| Ga0335079_112306031 | 3300032783 | Soil | IGMNFDKLLQSLGVPAAPNRTQPASGLLPAGYPASW |
| Ga0335080_102757864 | 3300032828 | Soil | SAESELPQAGGIAGLGPFPTTIGVNFDKLLQSLGVPAAPNRTQPANGLLPAGYPASW |
| Ga0335081_101792751 | 3300032892 | Soil | ISGGGPFPTAVGLSFDVLLQSLGVPAAPNSGQAANGILPPGYPRD |
| Ga0318519_100282535 | 3300033290 | Soil | GIGGGGPFPTRIGVNFEELLQSLGVPAAPNRTQAPYGLLPANYPVIEG |
| Ga0373958_0084544_587_721 | 3300034819 | Rhizosphere Soil | GLGPFPTRVGVNFDQLLESLGVPAAPNRTEAASGLLPAGYPASW |
| ⦗Top⦘ |