| Basic Information | |
|---|---|
| Family ID | F044586 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 154 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLTRRDILQQAGRTAVVLATTAPWWLVRRAHAARQHKLVVWN |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.40 % |
| % of genes near scaffold ends (potentially truncated) | 98.70 % |
| % of genes from short scaffolds (< 2000 bps) | 95.45 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.403 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.338 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.675 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.662 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 49.35 |
| PF13416 | SBP_bac_8 | 12.34 |
| PF01547 | SBP_bac_1 | 1.30 |
| PF13374 | TPR_10 | 0.65 |
| PF07995 | GSDH | 0.65 |
| PF00581 | Rhodanese | 0.65 |
| PF07963 | N_methyl | 0.65 |
| PF10518 | TAT_signal | 0.65 |
| PF07228 | SpoIIE | 0.65 |
| PF12002 | MgsA_C | 0.65 |
| PF13424 | TPR_12 | 0.65 |
| PF07969 | Amidohydro_3 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.40 % |
| Unclassified | root | N/A | 2.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100149568 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300004281|Ga0066397_10098325 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 610 | Open in IMG/M |
| 3300005093|Ga0062594_100500458 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300005172|Ga0066683_10423666 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 820 | Open in IMG/M |
| 3300005294|Ga0065705_10232086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Kaistia → Kaistia adipata | 1268 | Open in IMG/M |
| 3300005295|Ga0065707_10574639 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300005295|Ga0065707_10732171 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005332|Ga0066388_100281081 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2307 | Open in IMG/M |
| 3300005332|Ga0066388_100497004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1856 | Open in IMG/M |
| 3300005438|Ga0070701_10609095 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 724 | Open in IMG/M |
| 3300005440|Ga0070705_100802012 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 749 | Open in IMG/M |
| 3300005468|Ga0070707_100153048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 2246 | Open in IMG/M |
| 3300005468|Ga0070707_102077536 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
| 3300005544|Ga0070686_101460531 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005555|Ga0066692_10365650 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005560|Ga0066670_10495092 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 751 | Open in IMG/M |
| 3300005576|Ga0066708_10758146 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
| 3300005713|Ga0066905_100913921 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 769 | Open in IMG/M |
| 3300005713|Ga0066905_101687768 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005764|Ga0066903_101339050 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1340 | Open in IMG/M |
| 3300005840|Ga0068870_10458269 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300005937|Ga0081455_10640268 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005981|Ga0081538_10270272 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 637 | Open in IMG/M |
| 3300006034|Ga0066656_10865603 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
| 3300006194|Ga0075427_10029508 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300006797|Ga0066659_10837205 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 764 | Open in IMG/M |
| 3300006844|Ga0075428_100258485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1875 | Open in IMG/M |
| 3300006844|Ga0075428_101025896 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300006845|Ga0075421_102152487 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300006846|Ga0075430_101414708 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006853|Ga0075420_100496791 | Not Available | 1054 | Open in IMG/M |
| 3300006853|Ga0075420_100607499 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300006853|Ga0075420_100965281 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300006854|Ga0075425_101122225 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300006914|Ga0075436_101169484 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006914|Ga0075436_101340717 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 542 | Open in IMG/M |
| 3300009012|Ga0066710_104825735 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300009038|Ga0099829_11655447 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300009089|Ga0099828_11345212 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 631 | Open in IMG/M |
| 3300009089|Ga0099828_11520574 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009100|Ga0075418_10907184 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300009100|Ga0075418_13031178 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
| 3300009137|Ga0066709_103393229 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300009156|Ga0111538_11123228 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300009156|Ga0111538_13771596 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300009168|Ga0105104_10650594 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009553|Ga0105249_12576745 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300009691|Ga0114944_1004153 | All Organisms → cellular organisms → Bacteria | 4494 | Open in IMG/M |
| 3300009816|Ga0105076_1033192 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300009817|Ga0105062_1075317 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 644 | Open in IMG/M |
| 3300009820|Ga0105085_1122135 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010043|Ga0126380_11115978 | Not Available | 673 | Open in IMG/M |
| 3300010145|Ga0126321_1172428 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300010145|Ga0126321_1260215 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300010323|Ga0134086_10407095 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
| 3300010337|Ga0134062_10783799 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
| 3300010361|Ga0126378_11191459 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300010362|Ga0126377_10786422 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300010362|Ga0126377_11069444 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300010398|Ga0126383_11290977 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 820 | Open in IMG/M |
| 3300010399|Ga0134127_11010731 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300010400|Ga0134122_11155969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 771 | Open in IMG/M |
| 3300011333|Ga0127502_10365613 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012096|Ga0137389_11020704 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012189|Ga0137388_10849679 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300012199|Ga0137383_10710118 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 734 | Open in IMG/M |
| 3300012203|Ga0137399_10601666 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300012226|Ga0137447_1065872 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 682 | Open in IMG/M |
| 3300012351|Ga0137386_10758489 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 697 | Open in IMG/M |
| 3300012353|Ga0137367_10076821 | All Organisms → cellular organisms → Bacteria | 2472 | Open in IMG/M |
| 3300012353|Ga0137367_10126115 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300012356|Ga0137371_10198713 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300012359|Ga0137385_11140635 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 640 | Open in IMG/M |
| 3300012363|Ga0137390_11482398 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 620 | Open in IMG/M |
| 3300012469|Ga0150984_109776702 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300012582|Ga0137358_10748754 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
| 3300012685|Ga0137397_10827073 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 687 | Open in IMG/M |
| 3300012944|Ga0137410_11476122 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 593 | Open in IMG/M |
| 3300012971|Ga0126369_10316019 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300013306|Ga0163162_11612112 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 740 | Open in IMG/M |
| 3300015241|Ga0137418_10598138 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 865 | Open in IMG/M |
| 3300015372|Ga0132256_102612646 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300015374|Ga0132255_101323880 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300016319|Ga0182033_11186961 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300017656|Ga0134112_10059374 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300018422|Ga0190265_11147009 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300018469|Ga0190270_10720927 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300018469|Ga0190270_11086812 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300018469|Ga0190270_13186782 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300019232|Ga0180114_1009735 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300019238|Ga0180112_1291514 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300019244|Ga0180111_1325922 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 598 | Open in IMG/M |
| 3300019249|Ga0184648_1254894 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300019257|Ga0180115_1217081 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300019259|Ga0184646_1252888 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300019259|Ga0184646_1474429 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300019279|Ga0184642_1359922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae | 696 | Open in IMG/M |
| 3300019458|Ga0187892_10150584 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300020063|Ga0180118_1107837 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300020065|Ga0180113_1394408 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300020065|Ga0180113_1439473 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300020080|Ga0206350_10844404 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300020084|Ga0194110_10542261 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 750 | Open in IMG/M |
| 3300021073|Ga0210378_10244047 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 681 | Open in IMG/M |
| 3300021314|Ga0210370_1191513 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
| 3300022195|Ga0222625_1193162 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300025157|Ga0209399_10179387 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 850 | Open in IMG/M |
| 3300025961|Ga0207712_11231786 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 668 | Open in IMG/M |
| 3300026326|Ga0209801_1240198 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 697 | Open in IMG/M |
| 3300026328|Ga0209802_1233342 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 656 | Open in IMG/M |
| 3300026333|Ga0209158_1174575 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 775 | Open in IMG/M |
| 3300026536|Ga0209058_1009520 | All Organisms → cellular organisms → Bacteria | 7027 | Open in IMG/M |
| 3300027577|Ga0209874_1133338 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300027646|Ga0209466_1093061 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 609 | Open in IMG/M |
| 3300027654|Ga0209799_1071874 | Not Available | 778 | Open in IMG/M |
| 3300027882|Ga0209590_10661475 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300027903|Ga0209488_10676525 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300027909|Ga0209382_12072842 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300028381|Ga0268264_12487154 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300028587|Ga0247828_10169097 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300028673|Ga0257175_1021317 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300028878|Ga0307278_10180327 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300030592|Ga0247612_1001017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marivita → Marivita cryptomonadis | 1863 | Open in IMG/M |
| 3300030634|Ga0247636_10367099 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300030903|Ga0308206_1003429 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300030903|Ga0308206_1087504 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300030903|Ga0308206_1102876 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300030993|Ga0308190_1058870 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300031092|Ga0308204_10034345 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300031094|Ga0308199_1136778 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031094|Ga0308199_1146163 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300031098|Ga0308191_1002081 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300031114|Ga0308187_10143020 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300031114|Ga0308187_10290553 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1059343 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 809 | Open in IMG/M |
| 3300031547|Ga0310887_10040431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marivita → Marivita cryptomonadis | 2027 | Open in IMG/M |
| 3300031561|Ga0318528_10011634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4014 | Open in IMG/M |
| 3300031744|Ga0306918_11528223 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031747|Ga0318502_10332048 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300031820|Ga0307473_10145725 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300031947|Ga0310909_11167314 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300032013|Ga0310906_10589780 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300032180|Ga0307471_101405590 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300032180|Ga0307471_101545077 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300032180|Ga0307471_101638108 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 799 | Open in IMG/M |
| 3300032180|Ga0307471_102937798 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 605 | Open in IMG/M |
| 3300034115|Ga0364945_0151577 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 696 | Open in IMG/M |
| 3300034164|Ga0364940_0097665 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 825 | Open in IMG/M |
| 3300034659|Ga0314780_213558 | Not Available | 510 | Open in IMG/M |
| 3300034661|Ga0314782_149285 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300034663|Ga0314784_081175 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300034669|Ga0314794_115498 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 590 | Open in IMG/M |
| 3300034672|Ga0314797_060698 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300034674|Ga0314799_046553 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.34% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 8.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.60% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.60% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.95% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.95% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.30% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.30% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.30% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.30% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.65% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.65% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.65% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.65% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.65% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019244 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021314 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.671 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030592 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030634 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031098 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034674 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1001495681 | 3300000559 | Soil | MLTRRDMLQQAGRTAAVLATTAPWWLVRRAHAARQNKLVVWNT |
| Ga0066397_100983252 | 3300004281 | Tropical Forest Soil | MLTRRDVLQRAGTAAALATTASWWLVRRAHAARQHKLIVWVPT |
| Ga0062594_1005004582 | 3300005093 | Soil | MIGRHNMLTRRELLQQTGKATTVLSTTAPWWLVRRAHAARQ |
| Ga0066683_104236662 | 3300005172 | Soil | MPTRREILKTAGKTAAVLTTTAPWWLSRTAHAARQAKLVVWNPAAL |
| Ga0065705_102320861 | 3300005294 | Switchgrass Rhizosphere | MQTRREILKTAGKTAVLTTTAPWWLVRRAHAARAAKLVVWNPAALAPQV |
| Ga0065707_105746392 | 3300005295 | Switchgrass Rhizosphere | MLTRRDILQQAGRTAVVVATTAPWWLVRRAHAARETKLVVWN |
| Ga0065707_107321712 | 3300005295 | Switchgrass Rhizosphere | MLTRRDLLRQTGTATALAMTASWWLVHQAHAARDKKLVVWVPTALAPQVD |
| Ga0066388_1002810811 | 3300005332 | Tropical Forest Soil | MWTRRKILRQAGTAVVLATTAPWWLVRRAHAARQTKLVVWNTTALAPQVDKI |
| Ga0066388_1004970042 | 3300005332 | Tropical Forest Soil | MWTRRKILRQAGPAVVLATTAPWWLVRRAHAARQTKLVVWNTTALAPQVDKI |
| Ga0070701_106090952 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTRRELLQQTGKATTVLSTTAPWWLVRRAHAARQAKLVVWNPAALAPQVD |
| Ga0070705_1008020122 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTRREILKRAGAATVVTTTAPWWLVRKAHAARTAKLVVWNPAALAPQVD |
| Ga0070707_1001530483 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTRRDILQQAGRTAAILVTTAPWWLVRRAHAARQNKLVVWNTTALAPQVDK |
| Ga0070707_1020775362 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTRRSLLKTAGTTATILTTTSPWWLVRRAHAARQAKLVVWNPA |
| Ga0070686_1014605312 | 3300005544 | Switchgrass Rhizosphere | MLTRRDVLRQAGTATALATTASWWLVCRAHAARDKKLTVWVPT |
| Ga0066692_103656502 | 3300005555 | Soil | MPTRREILKQAGKTATVLTTTAPWWLVRRAHAARQAKLV |
| Ga0066670_104950922 | 3300005560 | Soil | MPTRREILKTAGKTATVLTTTAPWWLVRRAHAARQAKLVVWNPA |
| Ga0066708_107581461 | 3300005576 | Soil | MPTRREILKTAGKTATVLTTTAPWWLVRRAHAARQAKLVVWNPAALAPQ |
| Ga0066905_1009139211 | 3300005713 | Tropical Forest Soil | MPTRRDILKTAGKSATVLTTTAPWWRVRRAHAARQAKLVVWNPAALAPQVDK |
| Ga0066905_1016877681 | 3300005713 | Tropical Forest Soil | MWTRRKVLRQAGPAVVLATAVPWWLVRRAHAARQTKLVVWN |
| Ga0066903_1013390502 | 3300005764 | Tropical Forest Soil | MWTRRKILRQAGPAVVLATTAPWWLVRRAHAARQTKLVVWNTTAL |
| Ga0068870_104582693 | 3300005840 | Miscanthus Rhizosphere | MLTRRDVLRQSGRAVTIVATTAPWWLVRRAHAARQ |
| Ga0081455_106402681 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLTRRDILRQAGTTAAVLATTAPWWLVRRAHAARQHKLVVWNPAAL |
| Ga0081538_102702722 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MLTRRDVLKQAGVAAALATAPWWLVRRAHAARREKLVVWHGVALAP |
| Ga0066656_108656031 | 3300006034 | Soil | MLTRRAILQQAGKTATVLTAATPWWLVRRAHAARQAKLVVWNPA |
| Ga0075427_100295081 | 3300006194 | Populus Rhizosphere | MLTRRDILQQAGRTAVVLATTAPWWLVRRAHAARQHKLVVWNTTALAPQVDK |
| Ga0066659_108372052 | 3300006797 | Soil | MLTRRDVLQRAGTATALATTASWWLVRRAHAARDKKLV |
| Ga0075428_1002584851 | 3300006844 | Populus Rhizosphere | MLTRRDILQQAGRAATILATTAPWWLVRRAHAARQTKLAAWVPAALAPQ |
| Ga0075428_1010258961 | 3300006844 | Populus Rhizosphere | MLTRRSVLQRAGTATALATTASWWLVRRAHAARDKKLVVWVPTALAPQV |
| Ga0075421_1021524871 | 3300006845 | Populus Rhizosphere | MPTRREVLRQVGTMAVLGTTAPWWLVRRAHAARREKLIVW |
| Ga0075430_1014147082 | 3300006846 | Populus Rhizosphere | MLTRRDILQQAGRTAVVLATTAPWWLVRRAHAARQHKLVVWNTTALAPQVD |
| Ga0075420_1004967914 | 3300006853 | Populus Rhizosphere | MVTRRDVLQRAGAATALATTAAWWLVRRAHAARRAKLV |
| Ga0075420_1006074992 | 3300006853 | Populus Rhizosphere | MLTRRDALRQVGTAAALATMAPWWLVRRAHAQRAEKLIVWQPVAL |
| Ga0075420_1009652811 | 3300006853 | Populus Rhizosphere | MLTRRDILQQAGRTAAVLATTAPWWLVRRAHAARQQKL |
| Ga0075425_1011222251 | 3300006854 | Populus Rhizosphere | MLTRRDILQQAGRAATILATTAPWWLVRRAHAARQTKLAAWVPAALAPQV |
| Ga0075436_1011694841 | 3300006914 | Populus Rhizosphere | MLTRRDVLQRAGTATALATTASWWLVRRAHAARDKKLVVWVNTALAPQVD |
| Ga0075436_1013407172 | 3300006914 | Populus Rhizosphere | MPTTRREILKTAGKTAAVVTTTAPWWLSRHAHAARQTKLVVWNPAALAPQ |
| Ga0066710_1048257352 | 3300009012 | Grasslands Soil | MQTRRDVLRWAGTATTLATTASWWLVRRAHAARQAKLVVWNP |
| Ga0099829_116554471 | 3300009038 | Vadose Zone Soil | MLTRRDVLRRAGTATALATTASWWLVRRAHAARDKKLVVW |
| Ga0099828_113452122 | 3300009089 | Vadose Zone Soil | MLTRRTILERAGKTAAVLTTTAPWWLVRRAQAARQAKLVVWN |
| Ga0099828_115205742 | 3300009089 | Vadose Zone Soil | MLTRRDVLRRAGTATALATTASWWLVRRAHAARDKKLVVWVPTALAPQVD |
| Ga0075418_109071841 | 3300009100 | Populus Rhizosphere | MLTRRDILQQAGRTAVVLATTAPWWLVRRAHAARQHKLVVWN |
| Ga0075418_130311781 | 3300009100 | Populus Rhizosphere | MQTRREILKTAGKTAVLTTTAPWWLVRRAHAARAAKLVVWNP |
| Ga0066709_1033932292 | 3300009137 | Grasslands Soil | MLTRRDILQQAGRTAAVLATTAPWWLVRGAHAARQNKLV |
| Ga0111538_111232282 | 3300009156 | Populus Rhizosphere | MLTRRDILQQAGRTAVVLATTAPWWLVRRAHAARDTK |
| Ga0111538_137715962 | 3300009156 | Populus Rhizosphere | MLTRRDMLRQAGRTAAVLATAAPWWLVRRAHAARDK |
| Ga0105104_106505941 | 3300009168 | Freshwater Sediment | MLTRRDVLKQAGVMAAVATTTPWWLVRRAHAARREKLIV |
| Ga0105249_125767452 | 3300009553 | Switchgrass Rhizosphere | MPTTRREILKTVGKTAAVVTTTAPWWLSRRAHAARQAKLVVWN |
| Ga0114944_10041531 | 3300009691 | Thermal Springs | MIRQAGMAAVLATTAPWWLVRRAHAARDKKLIVWNSASLAPQVDKIM |
| Ga0105076_10331922 | 3300009816 | Groundwater Sand | MLTRREVLLATGKTATVLTTTAPWWLVRRAHAARQAKLVVWNPAALAPQV |
| Ga0105062_10753171 | 3300009817 | Groundwater Sand | MLTRREILQQTGKTAAVLTATAPWWLVRRAHAARSAK |
| Ga0105085_11221351 | 3300009820 | Groundwater Sand | MLTRRNILRQAGTVAVLATTAPWWLVRRAHVARDKKLIVWSGATLA |
| Ga0126380_111159782 | 3300010043 | Tropical Forest Soil | MMLTRREVLKQAGTMAALATMAPWWVCRRAHAARRE |
| Ga0126321_11724281 | 3300010145 | Soil | MLTRRDILRQTGTATALAMTASWWLVRQAHAARDKKL |
| Ga0126321_12602152 | 3300010145 | Soil | MLTRRDILQWTGRTAVVLATTAPWWLVRRAHAARDKKLTVWNPA |
| Ga0134086_104070951 | 3300010323 | Grasslands Soil | MPTRREILKTAGTVTLVSTTAPWWLVRRAHAARAAKLVVW |
| Ga0134062_107837991 | 3300010337 | Grasslands Soil | MPTRREILKTAGKTATVLTTTAPWWLVRRAHAARQAKLVVWNPAALA |
| Ga0126378_111914592 | 3300010361 | Tropical Forest Soil | MLTRRDVLCRAGTATALATTASWWLVRQAHAARDKK |
| Ga0126377_107864222 | 3300010362 | Tropical Forest Soil | MLSRRDLLQQLGVAALATTAPWWLVRRAHAARREKLIVWN |
| Ga0126377_110694441 | 3300010362 | Tropical Forest Soil | MLTRRDILQQAGRTAAILATTAPWWLVRGAHAARQ |
| Ga0126383_112909771 | 3300010398 | Tropical Forest Soil | MQTRREILKAAAATAVVNTTAPWWLVRSAHAARAAKLVVWNPAALAP |
| Ga0134127_110107312 | 3300010399 | Terrestrial Soil | MLTRRDVLRQSGRAVTIVATTAPWWLVRRAHAARQNKLIVWNPAA |
| Ga0134122_111559692 | 3300010400 | Terrestrial Soil | MPTTRREMLKTAGKSAAVVTTTAPWWLSRRAHAARQ |
| Ga0127502_103656132 | 3300011333 | Soil | MWTRRDMLRQTGAAAVLATTTPWWMIRRAHGARQHKLVVWNPAALAPQVD |
| Ga0137389_110207042 | 3300012096 | Vadose Zone Soil | MLTRRDILQQAVRTAAVLATTAPWWLVRRAHAARQHKLVVWNLTAL |
| Ga0137388_108496792 | 3300012189 | Vadose Zone Soil | MLTRRDILQQAVRTAAILATTAPWWLVRRAHAARQ |
| Ga0137383_107101181 | 3300012199 | Vadose Zone Soil | MPTTRREILQRAGKTATVLTATAPWWLVRRAHAARQAKLVVWN |
| Ga0137399_106016661 | 3300012203 | Vadose Zone Soil | MPTTRREILQRAGKTATVLTATTPWWLVRRAHAARQAKLVVWNPAALAPQV |
| Ga0137447_10658722 | 3300012226 | Soil | MLTRRDILQQAGKTATVLTTTAPWWLVRRAHAARKAKLVVWNPAALAPQVDKI |
| Ga0137386_107584891 | 3300012351 | Vadose Zone Soil | MRTRREILKTAGTTAAILTTTAPWWLVRRAHAARQAKLVVWNPAE |
| Ga0137367_100768214 | 3300012353 | Vadose Zone Soil | MLTRREILQAAARTATVLTTTAPWWLVRRAHAARAAKLVVW |
| Ga0137367_101261153 | 3300012353 | Vadose Zone Soil | MLTRRNILQQAGRTAAVLATTAPWWLVRRAHAARQA |
| Ga0137371_101987131 | 3300012356 | Vadose Zone Soil | MLTRRDALRQAGMVAALATTAPWWVVRRAHAARREKLI |
| Ga0137385_111406352 | 3300012359 | Vadose Zone Soil | MLTRRDILQQAGRAATILATTAPWWLVCRAHAARQNKLVVWNQA |
| Ga0137390_114823982 | 3300012363 | Vadose Zone Soil | MLTRREILQHGGRAATVLATTAPWWLVRRAHAARQAKLV |
| Ga0150984_1097767022 | 3300012469 | Avena Fatua Rhizosphere | MLTRRDVLRQAGTMAALATTAPWWLVRRAHAARSEKLVVWS |
| Ga0137358_107487541 | 3300012582 | Vadose Zone Soil | MPTRREILKQAGKTAALTTAAPWWLVRRAHAARQAK |
| Ga0137397_108270732 | 3300012685 | Vadose Zone Soil | MPTRREILKTAGTVTLVSTTAPWWLVRRAHAARAAKLVVWN |
| Ga0137410_114761221 | 3300012944 | Vadose Zone Soil | MLTRRDVLQRTGTATALATTASWWLVRRAHAARQNKLVV |
| Ga0126369_103160191 | 3300012971 | Tropical Forest Soil | MLTRRDVLQRAGTATALATTASWWLVRRAHAARDKKLVA |
| Ga0163162_116121122 | 3300013306 | Switchgrass Rhizosphere | MLTRRDILQRAGTATALATTASWWLVRRAHAARDKKLTVWNPADLAPQV |
| Ga0137418_105981381 | 3300015241 | Vadose Zone Soil | MLTRRDVLRRAGTATALATTASWWLVRRAHAARDKKL |
| Ga0132256_1026126461 | 3300015372 | Arabidopsis Rhizosphere | MLTRRDLLRQTGTATALATTASWWLVRRAHAARDKKLVVWVPTALVPQ |
| Ga0132255_1013238801 | 3300015374 | Arabidopsis Rhizosphere | MPTRREILKQAGTTAALSATAPWWLVRRAHAARQAKLV |
| Ga0182033_111869612 | 3300016319 | Soil | MLTRRDILQQAGSTAVVLATTAPWWLVRRAHAARQHKL |
| Ga0134112_100593743 | 3300017656 | Grasslands Soil | MPTTRREILQQAGKTATVLTATVPWWLVRRAHAARQ |
| Ga0190265_111470091 | 3300018422 | Soil | MPTRRDVLKQAGMVAALATTAPWWLVRRAHAARREKLIVWNQIAQAPVVD |
| Ga0190270_107209271 | 3300018469 | Soil | VLTRRGVLKQTGMVAALATTAPWWLVRQAHAARREKLIVWS |
| Ga0190270_110868122 | 3300018469 | Soil | MPTRREVLKQAGMAAVLATTAPWWLVRRAHAARREKLIV |
| Ga0190270_131867822 | 3300018469 | Soil | MLTRRDVLQQVGMAAAVAATAPWWLVRRAHAARREKL |
| Ga0180114_10097352 | 3300019232 | Groundwater Sediment | MLTRRDILQQTGRAATILATTAPWWLVRRAHAARQHKLVVWNP |
| Ga0180112_12915141 | 3300019238 | Groundwater Sediment | MLTRRDILQQTGRAAAILATTAPWWLVRHAHAARQHKLV |
| Ga0180111_13259222 | 3300019244 | Groundwater Sediment | MLTRREMLQQARRAAVLATTAPWWLVRRAHAARQNKLTVWNPAAL |
| Ga0184648_12548941 | 3300019249 | Groundwater Sediment | MLTRRDMLRQARMAAVLATTAPWWLVRRAHAARQNKLTVW |
| Ga0180115_12170811 | 3300019257 | Groundwater Sediment | MLTRRNILQHAGRTATVLVTTAPWWLVRRAHAARQQKLVVWSTTAL |
| Ga0184646_12528882 | 3300019259 | Groundwater Sediment | MLTTRRDILRQAGTAAAVLATTAPWWLVRRAHAARQKKLVVWN |
| Ga0184646_14744292 | 3300019259 | Groundwater Sediment | MLTRRDILQQAGRAATILATTAPWWLVRRAHAVRDKKLTVWN |
| Ga0184642_13599221 | 3300019279 | Groundwater Sediment | MLTRRDVLRRAGTATALATTAAWWLVRRAHAARRAKLV |
| Ga0187892_101505841 | 3300019458 | Bio-Ooze | MPTRRDILKTAGTATAVLTTTTAPWWLVRRAHAARQKKLGVFVEVSGCFH |
| Ga0180118_11078371 | 3300020063 | Groundwater Sediment | MLTRRNILQHAGRTATVLVTTAPWWLVRRAHAARQQKLVVWSTT |
| Ga0180113_13944081 | 3300020065 | Groundwater Sediment | MLTRRDVIHRAGTATALTTTAAWWLVRRAHAARQAKLVVWNPA |
| Ga0180113_14394732 | 3300020065 | Groundwater Sediment | MLTRRDVLQQVGRTAVVMATTAPWWLVRRAHAARQHKLVVWN |
| Ga0206350_108444042 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTRRDVLRQAGTATALATTASWWLVCRAHAARDKKLTVWVPTALAPQVD |
| Ga0194110_105422612 | 3300020084 | Freshwater Lake | MFTRRTMLGRAGMAAALATTAPWWLARKAHAARAHKLVVWNPAA |
| Ga0210378_102440471 | 3300021073 | Groundwater Sediment | MLTRRNIMRQVGTAAALATTAPWWLVRRAHAARDKKL |
| Ga0210370_11915131 | 3300021314 | Estuarine | MQTRRTLLQQAGSAALLATTSPWWMVPRSAHAARDKKLVVWHLAAL |
| Ga0222625_11931622 | 3300022195 | Groundwater Sediment | MLTRREVLKQAGAAALATTAPWWLVRRAHAARREKLIVWMPVALAPQ |
| Ga0209399_101793871 | 3300025157 | Thermal Springs | MLTRRAMLRQARMAAFLATTSPWWLVRRAHAARDKKLVVWHGSALA |
| Ga0207712_112317862 | 3300025961 | Switchgrass Rhizosphere | MQTRREILKTAGKTAVLTTTAPWWLVRRAHAARAAK |
| Ga0209801_12401982 | 3300026326 | Soil | MPTRREILKTAGKTATVLTTTAPWWLVRRAHAARQAKLVVWNPAALAPQV |
| Ga0209802_12333422 | 3300026328 | Soil | MRTRREILKTAGKTAAILTTTAPWWLVRRAHAARQAKLVVWNPAALAPQVDK |
| Ga0209158_11745752 | 3300026333 | Soil | MRTRREILKTAGKTAAILTTTAPWWLVRRAHAARQAKLVVWNPAAL |
| Ga0209058_10095201 | 3300026536 | Soil | MPTTRREILQQAGKTATVLTATVPWWLVRRAHAARQAKLVV |
| Ga0209874_11333382 | 3300027577 | Groundwater Sand | MLTRRNILRQAGTAAALATTAPWWLVRRAHAARDKKLTVWSGASLAPQ |
| Ga0209466_10930611 | 3300027646 | Tropical Forest Soil | MQTRREILKAAGATAVVSTTAPWWLVRRAHAARAAKLVV |
| Ga0209799_10718741 | 3300027654 | Tropical Forest Soil | MWTRRKVLRQAGPAVVLATAVPWWLVRRAHAARQTKLVV |
| Ga0209590_106614751 | 3300027882 | Vadose Zone Soil | MLTRRDILQQAGRTAAVLATTAPWWLVRRAHAARQ |
| Ga0209488_106765252 | 3300027903 | Vadose Zone Soil | MRTRREMMRQAGTAAVLATTSPWWLVRRAHAARQAKLVVWVPTA |
| Ga0209382_120728422 | 3300027909 | Populus Rhizosphere | MLTRRDVLQRAGTATALATTASWWLVRRAHAARDKKL |
| Ga0268264_124871542 | 3300028381 | Switchgrass Rhizosphere | MLTRRDVLRRAGTATALATTASWWLVRRAHAARRAKLVVWNTAAL |
| Ga0247828_101690972 | 3300028587 | Soil | MLTRRDVLQRAGTATALATTASWWLVRRAHAVRDKKLTVWN |
| Ga0257175_10213171 | 3300028673 | Soil | MSTRREILKQAGMTATVLTTTAPWWLVRRAHAARQAKLVVWNP |
| Ga0307278_101803271 | 3300028878 | Soil | MLTRRAILQQAGKTATVLTTTTPWWLVRRAHAARQAKL |
| Ga0247612_10010173 | 3300030592 | Soil | MLTTRRDILRQAGTAAVILASTAPWWLVRRAHAARQKKLVVWNGASLAPQVD |
| Ga0247636_103670991 | 3300030634 | Soil | MLTRRDVLKQAGVAAAPATTAPWWLVRRVHAARSEKLIVWMPV |
| Ga0308206_10034293 | 3300030903 | Soil | MLTRRDVLRQVGTVAMVATTAPWWLMRRAHAARDAKLT |
| Ga0308206_10875042 | 3300030903 | Soil | MLRRRDVLQRAGTATTLATTATWWLVRRAHAARQLKLVAWVPTALAPQVD |
| Ga0308206_11028762 | 3300030903 | Soil | MLTRRNILQQAGTTAAVLATTVPWWLVRRAHAARDKK |
| Ga0308190_10588702 | 3300030993 | Soil | MLTRRDVLRQVGTVAMVATTAPWWLMRRAHAARDAKLTVWSPVALAPQVD |
| Ga0308204_100343452 | 3300031092 | Soil | MLTRRDILQQAGKTAAVLATTAPWWLVRRTHAARQN |
| Ga0308199_11367782 | 3300031094 | Soil | MLTRRDMLRQAGRAATILATTAPWWLVRRAHAVRDKKLTVWN |
| Ga0308199_11461632 | 3300031094 | Soil | MLTRRDILQQAGRTGAVLATTAPWWLVRRAHAARQNKLVVWN |
| Ga0308191_10020813 | 3300031098 | Soil | MLTRRDMLQQAGRAATILATIAPWWLVRRAHAARQAKLTV |
| Ga0308187_101430201 | 3300031114 | Soil | VKVMLSRRDVLKQTGTLAALATTAPWWLVRRAHAA |
| Ga0308187_102905532 | 3300031114 | Soil | MLTRRDVLKQAGTLAALATTAPWWLVRRAHAARRE |
| (restricted) Ga0255311_10593432 | 3300031150 | Sandy Soil | MLTRRTVLERAAKTAAVVATTAPWWLSRRAHAARQHKLVVW |
| Ga0310887_100404311 | 3300031547 | Soil | MPTTRREILKTAGKTAAVVTTTAPWWLSRRAHAARQAKL |
| Ga0318528_100116341 | 3300031561 | Soil | MPTTRREMLKTAGKTAAVVTTAAPWWLSRRAHAARQAKLV |
| Ga0306918_115282231 | 3300031744 | Soil | MLTRRDILQQAGRTAVVLATTAPWWLVRRAHAARDKKLVVW |
| Ga0318502_103320482 | 3300031747 | Soil | MPTTRREMLKTAGKTAAVVTTAAPWWLSRRAHAARQA |
| Ga0307473_101457251 | 3300031820 | Hardwood Forest Soil | MLTRRDILQQAGKAATVLTTTAPWWLSRREHAARQAKLVVWNPAALAPQV |
| Ga0310909_111673141 | 3300031947 | Soil | MPMRTRREMMQQAGTAAVLATTSPWWLVRRAHAARQAKLV |
| Ga0310906_105897802 | 3300032013 | Soil | MLTRRDMLQQAGRTAVVLATTAPWWLVRRAHAARDKKLV |
| Ga0307471_1014055902 | 3300032180 | Hardwood Forest Soil | MPTRREILKTAGKTAAVLTTTAPWWLSRKAHAARAAKLVVW |
| Ga0307471_1015450772 | 3300032180 | Hardwood Forest Soil | MLTRRTVLTQAGKAAAVVTATAPWWLSRRAHAARQHKL |
| Ga0307471_1016381081 | 3300032180 | Hardwood Forest Soil | MPTRREILKTAGKTAAVLTTTAPWWLSRKAHAARAAKLVVWNPAA |
| Ga0307471_1029377981 | 3300032180 | Hardwood Forest Soil | MLTRRAILKQAGKTAAVVTATAPWWLSRKAHAARQHKLV |
| Ga0364945_0151577_550_696 | 3300034115 | Sediment | MLTRREILKATGKTAAVLTTTTAPWWLVRRAHAARQAKLVVWNPAALAP |
| Ga0364940_0097665_685_825 | 3300034164 | Sediment | MLTRREILQATGKTATVLTTTAPWWLVRRAHAARQAKLVVWNPAALA |
| Ga0314780_213558_3_128 | 3300034659 | Soil | MWTRRDMLRQTGAAAVLATTTPWWMTRRAHGARQHKLVVWNP |
| Ga0314782_149285_421_570 | 3300034661 | Soil | MLTRRDILQQTGRAAVIMATTAPWWLVRHAHAARQNKLVVWNPTALAPQV |
| Ga0314784_081175_1_114 | 3300034663 | Soil | MLRRRDVLRQAGTATALATTASWWLVRQAHAARDKKLV |
| Ga0314794_115498_469_588 | 3300034669 | Soil | MLTRRDILRQTGSAAALMATTAPWWLVRHAHAARQNKLVV |
| Ga0314797_060698_2_121 | 3300034672 | Soil | MLTRRDVLRQAGTATALATAASWWLVRRAHAARDKKLVVW |
| Ga0314799_046553_379_522 | 3300034674 | Soil | MLTRRDVLRQAGTATALTTTASWWLVRRAHAARDKKLTVWVPTALAPQ |
| ⦗Top⦘ |