Basic Information | |
---|---|
Family ID | F044557 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 154 |
Average Sequence Length | 46 residues |
Representative Sequence | GRPAKGMPSWCALGMEMPTIEKIYSYVKGRSDAKIGPGRPAVKPGT |
Number of Associated Samples | 127 |
Number of Associated Scaffolds | 154 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.95 % |
% of genes near scaffold ends (potentially truncated) | 97.40 % |
% of genes from short scaffolds (< 2000 bps) | 91.56 % |
Associated GOLD sequencing projects | 124 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.455 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.182 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.416 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.714 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.68% β-sheet: 2.70% Coil/Unstructured: 71.62% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 154 Family Scaffolds |
---|---|---|
PF00805 | Pentapeptide | 29.22 |
PF13442 | Cytochrome_CBB3 | 15.58 |
PF09095 | AmyA-gluTrfs_C | 13.64 |
PF11684 | DUF3280 | 11.04 |
PF00999 | Na_H_Exchanger | 1.30 |
PF02353 | CMAS | 1.30 |
PF07366 | SnoaL | 1.30 |
PF13628 | DUF4142 | 0.65 |
PF09210 | BE_C | 0.65 |
PF13540 | RCC1_2 | 0.65 |
PF01370 | Epimerase | 0.65 |
PF13023 | HD_3 | 0.65 |
PF00350 | Dynamin_N | 0.65 |
PF01914 | MarC | 0.65 |
PF10282 | Lactonase | 0.65 |
PF09859 | Oxygenase-NA | 0.65 |
PF02897 | Peptidase_S9_N | 0.65 |
PF01028 | Topoisom_I | 0.65 |
PF13428 | TPR_14 | 0.65 |
PF00580 | UvrD-helicase | 0.65 |
PF04237 | YjbR | 0.65 |
PF14028 | Lant_dehydr_C | 0.65 |
PF03167 | UDG | 0.65 |
PF12680 | SnoaL_2 | 0.65 |
PF13847 | Methyltransf_31 | 0.65 |
PF00497 | SBP_bac_3 | 0.65 |
COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
---|---|---|---|
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 29.22 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 1.30 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 1.30 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 1.30 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 1.30 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 1.30 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.30 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 1.30 |
COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 1.30 |
COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 0.65 |
COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.65 |
COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.65 |
COG3569 | DNA topoisomerase IB | Replication, recombination and repair [L] | 0.65 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.65 |
COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.65 |
COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.65 |
COG1543 | Predicted glycosyl hydrolase, contains GH57 and DUF1957 domains | Carbohydrate transport and metabolism [G] | 0.65 |
COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.65 |
COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.65 |
COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.65 |
COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.45 % |
Unclassified | root | N/A | 4.55 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886012|MBSR1b_contig_6977885 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0678645 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_10744359 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 517 | Open in IMG/M |
3300003267|soilL1_10102973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3855 | Open in IMG/M |
3300003267|soilL1_10108310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2297 | Open in IMG/M |
3300003316|rootH1_10113003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1022 | Open in IMG/M |
3300003320|rootH2_10180548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1581 | Open in IMG/M |
3300003993|Ga0055468_10301822 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300003999|Ga0055469_10023248 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300004643|Ga0062591_101672477 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300004778|Ga0062383_10588204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
3300004803|Ga0058862_11786578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
3300005328|Ga0070676_10771190 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300005332|Ga0066388_104199612 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300005339|Ga0070660_100525244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 986 | Open in IMG/M |
3300005340|Ga0070689_101874205 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300005365|Ga0070688_101233233 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300005438|Ga0070701_10137534 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
3300005438|Ga0070701_10600647 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 729 | Open in IMG/M |
3300005458|Ga0070681_10967207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 771 | Open in IMG/M |
3300005518|Ga0070699_101464701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 626 | Open in IMG/M |
3300005518|Ga0070699_101651949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 587 | Open in IMG/M |
3300005518|Ga0070699_102196592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
3300005542|Ga0070732_10135752 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
3300005563|Ga0068855_101649939 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300005844|Ga0068862_100789202 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 927 | Open in IMG/M |
3300005881|Ga0075294_1009135 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300006237|Ga0097621_101672582 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 606 | Open in IMG/M |
3300006806|Ga0079220_10143054 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300006853|Ga0075420_100016757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6550 | Open in IMG/M |
3300006853|Ga0075420_100263460 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300006854|Ga0075425_100300609 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
3300007004|Ga0079218_13564801 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300009156|Ga0111538_13551195 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 541 | Open in IMG/M |
3300009157|Ga0105092_10708346 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 586 | Open in IMG/M |
3300009162|Ga0075423_11210808 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300009176|Ga0105242_11380576 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 731 | Open in IMG/M |
3300010037|Ga0126304_11191168 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 522 | Open in IMG/M |
3300010038|Ga0126315_10907230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 586 | Open in IMG/M |
3300010039|Ga0126309_10037243 | All Organisms → cellular organisms → Bacteria | 2257 | Open in IMG/M |
3300010040|Ga0126308_10309546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1040 | Open in IMG/M |
3300010145|Ga0126321_1449960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 956 | Open in IMG/M |
3300010166|Ga0126306_10530889 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 933 | Open in IMG/M |
3300010397|Ga0134124_11497170 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 703 | Open in IMG/M |
3300010399|Ga0134127_10980016 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 904 | Open in IMG/M |
3300010399|Ga0134127_11326609 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 789 | Open in IMG/M |
3300010401|Ga0134121_12900745 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 526 | Open in IMG/M |
3300010403|Ga0134123_11511339 | Not Available | 716 | Open in IMG/M |
3300011444|Ga0137463_1215135 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 719 | Open in IMG/M |
3300012212|Ga0150985_112596803 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 523 | Open in IMG/M |
3300012212|Ga0150985_114891037 | Not Available | 517 | Open in IMG/M |
3300012469|Ga0150984_116348348 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1337 | Open in IMG/M |
3300012533|Ga0138256_11061142 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 608 | Open in IMG/M |
3300012684|Ga0136614_10377780 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1039 | Open in IMG/M |
3300012930|Ga0137407_10229394 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
3300012930|Ga0137407_11028476 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300012958|Ga0164299_10241344 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1073 | Open in IMG/M |
3300012960|Ga0164301_10030150 | All Organisms → cellular organisms → Bacteria | 2572 | Open in IMG/M |
3300012987|Ga0164307_11493771 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 571 | Open in IMG/M |
3300012988|Ga0164306_10482288 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 950 | Open in IMG/M |
3300012989|Ga0164305_11330562 | Not Available | 629 | Open in IMG/M |
3300013307|Ga0157372_13047780 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 535 | Open in IMG/M |
3300013308|Ga0157375_12301465 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 642 | Open in IMG/M |
3300014267|Ga0075313_1146453 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 605 | Open in IMG/M |
3300014325|Ga0163163_12159930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 616 | Open in IMG/M |
3300014325|Ga0163163_13193026 | Not Available | 511 | Open in IMG/M |
3300014497|Ga0182008_10335761 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 798 | Open in IMG/M |
3300014497|Ga0182008_10336582 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300014968|Ga0157379_10381834 | Not Available | 1293 | Open in IMG/M |
3300017930|Ga0187825_10036215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1666 | Open in IMG/M |
3300017997|Ga0184610_1007131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2703 | Open in IMG/M |
3300017997|Ga0184610_1052329 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1210 | Open in IMG/M |
3300017997|Ga0184610_1241736 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300018027|Ga0184605_10087775 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1362 | Open in IMG/M |
3300018027|Ga0184605_10149718 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300018054|Ga0184621_10326635 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 540 | Open in IMG/M |
3300018066|Ga0184617_1060950 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 983 | Open in IMG/M |
3300018077|Ga0184633_10164158 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
3300018422|Ga0190265_10575598 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1244 | Open in IMG/M |
3300018422|Ga0190265_13007886 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 563 | Open in IMG/M |
3300018429|Ga0190272_10172609 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
3300018476|Ga0190274_12341992 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 631 | Open in IMG/M |
3300019279|Ga0184642_1344271 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 566 | Open in IMG/M |
3300019356|Ga0173481_10881110 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 503 | Open in IMG/M |
3300019377|Ga0190264_10358768 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300019377|Ga0190264_12061112 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 525 | Open in IMG/M |
3300019882|Ga0193713_1129750 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 689 | Open in IMG/M |
3300019888|Ga0193751_1111250 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1037 | Open in IMG/M |
3300020034|Ga0193753_10249937 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 788 | Open in IMG/M |
3300020059|Ga0193745_1098591 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 624 | Open in IMG/M |
3300020070|Ga0206356_10113479 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 512 | Open in IMG/M |
3300021078|Ga0210381_10411362 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 501 | Open in IMG/M |
3300021080|Ga0210382_10264579 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 754 | Open in IMG/M |
3300021090|Ga0210377_10008207 | All Organisms → cellular organisms → Bacteria | 8267 | Open in IMG/M |
3300022694|Ga0222623_10414201 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 512 | Open in IMG/M |
3300024430|Ga0196962_10128393 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 797 | Open in IMG/M |
3300025327|Ga0209751_10991218 | Not Available | 637 | Open in IMG/M |
3300025918|Ga0207662_10966483 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 604 | Open in IMG/M |
3300025920|Ga0207649_10871181 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 705 | Open in IMG/M |
3300025928|Ga0207700_10859036 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300025933|Ga0207706_10988787 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 707 | Open in IMG/M |
3300025945|Ga0207679_11734227 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 571 | Open in IMG/M |
3300025960|Ga0207651_10875262 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300025972|Ga0207668_10852888 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300025981|Ga0207640_10019309 | All Organisms → cellular organisms → Bacteria | 4025 | Open in IMG/M |
3300026041|Ga0207639_11899574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 556 | Open in IMG/M |
3300026088|Ga0207641_10716881 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 986 | Open in IMG/M |
3300026089|Ga0207648_10134537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2177 | Open in IMG/M |
3300026089|Ga0207648_11208065 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 710 | Open in IMG/M |
3300026118|Ga0207675_100003502 | All Organisms → cellular organisms → Bacteria | 15315 | Open in IMG/M |
3300027716|Ga0209682_10174758 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300027775|Ga0209177_10507931 | Not Available | 504 | Open in IMG/M |
3300027787|Ga0209074_10384723 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 584 | Open in IMG/M |
3300027843|Ga0209798_10489604 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 563 | Open in IMG/M |
3300028380|Ga0268265_11424611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 695 | Open in IMG/M |
3300028380|Ga0268265_12319145 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 543 | Open in IMG/M |
3300028791|Ga0307290_10369298 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 525 | Open in IMG/M |
3300028809|Ga0247824_10722934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 609 | Open in IMG/M |
3300028811|Ga0307292_10303878 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 669 | Open in IMG/M |
3300028811|Ga0307292_10392853 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 589 | Open in IMG/M |
3300028814|Ga0307302_10496692 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 606 | Open in IMG/M |
3300028828|Ga0307312_10637356 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300028878|Ga0307278_10200903 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300028880|Ga0307300_10178626 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 679 | Open in IMG/M |
3300030620|Ga0302046_10359246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1197 | Open in IMG/M |
3300030993|Ga0308190_1113362 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 608 | Open in IMG/M |
3300031058|Ga0308189_10250346 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 669 | Open in IMG/M |
3300031091|Ga0308201_10348096 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 542 | Open in IMG/M |
3300031094|Ga0308199_1125524 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 589 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10063312 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300031547|Ga0310887_10593845 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 678 | Open in IMG/M |
3300031852|Ga0307410_10068694 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
3300031901|Ga0307406_11913229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 529 | Open in IMG/M |
3300031903|Ga0307407_10278230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1158 | Open in IMG/M |
3300031903|Ga0307407_11352488 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 560 | Open in IMG/M |
3300031903|Ga0307407_11626649 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 513 | Open in IMG/M |
3300031938|Ga0308175_100625459 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300031995|Ga0307409_100007167 | All Organisms → cellular organisms → Bacteria | 6643 | Open in IMG/M |
3300031995|Ga0307409_100720620 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 999 | Open in IMG/M |
3300031995|Ga0307409_101884003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 627 | Open in IMG/M |
3300031996|Ga0308176_10537840 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
3300032002|Ga0307416_100290536 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1618 | Open in IMG/M |
3300032002|Ga0307416_102057010 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 673 | Open in IMG/M |
3300032002|Ga0307416_103400772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 532 | Open in IMG/M |
3300032004|Ga0307414_10529448 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1047 | Open in IMG/M |
3300032004|Ga0307414_11700390 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 588 | Open in IMG/M |
3300032005|Ga0307411_10985831 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300032013|Ga0310906_10606333 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300032013|Ga0310906_10620098 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300033004|Ga0335084_12286488 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300033233|Ga0334722_10062286 | All Organisms → cellular organisms → Bacteria | 2903 | Open in IMG/M |
3300033433|Ga0326726_10354338 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
3300033433|Ga0326726_11114986 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 767 | Open in IMG/M |
3300033501|Ga0326732_1073288 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 561 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.18% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 9.09% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.90% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.25% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.25% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.25% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.25% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.60% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.60% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.95% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.95% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.95% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.30% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.30% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.30% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.30% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.30% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 1.30% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.30% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.30% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.65% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.65% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.65% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.65% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.65% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.65% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.65% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.65% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.65% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.65% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.65% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.65% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.65% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.65% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003316 | Sugarcane root Sample L1 | Host-Associated | Open in IMG/M |
3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005881 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033501 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
MBSR1b_0437.00005220 | 2162886012 | Miscanthus Rhizosphere | CAGRPDKGMPSWCALGLEMEKIQKIYEYLKGRADGKIHIGRPAAKAESEPGKSSS |
ICChiseqgaiiDRAFT_06786453 | 3300000033 | Soil | CALGMDPAKINQIYAYVKGRSEGKIAPGRPAVRQGG* |
ICChiseqgaiiFebDRAFT_107443591 | 3300000363 | Soil | EKGMPAWCALGMDPGTIEKIYGYVKARSDAKMAPGRPARKEG* |
soilL1_101029734 | 3300003267 | Sugarcane Root And Bulk Soil | LFVQTVCAGRPTKGMPAWCALGLDMDKIQEIYAYVKGRSDAKIGPGRPAVKREG* |
soilL1_101083107 | 3300003267 | Sugarcane Root And Bulk Soil | KGMPSWCALGMEMPTIEAIYSYVKGRSDAKIHPGRPAVRSGG* |
rootH1_101130032 | 3300003316 | Sugarcane Root And Bulk Soil | FIQTVCAGRPAKGMPSWCALGMDPGTIEKIYAYVKGRSDAKIGPGRPAVKSGT* |
rootH2_101805482 | 3300003320 | Sugarcane Root And Bulk Soil | TKELFMQTVCAGRPAKGMPAWCALGLDMNKINDIYLYVKGRSDAKIGPGRPAVKEGT* |
Ga0055468_103018221 | 3300003993 | Natural And Restored Wetlands | KGMPAWCALGLDMQKISDIYLYVKGRSDAKISPGRPAVKSGG* |
Ga0055469_100232482 | 3300003999 | Natural And Restored Wetlands | CAGRPEKGMPAWCALGLDMQKISDIYLYVKGRSDAKISPGRPAVKSGG* |
Ga0062591_1016724772 | 3300004643 | Soil | GRPTKGMPSWCALGMDMDKIQSIYDYVKGRSDAKIGPGRPAVKPTG* |
Ga0062383_105882042 | 3300004778 | Wetland Sediment | VCAGRPDKGMPSWCALGLEMDKIQKIYSYLKGRSDGKIGLGRPAVRENS* |
Ga0058862_117865781 | 3300004803 | Host-Associated | TVCAGRPAKGMPSWCALGMEMPTIEAIYSYVKGRSDAKIHPGRPAVKAGG* |
Ga0070676_107711901 | 3300005328 | Miscanthus Rhizosphere | QGRKEKGMPSWCELGLEMDKIMGIYAYVKGRADGKIHEGRPAVRENS* |
Ga0066388_1041996121 | 3300005332 | Tropical Forest Soil | VCAGRPSKGMPSWCALGLEMEKIQNIYAYLKGRADGKIHIGRPAVKAGPEPGKSSS* |
Ga0070660_1005252442 | 3300005339 | Corn Rhizosphere | GRPAKGMPSWCALGMELPTIEKIYAYVKGRSDAKISPGRPAVKTGT* |
Ga0070689_1018742052 | 3300005340 | Switchgrass Rhizosphere | AGRPDKGMPSWCALGLEMEKIQRIYLYLKGRADGKIGIGRPALRENS* |
Ga0070688_1012332332 | 3300005365 | Switchgrass Rhizosphere | PAKGMPSWCSLGMEMSTIEAIYSYVKGRSDAKIHPGRPAVKSGG* |
Ga0070701_101375344 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VCGGRPAKGMPAWCTLGMSTAQIDTIYSYVKARSDAKMHPGRPARRGG* |
Ga0070701_106006472 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | FLQTVCGGRPAKGMPAWCTLGMSTAQIDTIYSYVKARSDAKMHPGRPARRGG* |
Ga0070681_109672072 | 3300005458 | Corn Rhizosphere | CAGRPARGMPSWCAIGMEMGTIDKIYAYVKGRSDAKLAPGRPALKPGT* |
Ga0070699_1014647011 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EKGMPAWCALGLDMSKINDIYQYVKGRSDAKIGPGRPAVKPQG* |
Ga0070699_1016519492 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PEKGMPSWCALGMELPTIDKIYSYVKARSDAKIAPGRPAVKRAG* |
Ga0070699_1021965921 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | TVCAGRPEKGMPSWCALGLDMSKINDIYEYVKGRSDARISPGRPAVKEQG* |
Ga0070732_101357523 | 3300005542 | Surface Soil | TVCGGRPEKGMPAWCTIGLTPGQIDTIYAYVKGRSDAKLHPGRPALRR* |
Ga0068855_1016499393 | 3300005563 | Corn Rhizosphere | LGLDMDKINDIYQYVKGRSDAKISPGRPAVKPQG* |
Ga0068862_1007892022 | 3300005844 | Switchgrass Rhizosphere | FITTVCAGRPDKGMPSWCALGLEMEKIQRIYLYLKGRADGKIGIGRPALRENS* |
Ga0075294_10091351 | 3300005881 | Rice Paddy Soil | ALGMEMGTIDEIYSYVKARSDAKMAPGRPAVKREG* |
Ga0097621_1016725822 | 3300006237 | Miscanthus Rhizosphere | AKGMPSWCALGMELPTIEKIYGYVKGRSDAKIGPGRPAVKTGT* |
Ga0079220_101430543 | 3300006806 | Agricultural Soil | SWCALGMEMSTIEAIYSYVKGRSDAKIHPGRPAVKAGG* |
Ga0075420_1000167579 | 3300006853 | Populus Rhizosphere | VCAGRPEKGMPAWCALGMQMPTIEAIYSYVKGRSEAKLHPGRPALRSGG* |
Ga0075420_1002634603 | 3300006853 | Populus Rhizosphere | TVCAGRPEKGMPAWCALGLEMDKIENIYKYVKGRADSKISAGRPAVKSEPEAASSQS* |
Ga0075425_1003006091 | 3300006854 | Populus Rhizosphere | CAGRPAKGMPAWCALGLGLDKINDIYLYVKGRSDAKISPGRPAVKKEG* |
Ga0079218_135648012 | 3300007004 | Agricultural Soil | QTVCAGRPEKGMPAWCALGMEMPTIEAIYAYVKGRTDSKIHPGRPALKAGG* |
Ga0111538_135511952 | 3300009156 | Populus Rhizosphere | SWCALGMDPAKINQIYAYVKGRSEGKIAPGRPAVRQGG* |
Ga0105092_107083461 | 3300009157 | Freshwater Sediment | AGRPEKGMPSWCALGMDPGTIEKIYGYVKARSDAKMAPGRPARKEG* |
Ga0075423_112108082 | 3300009162 | Populus Rhizosphere | GRPEKGMPSWCALVKEMGTIEKIYSYVKARSDAKMAPGRPAVKPAG* |
Ga0105242_113805762 | 3300009176 | Miscanthus Rhizosphere | ELFMQTVCAGRPTKGMPAWCALGLGMDKIDEIYQYVKGRSDAKISPGRPAVKSGG* |
Ga0126304_111911682 | 3300010037 | Serpentine Soil | WCALGMEMPTIEAIYSYVKGRSDAKIHPGRPAVRSGG* |
Ga0126315_109072302 | 3300010038 | Serpentine Soil | FIQTVCAGRPAKGMPSWCSLGMEMPTTEKIYNYVKGRSDAKIGPGRPAVKPGT* |
Ga0126309_100372431 | 3300010039 | Serpentine Soil | RSAKGMPSWCALGMELPTIQKIYAYVKGRSDAKIASGRPAVKPGT* |
Ga0126308_103095461 | 3300010040 | Serpentine Soil | GRPAKGMPSWCALGMEMPTIEKIYSYVKGRSDAKIGPGRPAVKPGT* |
Ga0126321_14499602 | 3300010145 | Soil | CAGRPAKGMPSWCALGMDVKTIEKIYSYVKARSDAKLAPGRPAVKPTG* |
Ga0126306_105308891 | 3300010166 | Serpentine Soil | KGTPSWCALGMEMPTIEAIYSYVKGRSDAKIHPGRPAVRSGG* |
Ga0134124_114971702 | 3300010397 | Terrestrial Soil | SWCALGMELPAIEKIYAYVKGRSDAKIGPGRPAVKTGT* |
Ga0134127_109800161 | 3300010399 | Terrestrial Soil | GRPEKGMPAWCQLGLEMGKIEAIYFYVKGRSEGKVHMGRPAVSQ* |
Ga0134127_113266092 | 3300010399 | Terrestrial Soil | PAWCALGLDMQKISDIYLYVKGRSDAKISPGRPAVKSGG* |
Ga0134121_129007451 | 3300010401 | Terrestrial Soil | GMPSWCALGLDMEKINSIYLYVKGRSDAKISPGRPAVKKEG* |
Ga0134123_115113392 | 3300010403 | Terrestrial Soil | CALGMEIPTIDKIYSYVKARSDAKMAPGRPAVKRPG* |
Ga0137463_12151351 | 3300011444 | Soil | AKGMPAWCALGLEMDKINDIYEYVKGRSDAKISPGRPAVKPER* |
Ga0150985_1125968031 | 3300012212 | Avena Fatua Rhizosphere | PPKGMPSWCALGMEIPTIEKIYSYVRGRSDAKIGPGRPAVKPGA* |
Ga0150985_1148910372 | 3300012212 | Avena Fatua Rhizosphere | MQTVCAGRPAKGMPAWCALGLDMQKISDIYLYVKGRSDAKISPGRPAVKGG* |
Ga0150984_1163483483 | 3300012469 | Avena Fatua Rhizosphere | AKGMPSWCALGMEMPTIEAIYSYVKGRSDAKIHPGRPAVKAGG* |
Ga0138256_110611421 | 3300012533 | Active Sludge | TVCAGRPDKGMPAWCALGLEIDKIQRMYLYVKGRADGKIGPGRPAVRENS* |
Ga0136614_103777801 | 3300012684 | Polar Desert Sand | FVQVVCAGRPDKGMPSWCALGMDPPTIEKLYAYVKARSDAKMSPGRPARRGG* |
Ga0137407_102293941 | 3300012930 | Vadose Zone Soil | CAGRPEKGMPSWCALGLDMSKINDIYEYVKGRSDAKISPGRPAVKEQG* |
Ga0137407_110284761 | 3300012930 | Vadose Zone Soil | MPSWCALGMELPTIDKIYSYVKARSDAKMAPGRPAVKREG* |
Ga0164299_102413442 | 3300012958 | Soil | CAGLPAKGMPSCCALGMELPTIEKIYAYVKGRSDSKIAAGRPAVKAGG* |
Ga0164301_100301503 | 3300012960 | Soil | AKGMPAWCALGLGMDKIGDIYLYVKGRSDAKIGPGRPAVKREG* |
Ga0164307_114937711 | 3300012987 | Soil | KELFMQTVCAGRPAKGMPAWCALGLGMDKIGDIYLYVKGRSDAKIGPGRPAVKREG* |
Ga0164306_104822882 | 3300012988 | Soil | SWCALGLDMDKINSIYLYVKGRSDAKISPGRPAVKKEG* |
Ga0164305_113305621 | 3300012989 | Soil | KGMPSWCALGMEMPTIEAIYSYVKGRSDAKIHPGRPAVKPGG* |
Ga0157372_130477801 | 3300013307 | Corn Rhizosphere | TVCAGRPTKGMPAWCALGLGLDKINDIYLYVKGRSDAKISPGRPAVKQQG* |
Ga0157375_123014651 | 3300013308 | Miscanthus Rhizosphere | TTVCAGRPDKGMPSWCALGLEMDKIQRIYMYLKGRADGKIGIGRPALRENS* |
Ga0075313_11464531 | 3300014267 | Natural And Restored Wetlands | GMPSWCALGMDPATIERIYSYVKARSDAKIAPGRPARKEG* |
Ga0163163_121599302 | 3300014325 | Switchgrass Rhizosphere | LGLGIDKINDIYLYVKGRSDAKISPGRPAVKKEG* |
Ga0163163_131930261 | 3300014325 | Switchgrass Rhizosphere | AWCALGMEIPTIEKIYSYVKARSDAKVAPGRPAVKREG* |
Ga0182008_103357611 | 3300014497 | Rhizosphere | AGRPAKGMPSWCALGMEMSTIEAIYSYVKGRSDAKIHPGRPAVKAGG* |
Ga0182008_103365821 | 3300014497 | Rhizosphere | LGLDMGKINDIYLYVKGRSDAKIAPGRPAVKSGG* |
Ga0157379_103818341 | 3300014968 | Switchgrass Rhizosphere | KGMPAWCKIGLSTAQIDTIYSYVKGRSDAKLHPGRPALR* |
Ga0187825_100362151 | 3300017930 | Freshwater Sediment | TVCGGRPEKGMPAWCTIGLTPGQIDTIYAYVKGRSDAKLHPGRPALRR |
Ga0184610_10071315 | 3300017997 | Groundwater Sediment | LFMQTVCAGRPEKGMPAWCPLGLEMGKIEAIYLYVKGRSEGKIHQGRPAVKQ |
Ga0184610_10523291 | 3300017997 | Groundwater Sediment | AGRPAKGMPSWCALGMDLPTIEKIYSYVKGRSDAKLAPGRPALKPGA |
Ga0184610_12417361 | 3300017997 | Groundwater Sediment | PSWCALGMELPTITKIYAYVKGRSEAKLSPGRPALKPGA |
Ga0184605_100877753 | 3300018027 | Groundwater Sediment | CALGLDMEKINQIYAYVKGRSDSKIHSGRPAVKAGG |
Ga0184605_101497181 | 3300018027 | Groundwater Sediment | GMPSWCALGMELPTIDKIYSYVKGRSDAKISPGRPAVKPGP |
Ga0184621_103266352 | 3300018054 | Groundwater Sediment | MQTVCAGRPEKGMPSWCALGMEITTIDKIYSYVKARSDAKMAPGRPAVKRQG |
Ga0184617_10609502 | 3300018066 | Groundwater Sediment | PAKGMPSWCALGMELPTIDKVYAYVKGRSDAKIGPGRPTVKPGG |
Ga0184633_101641581 | 3300018077 | Groundwater Sediment | PAKGMPSWCALGMEPATIDKIYAYVKGRSDAKLAPGRPALKPGT |
Ga0190265_105755983 | 3300018422 | Soil | EKGMPAWCPLGLDMNKIEAVYSYVKGRSEGTLHLGRPALRQ |
Ga0190265_130078861 | 3300018422 | Soil | QVVCAGRPEKGMPAWCSLGMDPGTIEKIYSYVKARSDAKMSPGRPARKAEG |
Ga0190272_101726093 | 3300018429 | Soil | CAGRPDKGMPSWCALGMEPATIDKIYAYVKGRSDAKLGQGRPALKPGT |
Ga0190274_123419921 | 3300018476 | Soil | VQTVCAGRPAKGMPAWCALGMEMDKIQAIYSYVKGRSDGKIRPGRPAVKAAG |
Ga0184642_13442711 | 3300019279 | Groundwater Sediment | CAGRPAKGMPAWCALGLDMEKINQIYSYVKGRSDSKIHPGRPAVKSGG |
Ga0173481_108811102 | 3300019356 | Soil | FIQTVCAGRPAKGMPSWCSLGMEMPTIEAIYSYVKGRSDAKIHPGRPAVKSGG |
Ga0190264_103587681 | 3300019377 | Soil | EKGMPSWCALGMEITTIDKIYSYVKARSDAKMAPGRPAVKRQG |
Ga0190264_120611121 | 3300019377 | Soil | VCSGRPEKGMPSWCALGMDPAKINQIYSYVKGRSEGKIHPGRPAVKPEG |
Ga0193713_11297502 | 3300019882 | Soil | TVCAGRPPKGMPSWCALGMELPTIEKIYLYVKGRSDAKIAPGRPAVKPGT |
Ga0193751_11112501 | 3300019888 | Soil | SWCALGMELPTIEKIYLYVKGRSDAKIAPGRPAVKPGA |
Ga0193753_102499371 | 3300020034 | Soil | APALTVCAGRPDKGMPSWCALGLEMDKIMNMYSYLKGRADGKIGIGRPAVKDNS |
Ga0193745_10985911 | 3300020059 | Soil | AKGMPSWCALGMELPTIDKIYSYVKARSDAKMAPGRPAVKREG |
Ga0206356_101134791 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | LFVQTVCAGRPAKGMPAWCALGMDIPTLDKIYSYVKGRSDAKIGPGRPALKPQG |
Ga0210381_104113622 | 3300021078 | Groundwater Sediment | PPKGMPSWCALGMELPTIDKIYAYVKGRSDAKIAPGRPAVKPGT |
Ga0210382_102645791 | 3300021080 | Groundwater Sediment | PAKGMPAWCALGLDMEKINQIYAYVKGRSDSKIHSGRPAVKAGG |
Ga0210377_100082071 | 3300021090 | Groundwater Sediment | AFVQVVCAGRPEKGMPSWCALGMDPAKINQIHAYVKGRSEGKIRPGRPAVKQGG |
Ga0222623_104142011 | 3300022694 | Groundwater Sediment | VCAGRPEKGMPSWCALGMEIPTIDKIYSYVKARSDAKMAPGRPAVKRQG |
Ga0196962_101283931 | 3300024430 | Soil | CALGMEPQTINQIYSYVKGRSDGKLGPGRPARREEG |
Ga0209751_109912181 | 3300025327 | Soil | CALGVEIPTIDKIYSYVKARSDAKMAPGRPAVKREG |
Ga0207662_109664832 | 3300025918 | Switchgrass Rhizosphere | TTVCAGRPDKGMPSWCALGLEMEKIQRIYLYLKGRADGKIGIGRPALRENS |
Ga0207649_108711812 | 3300025920 | Corn Rhizosphere | PAKGMPAWCALGLDMQKINDIYMYVKGRSDAKISPGRPAVKAGG |
Ga0207700_108590361 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ALGMDLPTINKIYSYVKARSDAKMAPGRPAVKREG |
Ga0207706_109887871 | 3300025933 | Corn Rhizosphere | VCAGRPAKGMPSWCSLCKEPPTIEKIYAYVKGRSDAKISPGRPAVKTGT |
Ga0207679_117342271 | 3300025945 | Corn Rhizosphere | AWCALGLDMQKISDIYLYVKGRSDAKISPGRPAVKSGG |
Ga0207651_108752622 | 3300025960 | Switchgrass Rhizosphere | QTVCAGRPDKGMPSWCALGLEMEKIQKIYEYLKGRADGKIHIGRPAAKAESEPGKSSS |
Ga0207668_108528882 | 3300025972 | Switchgrass Rhizosphere | TTVCQGRKEKGMPAWCELGLEMDKIMGIYAYVKGRADGKIHEGRPAVRENS |
Ga0207640_100193091 | 3300025981 | Corn Rhizosphere | AGRPDKGMPSWCALGLEMDKIQRIYMYLKGRADGKIGIGRPAVKENS |
Ga0207639_118995741 | 3300026041 | Corn Rhizosphere | GRPEKGMPSWCALGMEIPTIDKIYSYVKARSDAKMAPGRPAVKRPG |
Ga0207641_107168811 | 3300026088 | Switchgrass Rhizosphere | KGMPSWCALGMEIPTIEKIYSYVKGRSDAKIGPGRPAVKAGT |
Ga0207648_101345371 | 3300026089 | Miscanthus Rhizosphere | TVCAGRPAKGMPSWCALGMEMPTIEAIYSYVKGRSDAKIHPGRPAVKAGG |
Ga0207648_112080651 | 3300026089 | Miscanthus Rhizosphere | RPAKGMPSWCALGMELPTIEKIYAYVKGRSDAKISPGRPAVKTGT |
Ga0207675_10000350215 | 3300026118 | Switchgrass Rhizosphere | LQVVCGGRPDKGMPAWCTLGMSTAQIDTIYAYVKARSDAKMHPGRPARRGG |
Ga0209682_101747582 | 3300027716 | Wetland Sediment | CAGRLDKGMPAWCALGLEMDKIQWIYKYAKGRADGKYAAGRPAQRQ |
Ga0209177_105079311 | 3300027775 | Agricultural Soil | SWCALGMDMEKIQDIYQYVKGRSDAKLAPGRPAVKKEG |
Ga0209074_103847231 | 3300027787 | Agricultural Soil | PSWCALGLDMGKINDIYLYVKGRSDAKIAPGRPAVKSGG |
Ga0209798_104896041 | 3300027843 | Wetland Sediment | VCAGRPDKGMPSWCALGLEMDKIQKIYSYLKGRSDGKIGLGRPAVRENS |
Ga0268265_114246111 | 3300028380 | Switchgrass Rhizosphere | FITTVCAGRPDKGMPSWCALGLEMEKIQRIYLYLKGRADGKIGIGRPALRENS |
Ga0268265_123191452 | 3300028380 | Switchgrass Rhizosphere | MPSWCALGLGIDKINDIYLYVKGRSDAKISPGRPAVKKAG |
Ga0307290_103692982 | 3300028791 | Soil | PPKGMPSWCALGMELPTINKIYAYVKGRSDAKIGPGRPAVKPGT |
Ga0247824_107229341 | 3300028809 | Soil | VVCAGRPDKGMPAWCALGLEMDKIENIYKYVKGRADKKIGVGRPAVKAEPEPASKS |
Ga0307292_103038782 | 3300028811 | Soil | IQTVCAGRPAKGMPSWCALGMELPTIEKIYGYVKARSDAKMAPGRPAVKRAG |
Ga0307292_103928532 | 3300028811 | Soil | RPAKGMPAWCSLGLGMDKIQDIYSYVKGRSEGKIAPGRPAVREGT |
Ga0307302_104966922 | 3300028814 | Soil | SWCALGMELPTIDKVYAYVKGRSDAKIGPGRPAVKPGG |
Ga0307312_106373561 | 3300028828 | Soil | KGMPSWCALGMELPTIEKIYGYVKARSDAKMAPGRPAVKREG |
Ga0307278_102009031 | 3300028878 | Soil | VCAGRPAKGMPSWCALGMELPTIEKIYGYVKARSDAKLAPGRPAVKRES |
Ga0307300_101786261 | 3300028880 | Soil | PPKGMPSWCALGMELPTIEKIYLYVKGRSDAKIAPGRPAVKPGT |
Ga0302046_103592461 | 3300030620 | Soil | CAGRPEKGMPSWCALGMDPAKIGQIYSYVKGRSEGKIHPGRPAVKPEG |
Ga0308190_11133622 | 3300030993 | Soil | VQTVCAGRPAKGMPAWCALGLDMEKINQIYAYVKGRSDSKIHPGRPAVKAGG |
Ga0308189_102503462 | 3300031058 | Soil | ALGMEMPTIEAIYSYVKGRSDAKIHPGRPAVKSGG |
Ga0308201_103480961 | 3300031091 | Soil | TVCAGRPAKGMPAWCALGLDMEKINEIYAYVKGRSDSKIHLGRPAVKAGG |
Ga0308199_11255241 | 3300031094 | Soil | AKGMPAWCALGLDMEKINEIYAYVKGRSDSKIHLGRPAVKAGG |
(restricted) Ga0255310_100633123 | 3300031197 | Sandy Soil | ALGLEMDKINDIYEYVKGRSDAKIGPGRPAVKPQG |
Ga0310887_105938452 | 3300031547 | Soil | GRPAKGMPAWCALGLGMDKIGDIYLYVKGRSDAKIGPGRPAVKREG |
Ga0307410_100686944 | 3300031852 | Rhizosphere | CALGMEMPTIEKIYAYVKGRSDAKLGQGRPALKPGT |
Ga0307406_119132291 | 3300031901 | Rhizosphere | VCAGRPEKGMPSWCALGMEIPTIDKIYGYVKARSDAKLAPGRPAVKRQG |
Ga0307407_102782302 | 3300031903 | Rhizosphere | CALGMDPATIQKIYAYVKGRSDAKISPGRPALKSGG |
Ga0307407_113524882 | 3300031903 | Rhizosphere | TVCAGRPEKGMPAWCALGMEMPTIDKIYQYVKARSDAKMAPGRPAVKKES |
Ga0307407_116266492 | 3300031903 | Rhizosphere | AWCALGLGMDKINNIYEYVKGRSDAKISPGRPAVKQQG |
Ga0308175_1006254591 | 3300031938 | Soil | ELFVQTVCAGRPAKGMPAWCALGMDIPTIDKIYSYVKSRSDAKMGPGRPAVKREG |
Ga0307409_1000071678 | 3300031995 | Rhizosphere | VQTVCAGRPAKGMPSWCALGMEMPTIEKIYLYVKGRSEAKLGQGRPALKPGA |
Ga0307409_1007206204 | 3300031995 | Rhizosphere | TVCAGRPEKGMPSWCALGMEMPTIEAIYSYVKGRSDAKIHPGRPAVRSGG |
Ga0307409_1018840031 | 3300031995 | Rhizosphere | PAKGMPSWCALGMEMPTIEKIYLYVKGRSDAKLGQGRPALKPGA |
Ga0308176_105378402 | 3300031996 | Soil | QTVCAGRPAKGMPAWCALGMEIPTIDKIYSYVKSRSDAKMGPGRPAVKREG |
Ga0307416_1002905361 | 3300032002 | Rhizosphere | WCALGMEIPTIDKIYQYVHGRSEGKIGPGRPARKEG |
Ga0307416_1020570103 | 3300032002 | Rhizosphere | CALGLGMDKISNIYEYVKGRSDAKISPGRPAVKEQG |
Ga0307416_1034007722 | 3300032002 | Rhizosphere | SRPPKGMPSWCALGMQPATIEKIYSYVKARSDSKLSPGRPARREG |
Ga0307414_105294483 | 3300032004 | Rhizosphere | MPAWCPLGLEMDKIEAIHAYVKGRSDGKIRPGRPAVKSEG |
Ga0307414_117003901 | 3300032004 | Rhizosphere | QTVCAGRPAKGMPAWCPLGLEMDKIEAIHAYVKGRSDGKIRPGRPAVKSEG |
Ga0307411_109858312 | 3300032005 | Rhizosphere | TVCAGRPAKGMPSWCALGMEMPTIEKIYLYVKGRSDAKLGQGRPALKPGG |
Ga0310906_106063332 | 3300032013 | Soil | TVCAGRPEKGMPSWCSLGMEIPTIDKIYSYVKARSDAKMAPGRPAVKRQG |
Ga0310906_106200981 | 3300032013 | Soil | RPAKGMPSWCALGMEMPTIEKIYAYVKGRSEGKIGQGRPALKAGS |
Ga0335084_122864882 | 3300033004 | Soil | GRLDKGMPSWCALGLEMSKIEQIYKYVKGRADGKIAIGRPALRE |
Ga0334722_100622861 | 3300033233 | Sediment | PAWCALGMEMGTIENIYSYVKGRSDAKLAPGRPAVKREG |
Ga0326726_103543381 | 3300033433 | Peat Soil | TAELFLQTVCAGRLDKGMPAWCALGLEMGTIQEIYAYLQIRSTGKVGIGRPAERGE |
Ga0326726_111149862 | 3300033433 | Peat Soil | KGMPAWCKIGLSTAQIDTIYSYVKGRSDAKIHPGRPAVR |
Ga0326732_10732882 | 3300033501 | Peat Soil | TVCAGRPDKGMPSWCALGLEMDKIQRIYMYLKNRADGKIGIGRPAVRDNS |
⦗Top⦘ |