NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F044549

Metagenome Family F044549

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044549
Family Type Metagenome
Number of Sequences 154
Average Sequence Length 61 residues
Representative Sequence MAVQIQSRRSSTLNDRPFPIRLGAGELAVNNNAGSPGLFFADNTASPNTGLIKVGPV
Number of Associated Samples 117
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 15.79 %
% of genes near scaffold ends (potentially truncated) 96.10 %
% of genes from short scaffolds (< 2000 bps) 87.01 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.481 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(26.623 % of family members)
Environment Ontology (ENVO) Unclassified
(80.519 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(83.117 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 24.71%    Coil/Unstructured: 75.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 154 Family Scaffolds
PF12836HHH_3 1.30
PF00171Aldedh 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 154 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.65
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.65
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.43 %
UnclassifiedrootN/A28.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559017|JCVI_READ_844640All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium954Open in IMG/M
3300001951|GOS2249_1044991All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1598Open in IMG/M
3300001953|GOS2231_1028261All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1534Open in IMG/M
3300001961|GOS2240_1049002All Organisms → cellular organisms → Bacteria6398Open in IMG/M
3300001964|GOS2234_1064608All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1697Open in IMG/M
3300001969|GOS2233_1083056All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1618Open in IMG/M
3300002231|KVRMV2_100621740All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium823Open in IMG/M
3300002482|JGI25127J35165_1026346All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1360Open in IMG/M
3300002482|JGI25127J35165_1095134Not Available603Open in IMG/M
3300002483|JGI25132J35274_1008811All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2506Open in IMG/M
3300002483|JGI25132J35274_1059911All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium810Open in IMG/M
3300002483|JGI25132J35274_1072061Not Available722Open in IMG/M
3300002483|JGI25132J35274_1077370Not Available691Open in IMG/M
3300002483|JGI25132J35274_1129347Not Available502Open in IMG/M
3300002488|JGI25128J35275_1044194All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium987Open in IMG/M
3300002488|JGI25128J35275_1058267All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium824Open in IMG/M
3300002488|JGI25128J35275_1065265All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium766Open in IMG/M
3300002514|JGI25133J35611_10016121All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3083Open in IMG/M
3300002514|JGI25133J35611_10022133All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2494Open in IMG/M
3300002514|JGI25133J35611_10096755All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium877Open in IMG/M
3300002514|JGI25133J35611_10101964All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium844Open in IMG/M
3300005971|Ga0066370_10323109Not Available554Open in IMG/M
3300006305|Ga0068468_1105541All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1842Open in IMG/M
3300006334|Ga0099675_1034679All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1731Open in IMG/M
3300006413|Ga0099963_1078607All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium893Open in IMG/M
3300006480|Ga0100226_1032392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1727Open in IMG/M
3300006481|Ga0100229_1034883All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1189Open in IMG/M
3300006481|Ga0100229_1037565Not Available585Open in IMG/M
3300006565|Ga0100228_1054772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2136Open in IMG/M
3300006735|Ga0098038_1258491Not Available548Open in IMG/M
3300006737|Ga0098037_1147884All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium790Open in IMG/M
3300006754|Ga0098044_1003014All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium8559Open in IMG/M
3300006789|Ga0098054_1156323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium840Open in IMG/M
3300006928|Ga0098041_1077772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1071Open in IMG/M
3300006928|Ga0098041_1256384All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium557Open in IMG/M
3300007113|Ga0101666_1055686Not Available731Open in IMG/M
3300007346|Ga0070753_1030875All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2299Open in IMG/M
3300007541|Ga0099848_1312162All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium538Open in IMG/M
3300007542|Ga0099846_1014541All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3088Open in IMG/M
3300007542|Ga0099846_1327657All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium522Open in IMG/M
3300007544|Ga0102861_1034166All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1296Open in IMG/M
3300007639|Ga0102865_1219322Not Available567Open in IMG/M
3300008055|Ga0108970_11646160All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1379Open in IMG/M
3300009481|Ga0114932_10048132All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2749Open in IMG/M
3300009481|Ga0114932_10227741All Organisms → Viruses → Predicted Viral1129Open in IMG/M
3300009593|Ga0115011_10738231All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium809Open in IMG/M
3300009790|Ga0115012_11913419All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium523Open in IMG/M
3300009794|Ga0105189_1001731All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2130Open in IMG/M
3300010148|Ga0098043_1198541Not Available556Open in IMG/M
3300010149|Ga0098049_1215542All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium587Open in IMG/M
3300010151|Ga0098061_1320042Not Available531Open in IMG/M
3300010389|Ga0136549_10457835Not Available511Open in IMG/M
3300011013|Ga0114934_10307964Not Available713Open in IMG/M
3300012919|Ga0160422_10118281All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1572Open in IMG/M
3300012920|Ga0160423_10673568Not Available699Open in IMG/M
3300012920|Ga0160423_10909789Not Available590Open in IMG/M
3300012920|Ga0160423_11103420All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium530Open in IMG/M
3300012928|Ga0163110_10397798All Organisms → Viruses → Predicted Viral1031Open in IMG/M
3300012928|Ga0163110_10507514All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium920Open in IMG/M
3300012952|Ga0163180_10409847All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium993Open in IMG/M
3300012954|Ga0163111_10826753All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium884Open in IMG/M
3300013005|Ga0164292_10790495Not Available600Open in IMG/M
3300015050|Ga0181338_1003534All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2711Open in IMG/M
3300017697|Ga0180120_10319231Not Available619Open in IMG/M
3300017709|Ga0181387_1050853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium825Open in IMG/M
3300017709|Ga0181387_1058279All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium772Open in IMG/M
3300017709|Ga0181387_1095565Not Available607Open in IMG/M
3300017713|Ga0181391_1076267All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium769Open in IMG/M
3300017730|Ga0181417_1047562All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1050Open in IMG/M
3300017730|Ga0181417_1075167All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium820Open in IMG/M
3300017732|Ga0181415_1124290Not Available580Open in IMG/M
3300017734|Ga0187222_1105313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium637Open in IMG/M
3300017734|Ga0187222_1140959Not Available537Open in IMG/M
3300017740|Ga0181418_1164581All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium531Open in IMG/M
3300017744|Ga0181397_1111984Not Available713Open in IMG/M
3300017757|Ga0181420_1166415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium652Open in IMG/M
3300017758|Ga0181409_1231357All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium527Open in IMG/M
3300017760|Ga0181408_1095686All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium775Open in IMG/M
3300017760|Ga0181408_1121441All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium676Open in IMG/M
3300017764|Ga0181385_1216437Not Available577Open in IMG/M
3300017764|Ga0181385_1275485Not Available502Open in IMG/M
3300017765|Ga0181413_1131010All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium759Open in IMG/M
3300017768|Ga0187220_1070752All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1050Open in IMG/M
3300017771|Ga0181425_1036951All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1603Open in IMG/M
3300017773|Ga0181386_1192655Not Available615Open in IMG/M
3300017782|Ga0181380_1041191All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1673Open in IMG/M
3300017989|Ga0180432_10380117All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1054Open in IMG/M
3300018080|Ga0180433_10487154All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium940Open in IMG/M
3300020193|Ga0194131_10137875All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1230Open in IMG/M
3300020246|Ga0211707_1053177Not Available541Open in IMG/M
3300020267|Ga0211648_1058791All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium745Open in IMG/M
3300020311|Ga0211628_1003136All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3427Open in IMG/M
3300020386|Ga0211582_10321329Not Available578Open in IMG/M
3300020394|Ga0211497_10348934Not Available546Open in IMG/M
3300020401|Ga0211617_10237483All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium757Open in IMG/M
3300020409|Ga0211472_10430105Not Available531Open in IMG/M
3300020411|Ga0211587_10057865All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1752Open in IMG/M
3300020417|Ga0211528_10210188All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium745Open in IMG/M
3300020419|Ga0211512_10359232All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium658Open in IMG/M
3300020419|Ga0211512_10450751Not Available577Open in IMG/M
3300020421|Ga0211653_10273613All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium734Open in IMG/M
3300020436|Ga0211708_10166072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium881Open in IMG/M
3300020438|Ga0211576_10164315All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1196Open in IMG/M
3300020438|Ga0211576_10511867Not Available605Open in IMG/M
3300020442|Ga0211559_10477113Not Available572Open in IMG/M
3300020445|Ga0211564_10015333All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3798Open in IMG/M
3300020445|Ga0211564_10341366All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium737Open in IMG/M
3300020446|Ga0211574_10347188Not Available641Open in IMG/M
3300020450|Ga0211641_10581395Not Available528Open in IMG/M
3300020451|Ga0211473_10559521Not Available581Open in IMG/M
3300020451|Ga0211473_10637900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium537Open in IMG/M
3300020454|Ga0211548_10340149All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium733Open in IMG/M
3300020457|Ga0211643_10332902All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium745Open in IMG/M
3300020468|Ga0211475_10446627All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium624Open in IMG/M
3300020474|Ga0211547_10475981Not Available626Open in IMG/M
3300022074|Ga0224906_1042964All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1482Open in IMG/M
3300022187|Ga0196899_1182375Not Available565Open in IMG/M
3300022198|Ga0196905_1052311All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1161Open in IMG/M
3300024344|Ga0209992_10012321All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5132Open in IMG/M
3300024352|Ga0255142_1071488All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium524Open in IMG/M
3300025110|Ga0208158_1061107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium916Open in IMG/M
3300025127|Ga0209348_1014071All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3118Open in IMG/M
3300025127|Ga0209348_1053426All Organisms → Viruses → Predicted Viral1355Open in IMG/M
3300025127|Ga0209348_1218791Not Available522Open in IMG/M
3300025132|Ga0209232_1016302All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2968Open in IMG/M
3300025132|Ga0209232_1134358All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium804Open in IMG/M
3300025151|Ga0209645_1021475All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2451Open in IMG/M
3300025151|Ga0209645_1217167Not Available553Open in IMG/M
3300025151|Ga0209645_1237875Not Available516Open in IMG/M
3300025646|Ga0208161_1066449All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1088Open in IMG/M
3300025655|Ga0208795_1030306All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1710Open in IMG/M
3300025655|Ga0208795_1142150All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium607Open in IMG/M
3300025687|Ga0208019_1059327All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1290Open in IMG/M
3300025889|Ga0208644_1258281Not Available716Open in IMG/M
3300026292|Ga0208277_1261381All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium517Open in IMG/M
3300027709|Ga0209228_1107557All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium858Open in IMG/M
3300027830|Ga0209359_10389966All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium643Open in IMG/M
3300029302|Ga0135227_1051876Not Available504Open in IMG/M
3300029787|Ga0183757_1028959All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1190Open in IMG/M
3300029792|Ga0183826_1014653All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1283Open in IMG/M
3300031539|Ga0307380_10217095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1833Open in IMG/M
3300031565|Ga0307379_10195061All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2078Open in IMG/M
3300031565|Ga0307379_10668669All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium938Open in IMG/M
3300031669|Ga0307375_10692660All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium588Open in IMG/M
3300031773|Ga0315332_10541106Not Available730Open in IMG/M
3300031774|Ga0315331_10224016All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1395Open in IMG/M
3300031774|Ga0315331_10658128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium744Open in IMG/M
3300032011|Ga0315316_10659476All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium871Open in IMG/M
3300032032|Ga0315327_10618295All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium667Open in IMG/M
3300032073|Ga0315315_10695660All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium932Open in IMG/M
3300032820|Ga0310342_100540215All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1309Open in IMG/M
3300034101|Ga0335027_0360866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium957Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine26.62%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine18.18%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater14.94%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.79%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine4.55%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater3.90%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.90%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface2.60%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil2.60%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.95%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.30%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.30%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment1.30%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.65%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.65%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.65%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.65%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic0.65%
Environmental And Host-AssociatedEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated0.65%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.65%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.65%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.65%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.65%
Volcanic Co2 Seep SeawaterEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater0.65%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.65%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559017Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean5 (GOS 4441573)EnvironmentalOpen in IMG/M
3300001951Marine microbial communities from North Seamore Island, Equador - GS034EnvironmentalOpen in IMG/M
3300001953Marine microbial communities from Key West, Florida, USA - GS015EnvironmentalOpen in IMG/M
3300001961Marine microbial communities from Dirty Rock, Cocos Island, Costa Rica - GS025EnvironmentalOpen in IMG/M
3300001964Marine microbial communities from Rosario Bank, Honduras - GS018EnvironmentalOpen in IMG/M
3300001969Marine microbial communities from Yucatan Channel, Mexico - GS017EnvironmentalOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300005971Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_AEnvironmentalOpen in IMG/M
3300006305Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025mEnvironmentalOpen in IMG/M
3300006334Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025mEnvironmentalOpen in IMG/M
3300006413Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025mEnvironmentalOpen in IMG/M
3300006480Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0075mEnvironmentalOpen in IMG/M
3300006481Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0025mEnvironmentalOpen in IMG/M
3300006565Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125mEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300007113Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-isEnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007639Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02EnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300009794Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017989Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaGEnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020246Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105)EnvironmentalOpen in IMG/M
3300020267Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556026-ERR599108)EnvironmentalOpen in IMG/M
3300020311Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX556071-ERR599171)EnvironmentalOpen in IMG/M
3300020386Marine microbial communities from Tara Oceans - TARA_B100000609 (ERX555990-ERR599038)EnvironmentalOpen in IMG/M
3300020394Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026)EnvironmentalOpen in IMG/M
3300020401Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139)EnvironmentalOpen in IMG/M
3300020409Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106)EnvironmentalOpen in IMG/M
3300020411Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130)EnvironmentalOpen in IMG/M
3300020417Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082)EnvironmentalOpen in IMG/M
3300020419Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020445Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087)EnvironmentalOpen in IMG/M
3300020446Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989)EnvironmentalOpen in IMG/M
3300020450Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020454Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170)EnvironmentalOpen in IMG/M
3300020457Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)EnvironmentalOpen in IMG/M
3300020468Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993)EnvironmentalOpen in IMG/M
3300020474Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024352Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026292Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes)EnvironmentalOpen in IMG/M
3300027709Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_150m (SPAdes)EnvironmentalOpen in IMG/M
3300027830Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300029302Marine harbor viral communities from the Indian Ocean - SRB3EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300029792Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031773Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032032Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ocean5-_026097602166559017Environmental And Host-AssociatedMAVQIQTRRSSTLNDRPFPTRLGEGELALNNHSTSPGLFFADNVALQAYR
GOS2249_104499113300001951MarineMAVQILSRRSSVLHDRPFPIRLGSAELAVNNNAGDPGLFFADNTASPST
GOS2231_102826123300001953MarineMAVQIQSRRSSTAHDRPFPIRLGAGELAVNNNNVSPGLFFADILHLQVQV*
GOS2240_104900213300001961MarineMTIQIQSRRSSLLNDRPVPTRISAGELCVNINSGDPGLFFADNVASPSTGLIKVGPIHVGSTQPNNAPTGFTSFSKGE
GOS2234_106460813300001964MarineMAVQIQTRRSSTVNDRPFPTRLGAGELALNNNSTSPGLFFADNVAS
GOS2233_108305633300001969MarineMAVQIQSRRSSTAHDRPFPIRLGAGELAVNNNSVSPGLFFADNTASPNTGLIKVGPVHIGSNAPNN
KVRMV2_10062174023300002231Marine SedimentMTIQIQSRRSSLLNDRPVPTRIGAGELCVNINSGDPGLFFADNVASPSTGLIKVGPIHVGSTQPN
JGI25127J35165_102634623300002482MarineMTIQIQTRRSSLXNDRPVPTRIGAGELCVNINSGDPGLFFADNVASPSTGLIKVGPIHVGSTQPNNAPTGFTS
JGI25127J35165_109513413300002482MarineMAVQIQTRRSSTVNDRPFPTRLGAGELALNNHSTSPGLFFADNTASPSTGLIKVGPVHIGSTAPNT
JGI25132J35274_100881113300002483MarineMSIQILSRRSTVLXDRPNPLRIGAGELCVNTNPNDPGLYFADSTASPSTGLIKAGPTFVGATAPNTPAAG
JGI25132J35274_105991113300002483MarineMAVQIQTRRSSTAHDRPFPIRLGAGELALNNNNVSPGLFFADDTAAPNTGLIKVGPVHIGSTAPNNAA
JGI25132J35274_107206113300002483MarineMSIQILSRRSTVLHDRPNPLRIGAGELCVNTNPNDPGLYFADSTASPSTGLIKAGPTFVGSTAPNTPAAGFATS
JGI25132J35274_107737013300002483MarineMAVQIQSRRSSTAHDRPFPIRLGAGELAVNNNSVSPGLFFADNTASPSTGLI
JGI25132J35274_112934713300002483MarineMAVQIQTRRSSTAHDRPFPTRLGTGELALNNNDVSPGLFFADN
JGI25128J35275_104419413300002488MarineMTIQIQSRRSSLLNDRPVPTRIGAGELCVNINSGDPGLFFADNIASPSTGLIKVGPIHVGSTQPNNSP
JGI25128J35275_105826713300002488MarineMAVQILSRRSITLHDRPYPTRLGIAELAVNNNAGDPGLFFADNTASPST
JGI25128J35275_106526533300002488MarineMAVQIQTRRSSTQNDRPFPTRLGAGELALNNHNTSPGLFFADNVASPSTDCLHFS*
JGI25133J35611_1001612113300002514MarineMAVQILSRRSSTLYDRPFPIRLGSGELAINNNNGEPGLYFADNIASPSTGLIKVGPIHIGATAPNVT
JGI25133J35611_1002213313300002514MarineMAVQILSRRSSTLRDRPYPTRLGSAELAINNNAGEPGLFFADNTASPSTGLIKVGPISV
JGI25133J35611_1009675513300002514MarineMAVQILSRRSSTLRDRPYPIRLGSAELAINNNAGEPGLFFADNTASPSTG
JGI25133J35611_1010196413300002514MarineMAVQILSRRSSTLYDRPFPIRLGAAELAINNNAGEPGLFFADNTASPSTGLVKV
Ga0066370_1032310923300005971MarineMAVQIQSRRSSTAHDRPFPIRLGAGELAVNNNNVSPGLFFADNTASPSTGLIKVGP
Ga0068468_110554113300006305MarineMAVQIQSRRSSTAHDRPFPIRLGAGELAVNNNSVSPGLFFADNTASPSTGLIK
Ga0099675_103467923300006334MarineMAVQIQSRRSSTAHDRPFPIRLGAGELAVNNNNISPGLFFADNTASPSTGLIKVGPVHIGSTAPNN
Ga0099963_107860723300006413MarineMAVQIQTRRSSTANDRPFPTRLGAGELALNNHSTSPGLFFADNV
Ga0100226_103239223300006480MarineMAVQIQTRRSSTANDRPFPTRLGAGELALNNHSTSPGLFFADNVFSSDFVNE*
Ga0100229_103488323300006481MarineMAVQIQTRRSSTANDRPFPIRLGAGELALNNNSVSPGLFFADNTASPSTGLIKVGP
Ga0100229_103756513300006481MarineMTIQIQSRRSSLLNDRPVPTRISAGELCVNINSGDPGLFFADNVASPSTGLIKVGPIHVGSTQ
Ga0100228_105477213300006565MarineMAVQILSRRSNVLSDRPFPTRLGVGELALNYNAGEPGLFFVDNTASPSTKLIKIGPIAIGATA
Ga0098038_125849113300006735MarineMAVQIQSRRSSTAHDRPFPIRLGAGELTVNNNNISPGLFFADNTASPSTGLIKVGPVH
Ga0098037_114788423300006737MarineMAVQILTRRSSVLHDRPFPIRLGTAELAVNNNAGKPGIFIADNTASPSTGLIKIGPTFVGSTSPNASPVGFTSYS
Ga0098044_1003014123300006754MarineMAVQILSRRSSTLYDRPFPIRLGAAELAINNNAGEPGLFFADNTASPSTGLVKVGPIAIS
Ga0098054_115632313300006789MarineMAVQILSRRSSTLHDRPYPTRLGIAELAVNNNAGDPGLFFADNTASPSTGLIKVGPISIGSTAPNNS
Ga0098041_107777213300006928MarineMAVQILSRRSSVLHDRPFPTRLGAAELAINNNAGEPGLFFADNTASPSTGLIKVGPISIGST
Ga0098041_125638423300006928MarineMAVQILTRRSSVLHDRPFPIRLGDAELAVNNHATEPGLFFADNTASPSTGLVKIGPTFVGSTSPNASPVGFNSYSKGESWLD
Ga0101666_105568623300007113Volcanic Co2 Seep SeawaterMTIQIQTRRSSLLNDRPVPTRIASGELCVNINSGDPGLFFADSVASPSTGLIKVGPIHVGSTQPNNTPTGFTSFSKGE
Ga0070753_103087523300007346AqueousMTIQILSRRSSLLNDRPFPIRIGDGELSLNLNPADPGLYFADSTGAPSTGLIKVGPVHVDSTPP
Ga0099848_131216213300007541AqueousMAVQILSRRSSIAFDRPFPIRLGNAELAINFNSADPGLYFADNTAAPSTNLIKVGPTFIGATAPNTPATGFN
Ga0099846_101454113300007542AqueousMAVQILSRRSSVAFDRPFPIRLGAGELALNFNATDPGLFYADAAASPSTGLIKVGPT
Ga0099846_132765713300007542AqueousMAVQILSRRSSVLFDRPFPVRIGVGELALNNNPGDPGLYFADNVTSPSTGLIKVGPTF
Ga0102861_103416613300007544EstuarineMAVQILSRRSSLLHDRPFPIRLGVGELTLNNNSGDPGLYFADDTASPGTGLIKVGPAFI
Ga0102865_121932223300007639EstuarineMAVQILSRRSSLLHDRPFPIRLGVGELTLNNNSGDPGLYFADDTASPGTGLIKVGPAFIGSTT
Ga0108970_1164616023300008055EstuaryMAVQILSRRSSLLFDRPYPIRLGVAELAVNNNPGDPGLYFADNTAGPSTGLIKVGPTFIGAS
Ga0114932_1004813243300009481Deep SubsurfaceMAVQILSRRSSVLHDRPFPIRLGSAELAVNNNSGDPGLFFADNTAAPSTGLIKIGPISVGTAAPNASAVGFTSNS
Ga0114932_1022774113300009481Deep SubsurfaceMTIQIQSRRSSLLNDRPVPTRIGAGELCVNINSGDPGLFFADSVASPSTGLIKVGPIHVGSTQPNNSPTG
Ga0115011_1064226523300009593MarineMAVQILSRRSSTLYDRPFPIRLGAAELAINNNAGEPGLFFADNTASPSTGLVKVGPIAISSTAPNTSAVGFTSSSKGESWLDTAST
Ga0115011_1073823113300009593MarineMAVQILSRRSNVLHDRPFPTRLGTAELAINNNPGEPGLFFADNTAAPNTGLVKAGPISVGTTSPNNAAAGFT
Ga0115012_1191341913300009790MarineMAVQILSRRSSVLHDRPFPTRLGSAELAVNNNAGDPGLFFADNTASPSTG
Ga0105189_100173123300009794Marine OceanicMAVQILSRRSSVLHDRPFPTRLGTAELAINNNAGQPGLFFADNTASPATGLVK
Ga0098043_119854123300010148MarineMTIQIQTRRSSLLNDRPVPTRIAAGELCVNINSGDPGLFFADNVASPSTGLIKVGPIHVGSTQPNN
Ga0098049_121554223300010149MarineMAVQILSRRSSTLRDRPYPIRLGSAELAINNNAGEPGLFFADNTASPSTGLIKVGPISVGSTAP
Ga0098061_132004223300010151MarineMTIQILSRRSSLLNDRPVPTRIGAGELCVNTNASDPGLYFADNTASPSTGLIKAGPVHIGSTQPN
Ga0136549_1045783523300010389Marine Methane Seep SedimentMAVQILSRRSSVLYDRPFPIRLGTAELAVNNNPGDPGLYFADSTASPSTGLIKVG
Ga0114934_1030796423300011013Deep SubsurfaceMTIQILSRRSALLNDRPVPTRIGAAELCVNTNAGDPGLYFADATAAPSTGLIKVGPVHIGTTQPNNAPSGFTSFSKGEQW
Ga0160422_1011828123300012919SeawaterMAVQIQTRRSSVVNDRPFPTRLGAGELALNNNNASPGLFFADDTASPSTGL
Ga0160423_1067356813300012920Surface SeawaterMTIQIQSRRSSLLNDRPVPTRISAGELCVNINSGDPGLFFADNVASPSTGLIKVGPIHVGSTQPNNA
Ga0160423_1090978913300012920Surface SeawaterMAVQILTRRSSVLNDRPFPIRLGVAELAVNNNAAEPGLFFADDTASPSTGLIKVGPTFVG
Ga0160423_1110342013300012920Surface SeawaterMAVQILSRRSSVLHDRPFPIRLGSAELAVNNNAGDPGLFFADNTASPSTGLVKIGPISVGTT
Ga0163110_1039779813300012928Surface SeawaterMTIQIQTRRSSLLNDRPVPTRIAAGELCVNINSGDPGLFFADNVASPSTGLIKVGPIHVGSTQPNNAPTGFSS
Ga0163110_1050751413300012928Surface SeawaterMAVQIQTRRSSTLSDRPFPIRLGEGELALNNNSGSPGLFFADNTASPNTGLIKVGPVHV
Ga0163180_1040984713300012952SeawaterMAVQIQSRRSSTAHDRPFPIRLGAGELAVNNNSVSPGLFFADNTASPSTGLIKVGPVHIGSTAPNSS
Ga0163111_1082675323300012954Surface SeawaterMAVQIQSRRSSTLNDRPFPIRLGAGELAVNNNAGSPGLFFADNTASPNTGLIKVGPV
Ga0164292_1079049513300013005FreshwaterMAGQVLSRRSSILHDRPFPIRLGIAELALNNNPGDPGLYFADNTASPSTGLIKVGPTFIGSTPPNTPAV
Ga0181338_100353413300015050Freshwater LakeMADQILNNRSSLLHDRPLPTRLGAAEIAINYNPSDPGLYFADSTASPSTGLIKVGPTF
Ga0180120_1031923123300017697Freshwater To Marine Saline GradientMAVQVLSRRSALLSDRPFPIRLGSGELAVNINPTEPGLFFADSTSSPSAGLVKVGPTYIG
Ga0181387_105085323300017709SeawaterMAVQIQTRRSSTVNDRPFPVRLGAGELALNNNSTSPGLFFADNTASPSTGLIKVG
Ga0181387_105827923300017709SeawaterMAVQIQTRRSSTANDRPFPIRLGSGELALNNNNTSPGLFFADNTASPNTGLIK
Ga0181387_109556513300017709SeawaterMAVQIQTRRSSTANDRPFPIRLGAGELALNNNNTSPGLFFADDTASPSTGLIKVGPVHIG
Ga0181391_107626723300017713SeawaterMAVQIQTRRSSTANDRPFPIRLGSGELALNNNSTSPGLFFADNTASPNTGLIKVGPVHIGSTAPNTG
Ga0181417_104756213300017730SeawaterMAVQIQTRRSSTANDRPFPVRLGAGELALNNNSASPGLFFAD
Ga0181417_107516723300017730SeawaterMAVQIQTRRSSTANDRPFPIRLGSGELALNNNNTSPGLFFADNTA
Ga0181415_112429023300017732SeawaterMTIQIQSRRSSLLNDRPVPTRIGAGELCVNINSGDPGLFFADNVASPSTGLIK
Ga0187222_110531323300017734SeawaterMAVQILSRRSSVLHDRPFPIRLGSAELAVNNNSGDPGLFFADNTAAPSTGLIKIGPISVGTAAPNASAVGFTSNSKGESWLDTN
Ga0187222_114095923300017734SeawaterMTIQIQSRRSSLLNDRPVPTRIGAGELCVNINSGDPGLFFADSVASPSTGLIKVGPIHVGSTQPNNSPTGFASFSKG
Ga0181418_116458123300017740SeawaterMAVQILSRRSSVLHDRPFPTRLGVAELAVNNNANQPGLFFADNTAAPSTGLVKVGPIAIGTAAPN
Ga0181397_111198413300017744SeawaterMAVQIQTRRSSTVNDRPFPTRLGAGELALNNHSTSPGLFFADNVASPSTGLIKV
Ga0181420_116641513300017757SeawaterMAVQILSRRSTTLHDRPYPTRLGIAELAINNNAGDPGLFFADNTASPSTGLIKVGPISIGST
Ga0181409_123135713300017758SeawaterMAVQILSRRSSVLHDRPFPTRLGAAELAINNNAGEPGLFFADNTASPATGLVKVGPISIGTAVPNNTAAGFTGN
Ga0181408_109568623300017760SeawaterMAVQILSRRSSVLHDRPFPTRLGVAELAVNNNAGQPGLFFADNTAAPSTGLVKVGPIAIGTAAPNVT
Ga0181408_112144123300017760SeawaterMAVQILSRRSSVLHDRPFPIRLGSAELAVNNNAGDPGLFFADNTASPSTGLVKIGPISVG
Ga0181385_121643713300017764SeawaterMAVQIQTRRSSTVNDRPFPTRLGAGELALNNHSTSPGLFFADNVASPSTGLIKVGPVHIG
Ga0181385_127548523300017764SeawaterMAVQIQTRRSSTANDRPFPVRLGAGELALNNDSTSPGLFFADNTASPSTGLIKVGPVHIGSTAPNTSAAGFTSSS
Ga0181413_113101023300017765SeawaterMAVQIQTRRSSTANDRPFPVRLGAGELALNNNSASPGLFFADDTASPSTGLIKVGPV
Ga0187220_107075213300017768SeawaterMAVQIQTRRSSTANDRPFPIRLGSGELALNNNSTSPGLFFADNTASPNTGLIKVGPV
Ga0181425_103695113300017771SeawaterMAVQILSRRSSVLHDRPFPTRLGAAELAINNNASEPGLFFADNTASPSTGLVKVGPISVGTAAPNNAAAGFTGNT
Ga0181386_119265513300017773SeawaterMTIQILSRRSSLLNDRPVPTRIGAGELCININAGDPGLYFADATAAPSTGLIKVGPTHVGTT
Ga0181380_104119123300017782SeawaterMTIQIQSRRSSLLNDRPVPTRIGAGELCVNINSGDPGLFFADNIASPSTGLIKVGPIHVDSTQP
Ga0180432_1038011723300017989Hypersaline Lake SedimentMTIQILSRRSSLLNDRPFPIRIGDGELALNLNPADPGLYFADSTGAPSTGLIKVGPVHVDSTPPNAAPTGFTSLSRGEQ
Ga0180433_1048715423300018080Hypersaline Lake SedimentMTIQILSRRSSLLNDRPFPIRIGDGELALNLNPADPGLYFADSTGAPSTGLIKVGPVHVD
Ga0194131_1013787523300020193Freshwater LakeMSIQILSRRSTVLNDRPFPIRLGAGEIAINLNSTDPGLFFADNVASPSTGLIKVGPTFVGSTLPNTPAAGFTSF
Ga0211707_105317723300020246MarineMAVQIQTRRSSTLNDRPFPTRLGAGELALNNHSTSPGLFFADNVA
Ga0211648_105879113300020267MarineMAVQIQTRRSSTLNDRPFPIRLGEGELALNNNSGSPGLFFADNTASPNTGLI
Ga0211628_100313613300020311MarineMAVQIQTRRSSTANDRPFPIRLGAGELALNNNSVSPGLFFADNTASPSTGLIKVGPVHIG
Ga0211582_1032132913300020386MarineMTIQIQTRRSSLLNDRPVPTRIAAGELCVNINSGDPGLFFADNVASPSTGLIKVGPIHVGSTQ
Ga0211497_1034893423300020394MarineMTIQIQSRRSSLLNDRPVPTRISAGELCVNINSGDPGLFFADNVASPSTGLIK
Ga0211617_1023748313300020401MarineMAVQIQTRRSSTAHDRPFPTRLGTGELALNNNDVSPGLFFADNTASPSTGLIKVGPVHIG
Ga0211472_1043010513300020409MarineMAVQIQTRRSSTAHDRPFPIRLGAGELALNNNNVSPGLFFADDTTAPNTGLIKVGPV
Ga0211587_1005786513300020411MarineMAVQILSRRSSVLHDRPFPTRLGTAELAVNNNAGQPGLFFADNTASPST
Ga0211528_1021018823300020417MarineMAVQIQTRRSSTANDRPFPTRLGAGELALNNHSTSPGLFFADNVASPSTGLIK
Ga0211512_1035923213300020419MarineMAVQILSRRSSVLHDRPFPIRLGSAELAVNNNSGDPGLFFADNTAAPSTGLIKIGPISVGTT
Ga0211512_1045075123300020419MarineMAVQIQTRRSSTANDRPFPVRLGAGELALNNNSTSPGLFFADNTASPN
Ga0211653_1027361323300020421MarineMAVQILSRRSSVLHDRPFPIRLGSAELAVNNNAGDPGLFFADNTASPSTGLIKIGPISVGTAAPNASA
Ga0211708_1016607213300020436MarineMTIQIQTRRSSLLNDRPVPTRIASGELCVNINSGDPGLFFADNVASPSTGLIKVGPIHVG
Ga0211576_1016431513300020438MarineMAVQILSRRSSVLHDRPFPTRLGAAELAINNNAGEPGLFFADNTASPATGLVKVGPIS
Ga0211576_1051186713300020438MarineMAVQIQTRRSSTANDRPFPIRLGSGELALNNNSTSPGLFFADNTASPNT
Ga0211559_1047711313300020442MarineMTIQIQSRRSSLLNDRPVPTRISAGELCVNINSGDPGLFFADNVASPSTGLIKV
Ga0211564_1001533353300020445MarineMAVQILSRRSNVLFDRPYPTRLGVGELALNYNASEPGLFFVDNTASPSTKLIKIGPIAIG
Ga0211564_1034136623300020445MarineMAVQILSRRSSVLHDRPFPIRLGSAELAVNNNAGDPGLFFADNTASPSTGLVKIGPISVGTAAPNASAVGFTSN
Ga0211574_1034718813300020446MarineMAVQIQSRRSSTANDRPFPVRLGSGELALNNNNVSPGLFFADNTASPSTGLIKVGPVHIGNTAPNTSPAGFTSLSKG
Ga0211641_1058139523300020450MarineMTIQIQTRRSSLLNDRPVPTRIAAGELCVNINSGDPGLFFADNVASPSTGLIKVGPIHVSSTQPNNAPTGFTSFSK
Ga0211473_1055952113300020451MarineMAVQIQTRRSSTANDRPFPIRLGAGELALNNNNTSPGLFFADDTASP
Ga0211473_1063790023300020451MarineMAVQILSRRSSVLHDRPFPTRLGAAELAINNNAGEPGLFFADNTASPSTGLVK
Ga0211548_1034014923300020454MarineMAVQIQTRRSSTVNDRPFPTRLGAGELALNNHSTSPGLFFADNVASPS
Ga0211643_1033290213300020457MarineMSVQILSRRSSLLNDRPFPTRLGTAELAVNNHPSEPGLFFADNTSSPATGLVKIGP
Ga0211475_1044662723300020468MarineMTIQIQSRRSSLLNDRPVPTRIGAGELCVNINSGDPGLFFADSVASPSTGLIKVGPIHVG
Ga0211547_1047598123300020474MarineMAVQIQTRRSSTANDRPFPVRLGAGELALNNNSTSPGLFFADNTASPSTGL
Ga0224906_104296413300022074SeawaterMAVQIQTRRSSTVNDRPFPVRLGAGELAVNNNSTSPGLFFADNTASPSTGLIKVGPVHIGSTAPNTSAAG
Ga0196899_118237513300022187AqueousMTIQILSRRSSLLNDRPFPIRIGDGELSLNLNPADPGLYFADSTGAPSTGLIKVGPVHVDSTPPNAAPTGFTSLSKGE
Ga0196905_105231113300022198AqueousMAVQILSRRSSVAFDRPFPIRLGAGELALNFNVTDPGLFYADNTASPSTGLIKVGPTFIG
Ga0196905_109634623300022198AqueousMTIQILSRRSVLLHDRPFPIRMGEGEIELNLNAADPGLYIADSTPAPSTGLIKIGPVHVSSTPPNASPTGFAGFCKGEQWLNTI
Ga0209992_1001232173300024344Deep SubsurfaceMAVQILSRRSSVLHDRPFPIRLGSAELAVNNNSGDPGLFFADNTAAPSTGLIKIGPISVGTAAPNASAVGFTSNSKGESWLDTNSTH
Ga0255142_107148813300024352FreshwaterMTVQILSRRSTILYDRPFPTRLGLAELAVNLNAGDPGLFFANSTSASLIKVGPT
Ga0208158_106110723300025110MarineMAVQILSRRSSVLHDRPFPTRLGAAELAINNNAGEPGLFFADNTASPATG
Ga0209348_101407113300025127MarineMAVQIQTRRSSTAHDRPFPIRLGAGELALNNNNVSPGLFFADDTAAPN
Ga0209348_105342613300025127MarineMTIQIQSRRSSLLNDRPVPTRIGAGELCVNINSGDPGLFFADNVASPSTGLIKVGPIHVGSTQ
Ga0209348_121879123300025127MarineMAVQIQTRRSSTANDRPFPVRLGAGELALNNNSVSPGLFFADNTASPSTGLI
Ga0209232_101630213300025132MarineMAVQILSRRSSVLHDRPFPTRLGVAELAVNNNAGQPGLFFADNTAAPSTGLVKVGPIAIGTAA
Ga0209232_113435813300025132MarineMAVQILSRRSSVLHDRPFPTRIGVAELALNNNASQPGLFFADNTASPNTGLVKIGPIAIGTSAPNVSAVGFTSNSKGES
Ga0209645_102147513300025151MarineMAVQIQSRRSSTAHDRPFPIRLGAGELAVNNNNVSPGLFFADDTASPS
Ga0209645_121716723300025151MarineMAVQIQTRRSSTVNDRPFPTRLGAGELALNNNSTSPGLFFADNVASPSTGLIKVGPVHI
Ga0209645_123787523300025151MarineMTIQIQSRRSSLLNDRPVPTRISAGELCVNINSGDPGLFFADNVASPSTGLIKVGPIHVGSTQPNNSPTGFTSFSKG
Ga0208161_106644913300025646AqueousMAVQILSRRSSVAFDRPFPIRLGAGELALNFNVTDPGLFYADNTASPSTG
Ga0208795_103030613300025655AqueousMAVQILSRRSSVLYDRPFPIRLGVAELAVNNNPGDPGLYFADNTASPSTGLIKVGPTFIG
Ga0208795_114215023300025655AqueousMAVQILSRRSSVAFDRPFPIRLGAGELALNFNVTDPGLFYADNTASPSTGLIKVGPTFIGATAPN
Ga0208019_105932713300025687AqueousMTIQILSRRSSLLNDRPFPIRIGDGELALNLNPADPGLYFADSTGAPSTGLIKVGPVHVDSTPPNAAPT
Ga0208644_125828123300025889AqueousMTIQILSRRSSLLNDRPFPIRIGDGEIALNLNPADPGLYFADSTPAPSKGLIKVGPVHVDSTAPNAAP
Ga0208277_126138113300026292MarineMAVQILSRRSSVLHDRPFPTRLGTAELAINNNAGQPGLFFADNTASPSTGLIKVGPISIGSTAPNNSAAG
Ga0209228_110755713300027709MarineMAIQVLSRRSSTLRDRPFPIRLGSAELAVNNNAGEPGLFFADNTASPSTGLIKIGPTFVGSTAPNTSATGFTSLSK
Ga0209359_1038996623300027830MarineMAVQIQTRRSSTLNDRPFPTRLGEGELALNNHSTSPGLFFADNVASPSTGLIKVG
Ga0135227_105187623300029302Marine HarborMAVQIQTRRSSTANDRPFPTRLGAGELALNNHSTSPGLFFADNVASPSTGLIKVGPVHIGSTAPNSSAARIVTGKRSIISRA
Ga0183757_102895923300029787MarineMAVQILSRRSSTLNDRPYPIRLGTAELAVNNNAGDPGLFFADNTASPSTGLIKVGPISIG
Ga0183826_101465313300029792MarineMAVQIQTRRSSVANDRPFPVRLGAGELALNNNSVSPGLFFADNTASPNTGLIKVGPVHIG
Ga0307380_1021709513300031539SoilMAVQILSRRSPVSFDRPFPVRLGTAELAVNFDSTDPGLYFADNTAFPATNLIKVGPTFIGSTP
Ga0307379_1019506123300031565SoilMAVQILSRRSPVSFDRPFPVRLGTAELAVNFDSTDPGLYFADNTAFPATNLIKVGPTF
Ga0307379_1066866923300031565SoilMAVQVLSRRSALLSDRPFPIRLGIGELAVNINPAEPGLFFADSTSSPSTGLIKVGPTYIG
Ga0307375_1069266013300031669SoilMAVQILSRRSSVLYDRPFPIRLGTAEIAINNNPGDPGLYFADSTASPSTGLIKVGPTFIGSSAPN
Ga0315332_1054110613300031773SeawaterMAVQILSRRSSTLHDRPFPTRLGAAELAVNNNSGDPGLFFADNTASPSTGLIKAGPISIGSTAPNASGV
Ga0315331_1022401623300031774SeawaterMAVQILSRRSSVLHDRPFPIRLGSAELAVNNNSGDPGLFFADNTAAPSTGLIKIGPISVGTTAP
Ga0315331_1065812813300031774SeawaterMAVQIQTRRSSTANDRPFPVRLGAGELALNNNSTSPGLFFADDTASP
Ga0315316_1065947613300032011SeawaterMAVQILSRRSSVLHDRPFPTRLGVAELAVNNNAGQPGLFFADNTAAPSTGLVKVGPIAIGTAAPNVTAAGFTGNS
Ga0315327_1061829513300032032SeawaterMAVQILSRRSSVLHDRPFPIRLGSAELAVNNNAGEPGLFFPDNTASPTTGLIKVGPISVGTTAPNNT
Ga0315315_1069566013300032073SeawaterMAVQILSRRSSTLYDRPFPIRLGAAELAINSNAGEPGLFFADNTASPST
Ga0310342_10054021513300032820SeawaterMAVQIQTRRSSTANDRPFPTRLGAGELALNNHSTSPGLFFTDN
Ga0335027_0360866_759_9563300034101FreshwaterMAGQVLSRRSSILHDRPFPIRLGIAELALNNNPGDPGLYFADNTASPSTGLIKVGPTFIGSTPPNT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.