| Basic Information | |
|---|---|
| Family ID | F044538 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 154 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAAAHAS |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 58.44 % |
| % of genes near scaffold ends (potentially truncated) | 25.97 % |
| % of genes from short scaffolds (< 2000 bps) | 69.48 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.130 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (9.740 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.416 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF02547 | Queuosine_synth | 54.55 |
| PF17191 | RecG_wedge | 13.64 |
| PF03466 | LysR_substrate | 7.79 |
| PF00691 | OmpA | 1.95 |
| PF00270 | DEAD | 1.30 |
| PF01702 | TGT | 1.30 |
| PF13663 | DUF4148 | 1.30 |
| PF01336 | tRNA_anti-codon | 1.30 |
| PF00126 | HTH_1 | 0.65 |
| PF07690 | MFS_1 | 0.65 |
| PF13932 | GIDA_C | 0.65 |
| PF09286 | Pro-kuma_activ | 0.65 |
| PF00990 | GGDEF | 0.65 |
| PF00005 | ABC_tran | 0.65 |
| PF00271 | Helicase_C | 0.65 |
| PF02527 | GidB | 0.65 |
| PF09916 | DUF2145 | 0.65 |
| PF04542 | Sigma70_r2 | 0.65 |
| PF13730 | HTH_36 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 54.55 |
| COG0343 | Queuine/archaeosine tRNA-ribosyltransferase | Translation, ribosomal structure and biogenesis [J] | 1.30 |
| COG1549 | Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domains | Translation, ribosomal structure and biogenesis [J] | 1.30 |
| COG0357 | 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B) | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.65 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.65 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.65 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.78 % |
| Unclassified | root | N/A | 29.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002705|JGI25156J39149_1000173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 47258 | Open in IMG/M |
| 3300002705|JGI25156J39149_1024228 | Not Available | 995 | Open in IMG/M |
| 3300003316|rootH1_10043954 | Not Available | 1285 | Open in IMG/M |
| 3300003316|rootH1_10043955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1527 | Open in IMG/M |
| 3300003320|rootH2_10083522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4697 | Open in IMG/M |
| 3300003322|rootL2_10073555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1152 | Open in IMG/M |
| 3300003752|Ga0055539_1000389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 17745 | Open in IMG/M |
| 3300003752|Ga0055539_1014771 | Not Available | 951 | Open in IMG/M |
| 3300003792|Ga0055540_1011122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2934 | Open in IMG/M |
| 3300005327|Ga0070658_10063423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3012 | Open in IMG/M |
| 3300005327|Ga0070658_10067629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2919 | Open in IMG/M |
| 3300005327|Ga0070658_10136176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2049 | Open in IMG/M |
| 3300005327|Ga0070658_10199370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 1688 | Open in IMG/M |
| 3300005327|Ga0070658_10772432 | Not Available | 834 | Open in IMG/M |
| 3300005330|Ga0070690_100011136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 5253 | Open in IMG/M |
| 3300005335|Ga0070666_11102188 | Not Available | 590 | Open in IMG/M |
| 3300005339|Ga0070660_100028271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4193 | Open in IMG/M |
| 3300005339|Ga0070660_100096705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 2335 | Open in IMG/M |
| 3300005339|Ga0070660_101444461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 584 | Open in IMG/M |
| 3300005354|Ga0070675_100446165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1160 | Open in IMG/M |
| 3300005364|Ga0070673_100013867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5594 | Open in IMG/M |
| 3300005366|Ga0070659_101058972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 714 | Open in IMG/M |
| 3300005366|Ga0070659_101649926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300005367|Ga0070667_101370163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
| 3300005513|Ga0077120_1024184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4459 | Open in IMG/M |
| 3300005513|Ga0077120_1030519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3688 | Open in IMG/M |
| 3300005515|Ga0077122_10015725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 10411 | Open in IMG/M |
| 3300005519|Ga0077119_10003651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 18762 | Open in IMG/M |
| 3300005519|Ga0077119_10005315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 14847 | Open in IMG/M |
| 3300005519|Ga0077119_10046701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3039 | Open in IMG/M |
| 3300005519|Ga0077119_10103037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1553 | Open in IMG/M |
| 3300005519|Ga0077119_10118496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp. | 1379 | Open in IMG/M |
| 3300005519|Ga0077119_10139860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1195 | Open in IMG/M |
| 3300005535|Ga0070684_101650246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 605 | Open in IMG/M |
| 3300005563|Ga0068855_100030543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6443 | Open in IMG/M |
| 3300005563|Ga0068855_100362507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1595 | Open in IMG/M |
| 3300005563|Ga0068855_102328932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 536 | Open in IMG/M |
| 3300005614|Ga0068856_100548889 | Not Available | 1177 | Open in IMG/M |
| 3300005616|Ga0068852_100566506 | Not Available | 1137 | Open in IMG/M |
| 3300005644|Ga0075036_1666882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 525 | Open in IMG/M |
| 3300005834|Ga0068851_10329378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 884 | Open in IMG/M |
| 3300006353|Ga0075370_10000121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 25670 | Open in IMG/M |
| 3300009093|Ga0105240_10742378 | Not Available | 1068 | Open in IMG/M |
| 3300009093|Ga0105240_12054045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300009148|Ga0105243_10018257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5311 | Open in IMG/M |
| 3300009500|Ga0116229_11054454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
| 3300009545|Ga0105237_11074068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 812 | Open in IMG/M |
| 3300009551|Ga0105238_12973012 | Not Available | 509 | Open in IMG/M |
| 3300009553|Ga0105249_10759519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1032 | Open in IMG/M |
| 3300009553|Ga0105249_13199992 | Not Available | 526 | Open in IMG/M |
| 3300009650|Ga0105857_1142408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300009662|Ga0105856_1347076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300009709|Ga0116227_10067922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3063 | Open in IMG/M |
| 3300009709|Ga0116227_10191856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1591 | Open in IMG/M |
| 3300009709|Ga0116227_10256048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1346 | Open in IMG/M |
| 3300009787|Ga0116226_10157950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 2359 | Open in IMG/M |
| 3300009787|Ga0116226_10630578 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae → Eurotiales → Aspergillaceae → Aspergillus → Aspergillus subgen. Fumigati → Aspergillus fumigatus | 1070 | Open in IMG/M |
| 3300010154|Ga0127503_10044161 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300010331|Ga0123336_10395509 | Not Available | 706 | Open in IMG/M |
| 3300010375|Ga0105239_10160751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2509 | Open in IMG/M |
| 3300010375|Ga0105239_12015896 | Not Available | 670 | Open in IMG/M |
| 3300010877|Ga0126356_10542864 | Not Available | 675 | Open in IMG/M |
| 3300011119|Ga0105246_10020462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter | 4244 | Open in IMG/M |
| 3300013006|Ga0164294_10461840 | Not Available | 866 | Open in IMG/M |
| 3300013296|Ga0157374_12558363 | Not Available | 538 | Open in IMG/M |
| 3300013297|Ga0157378_13291367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300013308|Ga0157375_10781989 | Not Available | 1104 | Open in IMG/M |
| 3300014168|Ga0181534_10849108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300014168|Ga0181534_10952399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300014325|Ga0163163_11193437 | Not Available | 824 | Open in IMG/M |
| 3300015024|Ga0167669_1112760 | Not Available | 825 | Open in IMG/M |
| 3300017792|Ga0163161_11291040 | Not Available | 634 | Open in IMG/M |
| 3300018037|Ga0187883_10277933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 856 | Open in IMG/M |
| 3300020580|Ga0210403_11293936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300021170|Ga0210400_10607438 | Not Available | 902 | Open in IMG/M |
| 3300021361|Ga0213872_10064032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1661 | Open in IMG/M |
| 3300021361|Ga0213872_10074075 | Not Available | 1533 | Open in IMG/M |
| 3300021403|Ga0210397_10046382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2771 | Open in IMG/M |
| 3300021403|Ga0210397_10273836 | Not Available | 1232 | Open in IMG/M |
| 3300021405|Ga0210387_10530930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1046 | Open in IMG/M |
| 3300021475|Ga0210392_10714624 | Not Available | 746 | Open in IMG/M |
| 3300021861|Ga0213853_10569273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 539 | Open in IMG/M |
| 3300022561|Ga0212090_10479824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 863 | Open in IMG/M |
| 3300022908|Ga0247779_1005043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5033 | Open in IMG/M |
| 3300025231|Ga0207427_100422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 24068 | Open in IMG/M |
| 3300025253|Ga0209677_103833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4639 | Open in IMG/M |
| 3300025256|Ga0209759_1000925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 21323 | Open in IMG/M |
| 3300025256|Ga0209759_1012355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2370 | Open in IMG/M |
| 3300025256|Ga0209759_1030676 | Not Available | 1058 | Open in IMG/M |
| 3300025303|Ga0209051_1001844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 16718 | Open in IMG/M |
| 3300025303|Ga0209051_1016835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3285 | Open in IMG/M |
| 3300025899|Ga0207642_10150614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1238 | Open in IMG/M |
| 3300025909|Ga0207705_10072478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2498 | Open in IMG/M |
| 3300025909|Ga0207705_10080829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2369 | Open in IMG/M |
| 3300025909|Ga0207705_10874791 | Not Available | 696 | Open in IMG/M |
| 3300025913|Ga0207695_11177133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300025920|Ga0207649_10598910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 847 | Open in IMG/M |
| 3300025926|Ga0207659_10502415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1027 | Open in IMG/M |
| 3300025931|Ga0207644_11864541 | Not Available | 503 | Open in IMG/M |
| 3300025932|Ga0207690_10283155 | Not Available | 1292 | Open in IMG/M |
| 3300025935|Ga0207709_10009295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5413 | Open in IMG/M |
| 3300025937|Ga0207669_11365118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300025949|Ga0207667_10010010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 11120 | Open in IMG/M |
| 3300025949|Ga0207667_10199417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2053 | Open in IMG/M |
| 3300025949|Ga0207667_10446801 | Not Available | 1314 | Open in IMG/M |
| 3300025960|Ga0207651_10006896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5999 | Open in IMG/M |
| 3300025961|Ga0207712_11806023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300028381|Ga0268264_11926587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300028562|Ga0302151_10000078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 56184 | Open in IMG/M |
| 3300028562|Ga0302151_10011562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 3364 | Open in IMG/M |
| 3300028743|Ga0302262_10115939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 919 | Open in IMG/M |
| 3300028762|Ga0302202_10434556 | Not Available | 603 | Open in IMG/M |
| 3300028783|Ga0302279_10356520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300028800|Ga0265338_11103878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300028869|Ga0302263_10315195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 620 | Open in IMG/M |
| 3300028870|Ga0302254_10238784 | Not Available | 669 | Open in IMG/M |
| 3300028877|Ga0302235_10054183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1920 | Open in IMG/M |
| 3300028877|Ga0302235_10445075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300029883|Ga0311327_10015221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6619 | Open in IMG/M |
| 3300029917|Ga0311326_10087566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1741 | Open in IMG/M |
| 3300029945|Ga0311330_10297219 | Not Available | 1395 | Open in IMG/M |
| 3300029945|Ga0311330_10570430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 896 | Open in IMG/M |
| 3300029951|Ga0311371_10007595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 21884 | Open in IMG/M |
| 3300029951|Ga0311371_12013860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300029987|Ga0311334_11104124 | Not Available | 663 | Open in IMG/M |
| 3300029989|Ga0311365_11755945 | Not Available | 531 | Open in IMG/M |
| 3300030020|Ga0311344_10059854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4633 | Open in IMG/M |
| 3300030294|Ga0311349_10131054 | Not Available | 2346 | Open in IMG/M |
| 3300030520|Ga0311372_11482177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 838 | Open in IMG/M |
| 3300030524|Ga0311357_10237520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1768 | Open in IMG/M |
| 3300030617|Ga0311356_10270627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus | 1711 | Open in IMG/M |
| 3300030677|Ga0302317_10188425 | Not Available | 951 | Open in IMG/M |
| 3300031027|Ga0302308_10222040 | Not Available | 1200 | Open in IMG/M |
| 3300031232|Ga0302323_102095781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 643 | Open in IMG/M |
| 3300031507|Ga0307509_10192119 | Not Available | 1891 | Open in IMG/M |
| 3300031543|Ga0318516_10115628 | Not Available | 1526 | Open in IMG/M |
| 3300031616|Ga0307508_10373032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1018 | Open in IMG/M |
| 3300031730|Ga0307516_10004842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 16393 | Open in IMG/M |
| 3300031730|Ga0307516_10689554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 678 | Open in IMG/M |
| 3300031765|Ga0318554_10101341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1618 | Open in IMG/M |
| 3300031781|Ga0318547_11012512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300031897|Ga0318520_10547580 | Not Available | 717 | Open in IMG/M |
| 3300031902|Ga0302322_101795555 | Not Available | 751 | Open in IMG/M |
| 3300031918|Ga0311367_10180714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Verminephrobacter → unclassified Verminephrobacter → Verminephrobacter sp. Larva24 | 2213 | Open in IMG/M |
| 3300031939|Ga0308174_10509369 | Not Available | 986 | Open in IMG/M |
| 3300031939|Ga0308174_11621395 | Not Available | 556 | Open in IMG/M |
| 3300031996|Ga0308176_11848939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300032074|Ga0308173_11628806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 608 | Open in IMG/M |
| 3300032074|Ga0308173_11803801 | Not Available | 576 | Open in IMG/M |
| 3300034170|Ga0370487_0000097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 31616 | Open in IMG/M |
| 3300034170|Ga0370487_0032642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter | 1564 | Open in IMG/M |
| 3300034170|Ga0370487_0212087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001 | 644 | Open in IMG/M |
| 3300034281|Ga0370481_0118297 | Not Available | 901 | Open in IMG/M |
| 3300034643|Ga0370545_056811 | Not Available | 774 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 9.74% |
| Arabidopsis Root | Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.49% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 5.84% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.84% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.84% |
| Arabidopsis Root | Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root | 4.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.55% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 3.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.25% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.60% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 2.60% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 2.60% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.95% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.30% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 1.30% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.30% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.65% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.65% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.65% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Host-Associated | Open in IMG/M |
| 3300003316 | Sugarcane root Sample L1 | Host-Associated | Open in IMG/M |
| 3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Host-Associated | Open in IMG/M |
| 3300003792 | Arabidopsis rhizosphere microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005513 | Combined assembly of arab plate scrape CL_Cvi (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005515 | Combined assembly of arab plate scrape MF_Cvi (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005519 | Combined assembly of arab plate scrape CL_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005644 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_053 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010331 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - ?SSSS metaG | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015024 | Arctic sediment microbial communities from supraglacial cryoconite, Rabots glacier, Tarfala, Sweden (Sample Rb cryoconite) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022561 | Borup_combined assembly | Environmental | Open in IMG/M |
| 3300022908 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5 | Environmental | Open in IMG/M |
| 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025303 | Arabidopsis rhizosphere microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300034170 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16 | Environmental | Open in IMG/M |
| 3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25156J39149_100017341 | 3300002705 | Arabidopsis Root | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAP* |
| JGI25156J39149_10242282 | 3300002705 | Arabidopsis Root | DQQLNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQETSARADS* |
| rootH1_100439542 | 3300003316 | Sugarcane Root And Bulk Soil | MRLIARFVVLMVAVFGVSLAFAWAWDRSDAPPAAEAHGS* |
| rootH1_100439552 | 3300003316 | Sugarcane Root And Bulk Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAAAQRTAS* |
| rootH2_100835225 | 3300003320 | Sugarcane Root And Bulk Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAAAHAAP* |
| rootL2_100735552 | 3300003322 | Sugarcane Root And Bulk Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAAAQRAAT* |
| Ga0055539_100038920 | 3300003752 | Arabidopsis Root | RLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAAAQRAAS* |
| Ga0055539_10147712 | 3300003752 | Arabidopsis Root | RLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAP* |
| Ga0055540_10111222 | 3300003792 | Arabidopsis Root | MRLIARFVVLMVAVFGVSLAFAWAWDRSDTPPATTPVRGS* |
| Ga0070658_100634233 | 3300005327 | Corn Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDAPQDTATAPAPAHI* |
| Ga0070658_100676293 | 3300005327 | Corn Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQQDTSARADS* |
| Ga0070658_101361762 | 3300005327 | Corn Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQETSARADS* |
| Ga0070658_101993701 | 3300005327 | Corn Rhizosphere | SNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAS* |
| Ga0070658_107724322 | 3300005327 | Corn Rhizosphere | SNMRLIARFVVLMVAVFGVSLAFAWAWDKSDTPQDTATTHAPAHT* |
| Ga0070690_1000111364 | 3300005330 | Switchgrass Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAS* |
| Ga0070666_111021881 | 3300005335 | Switchgrass Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPYDATAQRAAS* |
| Ga0070660_1000282712 | 3300005339 | Corn Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDNTSARADS* |
| Ga0070660_1000967051 | 3300005339 | Corn Rhizosphere | LQSNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAP* |
| Ga0070660_1014444611 | 3300005339 | Corn Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQETSTRADS* |
| Ga0070675_1004461652 | 3300005354 | Miscanthus Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRVAS* |
| Ga0070673_1000138676 | 3300005364 | Switchgrass Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTTARADS* |
| Ga0070659_1010589722 | 3300005366 | Corn Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDTPQDTATAPAPAHI* |
| Ga0070659_1016499261 | 3300005366 | Corn Rhizosphere | MRLIVRFVVLMVAVFGVSLAFAWAWDRSDTPPAAQVHGT* |
| Ga0070667_1013701632 | 3300005367 | Switchgrass Rhizosphere | MRLIVRFVVLMVAVFGVSLAFAWAWDHSDAQKATTTTTTHAE* |
| Ga0077120_10241842 | 3300005513 | Arabidopsis Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDTPQDTATTHAPAHT* |
| Ga0077120_10305192 | 3300005513 | Arabidopsis Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATTTAHAAT* |
| Ga0077122_100157253 | 3300005515 | Arabidopsis Root | MRLIARFVVLMVAVFGLSIAFAWAWDRSDAPKTAQHA* |
| Ga0077119_1000365120 | 3300005519 | Arabidopsis Root | MRLIARFVFLMVAVFGVSLAFAWAWDKSDKPHDDATVRAAA* |
| Ga0077119_100053151 | 3300005519 | Arabidopsis Root | ARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAP* |
| Ga0077119_100467015 | 3300005519 | Arabidopsis Root | QDQQLNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTTARADS* |
| Ga0077119_101030372 | 3300005519 | Arabidopsis Root | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDPAAAHAAT* |
| Ga0077119_101184962 | 3300005519 | Arabidopsis Root | MRLIARFVFLMVAVFGVSLAFAWAWDKSDTPRDANAHATPKA* |
| Ga0077119_101398602 | 3300005519 | Arabidopsis Root | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQQDTNARADS* |
| Ga0070684_1016502462 | 3300005535 | Corn Rhizosphere | NMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQETSTRADS* |
| Ga0068855_1000305434 | 3300005563 | Corn Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAAAQRAAS* |
| Ga0068855_1003625072 | 3300005563 | Corn Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQQDTHARADS* |
| Ga0068855_1023289321 | 3300005563 | Corn Rhizosphere | NMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDNTSARADS* |
| Ga0068856_1005488892 | 3300005614 | Corn Rhizosphere | LIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAAAQRAAS* |
| Ga0068852_1005665062 | 3300005616 | Corn Rhizosphere | LQSNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAAAQRAAS* |
| Ga0075036_16668822 | 3300005644 | Permafrost Soil | DLQLTMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAAAHAS* |
| Ga0068851_103293781 | 3300005834 | Corn Rhizosphere | MRLIVRFLVLMVAVFGLSVAFAWAWDRSDAPRTAHTAA |
| Ga0075370_1000012125 | 3300006353 | Populus Endosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDDAAVRAAS* |
| Ga0105240_107423781 | 3300009093 | Corn Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTSARADS* |
| Ga0105240_120540451 | 3300009093 | Corn Rhizosphere | MRLIARFVVLMVAVFGLSVAFAWAWDRSDAPKTTAHNA* |
| Ga0105243_100182575 | 3300009148 | Miscanthus Rhizosphere | MRLIARFVFLMVAVFGVSLAFAWAWDRSDTPRPTTPVHGS* |
| Ga0116229_110544542 | 3300009500 | Host-Associated | MRLIARFVFIMIAVFGVSLAFAWAWDKSDKPQDAVASH* |
| Ga0105237_110740682 | 3300009545 | Corn Rhizosphere | MRLIVRFLVLMVAVFGLSLAFAWAWDRSEAPKPAAHSS* |
| Ga0105238_129730122 | 3300009551 | Corn Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDRSDSPPATQVHGS* |
| Ga0105249_107595192 | 3300009553 | Switchgrass Rhizosphere | MRLIVRFVVLMVAVFGVSLAFAWAWDHSDAQKATTTTTTHAG* |
| Ga0105249_131999922 | 3300009553 | Switchgrass Rhizosphere | MRLIVRFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAS* |
| Ga0105857_11424082 | 3300009650 | Permafrost Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTAAAHAS* |
| Ga0105856_13470762 | 3300009662 | Permafrost Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDATTAHAS* |
| Ga0116227_100679223 | 3300009709 | Host-Associated | MRLLARFLFLMVAVFGVSLAFAWAWDNSDAPRDAAVHAST* |
| Ga0116227_101918562 | 3300009709 | Host-Associated | MRLIARFVVLMVAVFGVSLAFAWAWDRSDTQHLPAQGHTS* |
| Ga0116227_102560482 | 3300009709 | Host-Associated | MRLIARFVFIMIAVFGVSLAFAWAWDKSDKPRDAVVSH* |
| Ga0116226_101579502 | 3300009787 | Host-Associated | MRLIARFVFIMIAVFGVSLAFAWAWDKSDKRQDAVASH* |
| Ga0116226_106305782 | 3300009787 | Host-Associated | MRLIARFVYIMIAVFGVSLAFAWAWDKSDKPQDAVASH* |
| Ga0127503_100441612 | 3300010154 | Soil | RDLQLNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAASAHAAT* |
| Ga0123336_103955092 | 3300010331 | Glacier Valley | MRLIARFVFLMVAVFGVSLAFAWAWDKSDKSQDTTAAHAS* |
| Ga0105239_101607511 | 3300010375 | Corn Rhizosphere | SNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAP* |
| Ga0105239_120158961 | 3300010375 | Corn Rhizosphere | NMRLIARFVVLMVAVFGVSLAFAWAWDKSDTPQDTATAPAPAHI* |
| Ga0126356_105428642 | 3300010877 | Boreal Forest Soil | RFQMTQDLQLNMRLIARFVFLMVAVFGVSLAFAWAWDKSDKPQDAAVRASN* |
| Ga0105246_100204622 | 3300011119 | Miscanthus Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRTAS* |
| Ga0164294_104618402 | 3300013006 | Freshwater | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHAPPSATAPAAP* |
| Ga0157374_125583632 | 3300013296 | Miscanthus Rhizosphere | LIARFVVLMVAVFGVSLAFAWAWDKSDKPQETTARADS* |
| Ga0157378_132913671 | 3300013297 | Miscanthus Rhizosphere | MRLIARFVVLMVAVFGLSVAFAWAWDRSDAPKTTHNA* |
| Ga0157375_107819892 | 3300013308 | Miscanthus Rhizosphere | MRLIVRFVVLMVAVFGVSLAFAWAWDHSDAQKATTTTTT |
| Ga0181534_108491082 | 3300014168 | Bog | RLIARFVFLMVAVFGVSLAFAWAWDKSDKSQDASVHATSAT* |
| Ga0181534_109523992 | 3300014168 | Bog | FVFLMVAVFGVSLAFAWAWDNSDAPRDAAVHAST* |
| Ga0163163_111934372 | 3300014325 | Switchgrass Rhizosphere | ARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAS* |
| Ga0167669_11127602 | 3300015024 | Glacier Forefield Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAAAHAS* |
| Ga0163161_112910401 | 3300017792 | Switchgrass Rhizosphere | MRLIARFVVLMVAVFGLSVAFAWAWDRSDAPKTTAHNA |
| Ga0187883_102779332 | 3300018037 | Peatland | MRLIARFVFIMIAVFGVSLAFAWAWDKSDKRQDAVASH |
| Ga0210403_112939362 | 3300020580 | Soil | MRLIARFVFLMVAVFGVSLAFAWAWDKSDKPQDASVHATTAT |
| Ga0210400_106074381 | 3300021170 | Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDTSQASVQAAHAS |
| Ga0213872_100640322 | 3300021361 | Rhizosphere | MRLIARFVVLLAAVFGVSLAFAWAWDHSDTSAPTHAQGS |
| Ga0213872_100740752 | 3300021361 | Rhizosphere | RVGVPALTMRLIARFVVLMAAVFGVSLAFAWAWDHSDTPTPTHTQGS |
| Ga0210397_100463822 | 3300021403 | Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDTSQDAAAARAAS |
| Ga0210397_102738362 | 3300021403 | Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTVAAHASS |
| Ga0210387_105309302 | 3300021405 | Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAAHAAN |
| Ga0210392_107146241 | 3300021475 | Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTAAHA |
| Ga0213853_105692732 | 3300021861 | Watersheds | VLMVAVFGVSLAFAWAWDKSDKPRDAAAAVTPQQSS |
| Ga0212090_104798242 | 3300022561 | Glacier Valley | MRLIARFVFLMVAVFGVSLAFAWAWDKSDKSQDTTAAHAS |
| Ga0247779_10050433 | 3300022908 | Plant Litter | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTAAAHAAS |
| Ga0207427_1004223 | 3300025231 | Arabidopsis Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATTTAHAAT |
| Ga0209677_1038333 | 3300025253 | Arabidopsis Root | MRLIARFVVLMVAVFGVSLAFAWAWDKSDTPQDTATTHAPAHT |
| Ga0209759_100092513 | 3300025256 | Arabidopsis Root | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQETSARADS |
| Ga0209759_10123552 | 3300025256 | Arabidopsis Root | MRLIARFVFLMVAVFGVSLAFAWAWDKSDKPHDDATVRAAA |
| Ga0209759_10306762 | 3300025256 | Arabidopsis Root | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDPAAAHAAT |
| Ga0209051_10018443 | 3300025303 | Arabidopsis Root | MRLIARFVVLMVAVFGVSLAFAWAWDRSDTPPATTPVRGS |
| Ga0209051_10168352 | 3300025303 | Arabidopsis Root | MRLIARFVVLMVAVFGLSIAFAWAWDRSDAPKTAQHA |
| Ga0207642_101506142 | 3300025899 | Miscanthus Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAS |
| Ga0207705_100724782 | 3300025909 | Corn Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQQDTSARADS |
| Ga0207705_100808292 | 3300025909 | Corn Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDAPQDTATAPAPAHI |
| Ga0207705_108747912 | 3300025909 | Corn Rhizosphere | IARFVVLMVAVFGVSLAFAWAWDKSDTPQDTATTHAPAHT |
| Ga0207695_111771331 | 3300025913 | Corn Rhizosphere | RLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAP |
| Ga0207649_105989102 | 3300025920 | Corn Rhizosphere | MRLIARFVVLMVAVFGLSVAFAWAWDRSDAPKTAHQE |
| Ga0207659_105024151 | 3300025926 | Miscanthus Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQR |
| Ga0207644_118645411 | 3300025931 | Switchgrass Rhizosphere | MRLIARFVVLMVAVFGLSVAFAWAWDRSDAPKTTHDA |
| Ga0207690_102831552 | 3300025932 | Corn Rhizosphere | RFVVLMVAVFGVSLAFAWAWDKSDKPQDNTSARADS |
| Ga0207709_100092952 | 3300025935 | Miscanthus Rhizosphere | MRLIARFVFLMVAVFGVSLAFAWAWDRSDTPRPTTPVHGS |
| Ga0207669_113651181 | 3300025937 | Miscanthus Rhizosphere | DLRSNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDPAAAHAAT |
| Ga0207667_1001001012 | 3300025949 | Corn Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAAAQRAAS |
| Ga0207667_101994172 | 3300025949 | Corn Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQQDTHARADS |
| Ga0207667_104468012 | 3300025949 | Corn Rhizosphere | CSSNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAP |
| Ga0207651_100068962 | 3300025960 | Switchgrass Rhizosphere | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTTARADS |
| Ga0207712_118060232 | 3300025961 | Switchgrass Rhizosphere | MRLIVRFVVLMVAVFGVSLAFAWAWDHSDAQKATTTTTTHAG |
| Ga0268264_119265872 | 3300028381 | Switchgrass Rhizosphere | DRRACSSNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAS |
| Ga0302151_1000007834 | 3300028562 | Bog | MRLLARFVFLMVAVFGVSLAFAWAWDNSDTQQDASVHAPA |
| Ga0302151_100115622 | 3300028562 | Bog | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDATTAHAS |
| Ga0302262_101159392 | 3300028743 | Fen | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPRDAVALHTS |
| Ga0302202_104345562 | 3300028762 | Bog | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDATTAH |
| Ga0302279_103565201 | 3300028783 | Bog | LARFVFLMVAVFGVSLAFAWAWDNSDTQQDASVHAPA |
| Ga0265338_111038782 | 3300028800 | Rhizosphere | MRLLARFVFLMVAVFGVSLAFAWAWDKSDTPQDTVAAHAAN |
| Ga0302263_103151952 | 3300028869 | Fen | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTVAAHAAT |
| Ga0302254_102387842 | 3300028870 | Fen | MRLLARFLVLLVAVFGVSLAFAWAWDKSDRSQPVAQVRAA |
| Ga0302235_100541832 | 3300028877 | Palsa | MRLLARFVFLMVAVFGVSLAFAWAWDKSDTPQDDAVHTAN |
| Ga0302235_104450752 | 3300028877 | Palsa | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAATVHAS |
| Ga0311327_100152217 | 3300029883 | Bog | MRLLARFVFLMVAVFGVRLAFAWAWDNSDTQQDASVHAPA |
| Ga0311326_100875662 | 3300029917 | Bog | MLLLARFVFLMVAVFGVSLAFAWAWDNSDTQQDASVHAPA |
| Ga0311330_102972192 | 3300029945 | Bog | MRLIARFVFLMVAVFGVSLAFAWAWDKSDKPRDASVHANTAT |
| Ga0311330_105704302 | 3300029945 | Bog | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDATAAHAS |
| Ga0311371_100075954 | 3300029951 | Palsa | MRLIARFVVLMVAVFGVSLAFAWAWDKSDTSQDAATARAAS |
| Ga0311371_120138602 | 3300029951 | Palsa | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAVHASN |
| Ga0311334_111041242 | 3300029987 | Fen | MRLIARFVVLMVAVFGVSLAFAWAWDKYDTAQATVAAHT |
| Ga0311365_117559451 | 3300029989 | Fen | MRLIARFVFLMVAVFGVSLAFAWAWDKSDNQHDTVAAQAHTPA |
| Ga0311344_100598541 | 3300030020 | Bog | PHWPPDLQLTMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDATTAHAS |
| Ga0311349_101310543 | 3300030294 | Fen | MRLIARFVVLMVAVFGVSLAFAWAWDKSDTAQATVAAHTPT |
| Ga0311372_114821772 | 3300030520 | Palsa | MRLIARFVVLMVAVFGVSLAFAWAWDKSDTPQDAAAVRAAS |
| Ga0311357_102375202 | 3300030524 | Palsa | LQLTMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAATVHAS |
| Ga0311356_102706272 | 3300030617 | Palsa | MRLIARFVVLMVAVFGVSLAFAWSWDKSDKPQDATTAHAS |
| Ga0302317_101884251 | 3300030677 | Palsa | RDLQLTMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDATTAHAS |
| Ga0302308_102220401 | 3300031027 | Palsa | LQLTMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDATTAHAS |
| Ga0302323_1020957812 | 3300031232 | Fen | MRLIARFVVLMVAVFGVSLAFAWAWDRSDSPSATQVHGS |
| Ga0307509_101921191 | 3300031507 | Ectomycorrhiza | MRLFARFVVLMVAVFGVSLAFAWAWDRSDTRPATTPVHGS |
| Ga0318516_101156282 | 3300031543 | Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQNAPTTAAS |
| Ga0307508_103730322 | 3300031616 | Ectomycorrhiza | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPRDAAAAHAAS |
| Ga0307516_100048422 | 3300031730 | Ectomycorrhiza | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAAVHAAT |
| Ga0307516_106895542 | 3300031730 | Ectomycorrhiza | MRLIARFVFLMVAVFGVSLAFAWAWDKSDKPQDTVAAHAAT |
| Ga0318554_101013413 | 3300031765 | Soil | WSQDLQSNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQNAPTTAAS |
| Ga0318547_110125121 | 3300031781 | Soil | MRLIARFVVLMVAVFGLSVAFAWAWDRSDAPKTTTHNA |
| Ga0318520_105475801 | 3300031897 | Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAERAAS |
| Ga0302322_1017955552 | 3300031902 | Fen | LSRDLQPTMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPRDAVALHTS |
| Ga0311367_101807142 | 3300031918 | Fen | MRQLARFAILIVAVCGVSLAFAWAWDRSEAPAAAVAPR |
| Ga0308174_105093692 | 3300031939 | Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDGASVHAAS |
| Ga0308174_116213952 | 3300031939 | Soil | MRLIVRFVVLMVAVFGLSVAFAWAWDRSDAPKTTHDA |
| Ga0308176_118489391 | 3300031996 | Soil | MRLIARFVVLMVAVFGVSLAFAWAWDRSDTPPTTQVHGT |
| Ga0308173_116288061 | 3300032074 | Soil | MRLIVRFVVLMVAVFGLSVAFAWAWDRSDAPKTTHEA |
| Ga0308173_118038012 | 3300032074 | Soil | MPARDLLPNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAPNPAHTAS |
| Ga0370487_0000097_16166_16300 | 3300034170 | Untreated Peat Soil | LQLNMRLIARFVVLMIAVFGVSLAFAWAWDKSDKPRDAAAVHAS |
| Ga0370487_0032642_75_197 | 3300034170 | Untreated Peat Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAAVHAS |
| Ga0370487_0212087_139_264 | 3300034170 | Untreated Peat Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQASAAAHAAS |
| Ga0370481_0118297_497_622 | 3300034281 | Untreated Peat Soil | MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQATAAAHAAS |
| Ga0370545_056811_70_192 | 3300034643 | Soil | MRLIARFVVLMVAVFGVSLAFAWAWDRSDNRPAAAQVRGS |
| ⦗Top⦘ |