Metagenome / Metatranscriptome Family F044538

Basic Information
Family ID	F044538
Family Type	Metagenome / Metatranscriptome
Number of Sequences	154
Average Sequence Length	41 residues
Representative Sequence	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAAAHAS
Number of Associated Samples	111
Number of Associated Scaffolds	154

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	58.44 %
% of genes near scaffold ends (potentially truncated)	25.97 %
% of genes from short scaffolds (< 2000 bps)	69.48 %
Associated GOLD sequencing projects	99
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Most Common Taxonomy
Group	Bacteria (70.130 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (9.740 % of family members)
Environment Ontology (ENVO)	Unclassified (34.416 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (50.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 154 Family Scaffolds
PF02547	Queuosine_synth	54.55
PF17191	RecG_wedge	13.64
PF03466	LysR_substrate	7.79
PF00691	OmpA	1.95
PF00270	DEAD	1.30
PF01702	TGT	1.30
PF13663	DUF4148	1.30
PF01336	tRNA_anti-codon	1.30
PF00126	HTH_1	0.65
PF07690	MFS_1	0.65
PF13932	GIDA_C	0.65
PF09286	Pro-kuma_activ	0.65
PF00990	GGDEF	0.65
PF00005	ABC_tran	0.65
PF00271	Helicase_C	0.65
PF02527	GidB	0.65
PF09916	DUF2145	0.65
PF04542	Sigma70_r2	0.65
PF13730	HTH_36	0.65

COG ID	Name	Functional Category	% Frequency in 154 Family Scaffolds
COG0809	S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase)	Translation, ribosomal structure and biogenesis [J]	54.55
COG0343	Queuine/archaeosine tRNA-ribosyltransferase	Translation, ribosomal structure and biogenesis [J]	1.30
COG1549	Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domains	Translation, ribosomal structure and biogenesis [J]	1.30
COG0357	16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B)	Translation, ribosomal structure and biogenesis [J]	0.65
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.65
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.65
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.65
COG4934	Serine protease, subtilase family	Posttranslational modification, protein turnover, chaperones [O]	0.65
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.65

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	70.78 %
Unclassified	root	N/A	29.22 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	70.78 %
Unclassified	root	N/A	29.22 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	70.13 %
Unclassified	root	N/A	29.22 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.65 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	69.48 %
Unclassified	root	N/A	29.22 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	55.19 %
Unclassified	root	N/A	29.22 %
Fungi	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	0.65 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.65 %

Name	Rank	Taxonomy	Distribution
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	53.90 %
Unclassified	root	N/A	29.22 %
Dikarya	subkingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	0.65 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.22 %
Burkholderiales genera incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis	4.55 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4.55 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.65 %
Ascomycota	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota	0.65 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.22 %
Rhizobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter	1.30 %
Methylibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	1.95 %
saccharomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta	0.65 %
Verminephrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Verminephrobacter	0.65 %
Ideonella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella	0.65 %
Rubrivivax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax	0.65 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.65 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.22 %
Rhizobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter	1.30 %
Methylibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	1.95 %
unclassified Ideonella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella	0.65 %
unclassified Verminephrobacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Verminephrobacter → unclassified Verminephrobacter	0.65 %
unclassified Pseudomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas	0.65 %
Pezizomycotina	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	0.65 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.65 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.22 %
Rhizobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter	1.30 %
Methylibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	1.95 %
leotiomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta	0.65 %
Ideonella sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp.	0.65 %
Verminephrobacter sp. Larva24	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Verminephrobacter → unclassified Verminephrobacter → Verminephrobacter sp. Larva24	0.65 %
Pseudomonas sp. OF001	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001	0.65 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.65 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.22 %
Rhizobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter	1.30 %
Methylibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	1.95 %
Eurotiomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes	0.65 %
Ideonella sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp.	0.65 %
Verminephrobacter sp. Larva24	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Verminephrobacter → unclassified Verminephrobacter → Verminephrobacter sp. Larva24	0.65 %
Pseudomonas sp. OF001	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001	0.65 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.65 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.22 %
Rhizobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter	1.30 %
Methylibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	1.95 %
Eurotiomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae	0.65 %
Ideonella sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp.	0.65 %
Verminephrobacter sp. Larva24	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Verminephrobacter → unclassified Verminephrobacter → Verminephrobacter sp. Larva24	0.65 %
Pseudomonas sp. OF001	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001	0.65 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.65 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.22 %
Rhizobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter	1.30 %
Methylibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	1.95 %
Eurotiales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae → Eurotiales	0.65 %
Ideonella sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp.	0.65 %
Verminephrobacter sp. Larva24	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Verminephrobacter → unclassified Verminephrobacter → Verminephrobacter sp. Larva24	0.65 %
Pseudomonas sp. OF001	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001	0.65 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.65 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.22 %
Rhizobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter	1.30 %
Methylibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	1.95 %
Aspergillaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae → Eurotiales → Aspergillaceae	0.65 %
Ideonella sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp.	0.65 %
Verminephrobacter sp. Larva24	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Verminephrobacter → unclassified Verminephrobacter → Verminephrobacter sp. Larva24	0.65 %
Pseudomonas sp. OF001	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001	0.65 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.65 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.22 %
Rhizobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter	1.30 %
Methylibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	1.95 %
Aspergillus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae → Eurotiales → Aspergillaceae → Aspergillus	0.65 %
Ideonella sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp.	0.65 %
Verminephrobacter sp. Larva24	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Verminephrobacter → unclassified Verminephrobacter → Verminephrobacter sp. Larva24	0.65 %
Pseudomonas sp. OF001	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001	0.65 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.65 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.22 %
Rhizobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter	1.30 %
Methylibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	1.95 %
Aspergillus subgen. Fumigati	subgenus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae → Eurotiales → Aspergillaceae → Aspergillus → Aspergillus subgen. Fumigati	0.65 %
Ideonella sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp.	0.65 %
Verminephrobacter sp. Larva24	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Verminephrobacter → unclassified Verminephrobacter → Verminephrobacter sp. Larva24	0.65 %
Pseudomonas sp. OF001	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001	0.65 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.65 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.22 %
Rhizobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter	1.30 %
Methylibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	1.95 %
Aspergillus fumigatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae → Eurotiales → Aspergillaceae → Aspergillus → Aspergillus subgen. Fumigati → Aspergillus fumigatus	0.65 %
Ideonella sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp.	0.65 %
Verminephrobacter sp. Larva24	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Verminephrobacter → unclassified Verminephrobacter → Verminephrobacter sp. Larva24	0.65 %
Pseudomonas sp. OF001	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001	0.65 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.65 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.65 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002705\|JGI25156J39149_1000173	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	47258	Open in IMG/M
3300002705\|JGI25156J39149_1024228	Not Available	995	Open in IMG/M
3300003316\|rootH1_10043954	Not Available	1285	Open in IMG/M
3300003316\|rootH1_10043955	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1527	Open in IMG/M
3300003320\|rootH2_10083522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4697	Open in IMG/M
3300003322\|rootL2_10073555	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1152	Open in IMG/M
3300003752\|Ga0055539_1000389	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	17745	Open in IMG/M
3300003752\|Ga0055539_1014771	Not Available	951	Open in IMG/M
3300003792\|Ga0055540_1011122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2934	Open in IMG/M
3300005327\|Ga0070658_10063423	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3012	Open in IMG/M
3300005327\|Ga0070658_10067629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2919	Open in IMG/M
3300005327\|Ga0070658_10136176	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2049	Open in IMG/M
3300005327\|Ga0070658_10199370	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	1688	Open in IMG/M
3300005327\|Ga0070658_10772432	Not Available	834	Open in IMG/M
3300005330\|Ga0070690_100011136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	5253	Open in IMG/M
3300005335\|Ga0070666_11102188	Not Available	590	Open in IMG/M
3300005339\|Ga0070660_100028271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4193	Open in IMG/M
3300005339\|Ga0070660_100096705	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	2335	Open in IMG/M
3300005339\|Ga0070660_101444461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	584	Open in IMG/M
3300005354\|Ga0070675_100446165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1160	Open in IMG/M
3300005364\|Ga0070673_100013867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5594	Open in IMG/M
3300005366\|Ga0070659_101058972	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	714	Open in IMG/M
3300005366\|Ga0070659_101649926	All Organisms → cellular organisms → Bacteria → Proteobacteria	573	Open in IMG/M
3300005367\|Ga0070667_101370163	All Organisms → cellular organisms → Bacteria → Proteobacteria	663	Open in IMG/M
3300005513\|Ga0077120_1024184	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4459	Open in IMG/M
3300005513\|Ga0077120_1030519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3688	Open in IMG/M
3300005515\|Ga0077122_10015725	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	10411	Open in IMG/M
3300005519\|Ga0077119_10003651	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	18762	Open in IMG/M
3300005519\|Ga0077119_10005315	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	14847	Open in IMG/M
3300005519\|Ga0077119_10046701	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3039	Open in IMG/M
3300005519\|Ga0077119_10103037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1553	Open in IMG/M
3300005519\|Ga0077119_10118496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp.	1379	Open in IMG/M
3300005519\|Ga0077119_10139860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1195	Open in IMG/M
3300005535\|Ga0070684_101650246	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	605	Open in IMG/M
3300005563\|Ga0068855_100030543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	6443	Open in IMG/M
3300005563\|Ga0068855_100362507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1595	Open in IMG/M
3300005563\|Ga0068855_102328932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	536	Open in IMG/M
3300005614\|Ga0068856_100548889	Not Available	1177	Open in IMG/M
3300005616\|Ga0068852_100566506	Not Available	1137	Open in IMG/M
3300005644\|Ga0075036_1666882	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	525	Open in IMG/M
3300005834\|Ga0068851_10329378	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	884	Open in IMG/M
3300006353\|Ga0075370_10000121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	25670	Open in IMG/M
3300009093\|Ga0105240_10742378	Not Available	1068	Open in IMG/M
3300009093\|Ga0105240_12054045	All Organisms → cellular organisms → Bacteria → Proteobacteria	593	Open in IMG/M
3300009148\|Ga0105243_10018257	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5311	Open in IMG/M
3300009500\|Ga0116229_11054454	All Organisms → cellular organisms → Bacteria → Proteobacteria	652	Open in IMG/M
3300009545\|Ga0105237_11074068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	812	Open in IMG/M
3300009551\|Ga0105238_12973012	Not Available	509	Open in IMG/M
3300009553\|Ga0105249_10759519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1032	Open in IMG/M
3300009553\|Ga0105249_13199992	Not Available	526	Open in IMG/M
3300009650\|Ga0105857_1142408	All Organisms → cellular organisms → Bacteria → Proteobacteria	667	Open in IMG/M
3300009662\|Ga0105856_1347076	All Organisms → cellular organisms → Bacteria → Proteobacteria	508	Open in IMG/M
3300009709\|Ga0116227_10067922	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3063	Open in IMG/M
3300009709\|Ga0116227_10191856	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1591	Open in IMG/M
3300009709\|Ga0116227_10256048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1346	Open in IMG/M
3300009787\|Ga0116226_10157950	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	2359	Open in IMG/M
3300009787\|Ga0116226_10630578	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae → Eurotiales → Aspergillaceae → Aspergillus → Aspergillus subgen. Fumigati → Aspergillus fumigatus	1070	Open in IMG/M
3300010154\|Ga0127503_10044161	All Organisms → cellular organisms → Bacteria	560	Open in IMG/M
3300010331\|Ga0123336_10395509	Not Available	706	Open in IMG/M
3300010375\|Ga0105239_10160751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2509	Open in IMG/M
3300010375\|Ga0105239_12015896	Not Available	670	Open in IMG/M
3300010877\|Ga0126356_10542864	Not Available	675	Open in IMG/M
3300011119\|Ga0105246_10020462	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter	4244	Open in IMG/M
3300013006\|Ga0164294_10461840	Not Available	866	Open in IMG/M
3300013296\|Ga0157374_12558363	Not Available	538	Open in IMG/M
3300013297\|Ga0157378_13291367	All Organisms → cellular organisms → Bacteria → Proteobacteria	502	Open in IMG/M
3300013308\|Ga0157375_10781989	Not Available	1104	Open in IMG/M
3300014168\|Ga0181534_10849108	All Organisms → cellular organisms → Bacteria → Proteobacteria	543	Open in IMG/M
3300014168\|Ga0181534_10952399	All Organisms → cellular organisms → Bacteria → Proteobacteria	516	Open in IMG/M
3300014325\|Ga0163163_11193437	Not Available	824	Open in IMG/M
3300015024\|Ga0167669_1112760	Not Available	825	Open in IMG/M
3300017792\|Ga0163161_11291040	Not Available	634	Open in IMG/M
3300018037\|Ga0187883_10277933	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	856	Open in IMG/M
3300020580\|Ga0210403_11293936	All Organisms → cellular organisms → Bacteria → Proteobacteria	557	Open in IMG/M
3300021170\|Ga0210400_10607438	Not Available	902	Open in IMG/M
3300021361\|Ga0213872_10064032	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1661	Open in IMG/M
3300021361\|Ga0213872_10074075	Not Available	1533	Open in IMG/M
3300021403\|Ga0210397_10046382	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2771	Open in IMG/M
3300021403\|Ga0210397_10273836	Not Available	1232	Open in IMG/M
3300021405\|Ga0210387_10530930	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1046	Open in IMG/M
3300021475\|Ga0210392_10714624	Not Available	746	Open in IMG/M
3300021861\|Ga0213853_10569273	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	539	Open in IMG/M
3300022561\|Ga0212090_10479824	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	863	Open in IMG/M
3300022908\|Ga0247779_1005043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5033	Open in IMG/M
3300025231\|Ga0207427_100422	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	24068	Open in IMG/M
3300025253\|Ga0209677_103833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4639	Open in IMG/M
3300025256\|Ga0209759_1000925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	21323	Open in IMG/M
3300025256\|Ga0209759_1012355	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2370	Open in IMG/M
3300025256\|Ga0209759_1030676	Not Available	1058	Open in IMG/M
3300025303\|Ga0209051_1001844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	16718	Open in IMG/M
3300025303\|Ga0209051_1016835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3285	Open in IMG/M
3300025899\|Ga0207642_10150614	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1238	Open in IMG/M
3300025909\|Ga0207705_10072478	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2498	Open in IMG/M
3300025909\|Ga0207705_10080829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2369	Open in IMG/M
3300025909\|Ga0207705_10874791	Not Available	696	Open in IMG/M
3300025913\|Ga0207695_11177133	All Organisms → cellular organisms → Bacteria → Proteobacteria	647	Open in IMG/M
3300025920\|Ga0207649_10598910	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	847	Open in IMG/M
3300025926\|Ga0207659_10502415	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1027	Open in IMG/M
3300025931\|Ga0207644_11864541	Not Available	503	Open in IMG/M
3300025932\|Ga0207690_10283155	Not Available	1292	Open in IMG/M
3300025935\|Ga0207709_10009295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5413	Open in IMG/M
3300025937\|Ga0207669_11365118	All Organisms → cellular organisms → Bacteria → Proteobacteria	603	Open in IMG/M
3300025949\|Ga0207667_10010010	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	11120	Open in IMG/M
3300025949\|Ga0207667_10199417	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2053	Open in IMG/M
3300025949\|Ga0207667_10446801	Not Available	1314	Open in IMG/M
3300025960\|Ga0207651_10006896	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5999	Open in IMG/M
3300025961\|Ga0207712_11806023	All Organisms → cellular organisms → Bacteria → Proteobacteria	548	Open in IMG/M
3300028381\|Ga0268264_11926587	All Organisms → cellular organisms → Bacteria → Proteobacteria	600	Open in IMG/M
3300028562\|Ga0302151_10000078	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	56184	Open in IMG/M
3300028562\|Ga0302151_10011562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	3364	Open in IMG/M
3300028743\|Ga0302262_10115939	All Organisms → cellular organisms → Bacteria → Proteobacteria	919	Open in IMG/M
3300028762\|Ga0302202_10434556	Not Available	603	Open in IMG/M
3300028783\|Ga0302279_10356520	All Organisms → cellular organisms → Bacteria → Proteobacteria	625	Open in IMG/M
3300028800\|Ga0265338_11103878	All Organisms → cellular organisms → Bacteria → Proteobacteria	534	Open in IMG/M
3300028869\|Ga0302263_10315195	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	620	Open in IMG/M
3300028870\|Ga0302254_10238784	Not Available	669	Open in IMG/M
3300028877\|Ga0302235_10054183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1920	Open in IMG/M
3300028877\|Ga0302235_10445075	All Organisms → cellular organisms → Bacteria → Proteobacteria	552	Open in IMG/M
3300029883\|Ga0311327_10015221	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	6619	Open in IMG/M
3300029917\|Ga0311326_10087566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1741	Open in IMG/M
3300029945\|Ga0311330_10297219	Not Available	1395	Open in IMG/M
3300029945\|Ga0311330_10570430	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	896	Open in IMG/M
3300029951\|Ga0311371_10007595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	21884	Open in IMG/M
3300029951\|Ga0311371_12013860	All Organisms → cellular organisms → Bacteria → Proteobacteria	612	Open in IMG/M
3300029987\|Ga0311334_11104124	Not Available	663	Open in IMG/M
3300029989\|Ga0311365_11755945	Not Available	531	Open in IMG/M
3300030020\|Ga0311344_10059854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4633	Open in IMG/M
3300030294\|Ga0311349_10131054	Not Available	2346	Open in IMG/M
3300030520\|Ga0311372_11482177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	838	Open in IMG/M
3300030524\|Ga0311357_10237520	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1768	Open in IMG/M
3300030617\|Ga0311356_10270627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	1711	Open in IMG/M
3300030677\|Ga0302317_10188425	Not Available	951	Open in IMG/M
3300031027\|Ga0302308_10222040	Not Available	1200	Open in IMG/M
3300031232\|Ga0302323_102095781	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	643	Open in IMG/M
3300031507\|Ga0307509_10192119	Not Available	1891	Open in IMG/M
3300031543\|Ga0318516_10115628	Not Available	1526	Open in IMG/M
3300031616\|Ga0307508_10373032	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1018	Open in IMG/M
3300031730\|Ga0307516_10004842	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	16393	Open in IMG/M
3300031730\|Ga0307516_10689554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	678	Open in IMG/M
3300031765\|Ga0318554_10101341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1618	Open in IMG/M
3300031781\|Ga0318547_11012512	All Organisms → cellular organisms → Bacteria → Proteobacteria	519	Open in IMG/M
3300031897\|Ga0318520_10547580	Not Available	717	Open in IMG/M
3300031902\|Ga0302322_101795555	Not Available	751	Open in IMG/M
3300031918\|Ga0311367_10180714	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Verminephrobacter → unclassified Verminephrobacter → Verminephrobacter sp. Larva24	2213	Open in IMG/M
3300031939\|Ga0308174_10509369	Not Available	986	Open in IMG/M
3300031939\|Ga0308174_11621395	Not Available	556	Open in IMG/M
3300031996\|Ga0308176_11848939	All Organisms → cellular organisms → Bacteria → Proteobacteria	645	Open in IMG/M
3300032074\|Ga0308173_11628806	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	608	Open in IMG/M
3300032074\|Ga0308173_11803801	Not Available	576	Open in IMG/M
3300034170\|Ga0370487_0000097	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	31616	Open in IMG/M
3300034170\|Ga0370487_0032642	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter	1564	Open in IMG/M
3300034170\|Ga0370487_0212087	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001	644	Open in IMG/M
3300034281\|Ga0370481_0118297	Not Available	901	Open in IMG/M
3300034643\|Ga0370545_056811	Not Available	774	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	59.09%
Environmental	Environmental	40.91%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	59.09%
Terrestrial	Environmental → Terrestrial	35.71%
Aquatic	Environmental → Aquatic	5.19%

Habitat	Taxonomy	Distribution
Rhizosphere	Host-Associated → Plants → Rhizosphere	27.27%
Soil	Environmental → Terrestrial → Soil	17.53%
Peat	Environmental → Terrestrial → Peat	17.53%
Roots	Host-Associated → Plants → Roots	15.58%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.74%
Freshwater	Environmental → Aquatic → Freshwater	5.19%
Peat Moss	Host-Associated → Plants → Peat Moss	3.90%
Rhizome	Host-Associated → Plants → Rhizome	2.60%
Plant Litter	Environmental → Terrestrial → Plant Litter	0.65%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Peat → Unclassified	17.53%
Soil	Host-Associated → Plants → Rhizosphere → Soil	15.58%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	11.69%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.69%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.74%
Epiphytes	Host-Associated → Plants → Roots → Epiphytes	7.14%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.55%
Endophytes	Host-Associated → Plants → Roots → Endophytes	4.55%
Unclassified	Host-Associated → Plants → Peat Moss → Unclassified	3.90%
Unclassified	Host-Associated → Plants → Roots → Unclassified	2.60%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified	2.60%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.95%
Ice	Environmental → Aquatic → Freshwater → Ice	1.30%
Loam	Environmental → Terrestrial → Soil → Loam	1.30%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.65%
Lake	Environmental → Aquatic → Freshwater → Lake	0.65%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.65%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	0.65%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.65%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.65%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	17.53%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	15.58%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.69%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.74%
Unclassified	Host-Associated → Plants → Roots → Epiphytes → Unclassified	7.14%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	6.49%
Unclassified	Host-Associated → Plants → Roots → Endophytes → Unclassified	4.55%
Unclassified	Host-Associated → Plants → Peat Moss → Unclassified → Unclassified	3.90%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.25%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.60%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	2.60%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified → Unclassified	2.60%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.95%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.95%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.95%
Glacier	Environmental → Aquatic → Freshwater → Ice → Glacier	1.30%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.30%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.65%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.65%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.65%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	0.65%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.65%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.65%

Habitat	Taxonomy	Distribution
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	9.74%
Arabidopsis Root	Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root	7.14%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.49%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	5.84%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	5.84%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	5.84%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.84%
Arabidopsis Root	Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root	4.55%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.55%
Host-Associated	Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated	3.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.25%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.25%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	2.60%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	2.60%
Sugarcane Root And Bulk Soil	Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil	2.60%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	1.95%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	1.95%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.95%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.95%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.95%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.95%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	1.30%
Glacier Valley	Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley	1.30%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.30%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.65%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.65%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.65%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.65%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.65%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.65%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.65%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.65%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.65%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.65%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.65%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Host-Associated	Open in IMG/M
3300003316	Sugarcane root Sample L1	Host-Associated	Open in IMG/M
3300003320	Sugarcane root Sample H2	Host-Associated	Open in IMG/M
3300003322	Sugarcane root Sample L2	Host-Associated	Open in IMG/M
3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Host-Associated	Open in IMG/M
3300003792	Arabidopsis rhizosphere microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Host-Associated	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005513	Combined assembly of arab plate scrape CL_Cvi (Combined Assembly)	Host-Associated	Open in IMG/M
3300005515	Combined assembly of arab plate scrape MF_Cvi (Combined Assembly)	Host-Associated	Open in IMG/M
3300005519	Combined assembly of arab plate scrape CL_Col (Combined Assembly)	Host-Associated	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005644	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_053 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300006353	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Host-Associated	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009500	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009650	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061	Environmental	Open in IMG/M
3300009662	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060	Environmental	Open in IMG/M
3300009709	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG	Host-Associated	Open in IMG/M
3300009787	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG	Host-Associated	Open in IMG/M
3300010154	Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010331	Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - ?SSSS metaG	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010877	Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014168	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015024	Arctic sediment microbial communities from supraglacial cryoconite, Rabots glacier, Tarfala, Sweden (Sample Rb cryoconite)	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018037	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Host-Associated	Open in IMG/M
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021861	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022561	Borup_combined assembly	Environmental	Open in IMG/M
3300022908	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5	Environmental	Open in IMG/M
3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes)	Host-Associated	Open in IMG/M
3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes)	Host-Associated	Open in IMG/M
3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes)	Host-Associated	Open in IMG/M
3300025303	Arabidopsis rhizosphere microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes)	Host-Associated	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028562	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3	Environmental	Open in IMG/M
3300028743	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4	Environmental	Open in IMG/M
3300028762	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3	Environmental	Open in IMG/M
3300028783	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3	Environmental	Open in IMG/M
3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Host-Associated	Open in IMG/M
3300028869	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4	Environmental	Open in IMG/M
3300028870	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4	Environmental	Open in IMG/M
3300028877	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3	Environmental	Open in IMG/M
3300029883	I_Bog_E2 coassembly	Environmental	Open in IMG/M
3300029917	I_Bog_E1 coassembly	Environmental	Open in IMG/M
3300029945	I_Bog_N2 coassembly	Environmental	Open in IMG/M
3300029951	III_Palsa_N1 coassembly	Environmental	Open in IMG/M
3300029987	I_Fen_E3 coassembly	Environmental	Open in IMG/M
3300029989	III_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030020	II_Bog_N1 coassembly	Environmental	Open in IMG/M
3300030294	II_Fen_E3 coassembly	Environmental	Open in IMG/M
3300030520	III_Palsa_N2 coassembly	Environmental	Open in IMG/M
3300030524	II_Palsa_N3 coassembly	Environmental	Open in IMG/M
3300030617	II_Palsa_N2 coassembly	Environmental	Open in IMG/M
3300030677	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3	Environmental	Open in IMG/M
3300031027	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated	Open in IMG/M
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated	Open in IMG/M
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental	Open in IMG/M
3300031781	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20	Environmental	Open in IMG/M
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300031918	III_Fen_N3 coassembly	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300034170	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16	Environmental	Open in IMG/M
3300034281	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15	Environmental	Open in IMG/M
3300034643	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F044538

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI25156J39149_100017341	3300002705	Arabidopsis Root	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAP*
JGI25156J39149_10242282	3300002705	Arabidopsis Root	DQQLNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQETSARADS*
rootH1_100439542	3300003316	Sugarcane Root And Bulk Soil	MRLIARFVVLMVAVFGVSLAFAWAWDRSDAPPAAEAHGS*
rootH1_100439552	3300003316	Sugarcane Root And Bulk Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAAAQRTAS*
rootH2_100835225	3300003320	Sugarcane Root And Bulk Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAAAHAAP*
rootL2_100735552	3300003322	Sugarcane Root And Bulk Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAAAQRAAT*
Ga0055539_100038920	3300003752	Arabidopsis Root	RLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAAAQRAAS*
Ga0055539_10147712	3300003752	Arabidopsis Root	RLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAP*
Ga0055540_10111222	3300003792	Arabidopsis Root	MRLIARFVVLMVAVFGVSLAFAWAWDRSDTPPATTPVRGS*
Ga0070658_100634233	3300005327	Corn Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDAPQDTATAPAPAHI*
Ga0070658_100676293	3300005327	Corn Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQQDTSARADS*
Ga0070658_101361762	3300005327	Corn Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQETSARADS*
Ga0070658_101993701	3300005327	Corn Rhizosphere	SNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAS*
Ga0070658_107724322	3300005327	Corn Rhizosphere	SNMRLIARFVVLMVAVFGVSLAFAWAWDKSDTPQDTATTHAPAHT*
Ga0070690_1000111364	3300005330	Switchgrass Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAS*
Ga0070666_111021881	3300005335	Switchgrass Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPYDATAQRAAS*
Ga0070660_1000282712	3300005339	Corn Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDNTSARADS*
Ga0070660_1000967051	3300005339	Corn Rhizosphere	LQSNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAP*
Ga0070660_1014444611	3300005339	Corn Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQETSTRADS*
Ga0070675_1004461652	3300005354	Miscanthus Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRVAS*
Ga0070673_1000138676	3300005364	Switchgrass Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTTARADS*
Ga0070659_1010589722	3300005366	Corn Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDTPQDTATAPAPAHI*
Ga0070659_1016499261	3300005366	Corn Rhizosphere	MRLIVRFVVLMVAVFGVSLAFAWAWDRSDTPPAAQVHGT*
Ga0070667_1013701632	3300005367	Switchgrass Rhizosphere	MRLIVRFVVLMVAVFGVSLAFAWAWDHSDAQKATTTTTTHAE*
Ga0077120_10241842	3300005513	Arabidopsis Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDTPQDTATTHAPAHT*
Ga0077120_10305192	3300005513	Arabidopsis Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATTTAHAAT*
Ga0077122_100157253	3300005515	Arabidopsis Root	MRLIARFVVLMVAVFGLSIAFAWAWDRSDAPKTAQHA*
Ga0077119_1000365120	3300005519	Arabidopsis Root	MRLIARFVFLMVAVFGVSLAFAWAWDKSDKPHDDATVRAAA*
Ga0077119_100053151	3300005519	Arabidopsis Root	ARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAP*
Ga0077119_100467015	3300005519	Arabidopsis Root	QDQQLNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTTARADS*
Ga0077119_101030372	3300005519	Arabidopsis Root	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDPAAAHAAT*
Ga0077119_101184962	3300005519	Arabidopsis Root	MRLIARFVFLMVAVFGVSLAFAWAWDKSDTPRDANAHATPKA*
Ga0077119_101398602	3300005519	Arabidopsis Root	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQQDTNARADS*
Ga0070684_1016502462	3300005535	Corn Rhizosphere	NMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQETSTRADS*
Ga0068855_1000305434	3300005563	Corn Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAAAQRAAS*
Ga0068855_1003625072	3300005563	Corn Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQQDTHARADS*
Ga0068855_1023289321	3300005563	Corn Rhizosphere	NMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDNTSARADS*
Ga0068856_1005488892	3300005614	Corn Rhizosphere	LIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAAAQRAAS*
Ga0068852_1005665062	3300005616	Corn Rhizosphere	LQSNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAAAQRAAS*
Ga0075036_16668822	3300005644	Permafrost Soil	DLQLTMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAAAHAS*
Ga0068851_103293781	3300005834	Corn Rhizosphere	MRLIVRFLVLMVAVFGLSVAFAWAWDRSDAPRTAHTAA
Ga0075370_1000012125	3300006353	Populus Endosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDDAAVRAAS*
Ga0105240_107423781	3300009093	Corn Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTSARADS*
Ga0105240_120540451	3300009093	Corn Rhizosphere	MRLIARFVVLMVAVFGLSVAFAWAWDRSDAPKTTAHNA*
Ga0105243_100182575	3300009148	Miscanthus Rhizosphere	MRLIARFVFLMVAVFGVSLAFAWAWDRSDTPRPTTPVHGS*
Ga0116229_110544542	3300009500	Host-Associated	MRLIARFVFIMIAVFGVSLAFAWAWDKSDKPQDAVASH*
Ga0105237_110740682	3300009545	Corn Rhizosphere	MRLIVRFLVLMVAVFGLSLAFAWAWDRSEAPKPAAHSS*
Ga0105238_129730122	3300009551	Corn Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDRSDSPPATQVHGS*
Ga0105249_107595192	3300009553	Switchgrass Rhizosphere	MRLIVRFVVLMVAVFGVSLAFAWAWDHSDAQKATTTTTTHAG*
Ga0105249_131999922	3300009553	Switchgrass Rhizosphere	MRLIVRFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAS*
Ga0105857_11424082	3300009650	Permafrost Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTAAAHAS*
Ga0105856_13470762	3300009662	Permafrost Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDATTAHAS*
Ga0116227_100679223	3300009709	Host-Associated	MRLLARFLFLMVAVFGVSLAFAWAWDNSDAPRDAAVHAST*
Ga0116227_101918562	3300009709	Host-Associated	MRLIARFVVLMVAVFGVSLAFAWAWDRSDTQHLPAQGHTS*
Ga0116227_102560482	3300009709	Host-Associated	MRLIARFVFIMIAVFGVSLAFAWAWDKSDKPRDAVVSH*
Ga0116226_101579502	3300009787	Host-Associated	MRLIARFVFIMIAVFGVSLAFAWAWDKSDKRQDAVASH*
Ga0116226_106305782	3300009787	Host-Associated	MRLIARFVYIMIAVFGVSLAFAWAWDKSDKPQDAVASH*
Ga0127503_100441612	3300010154	Soil	RDLQLNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAASAHAAT*
Ga0123336_103955092	3300010331	Glacier Valley	MRLIARFVFLMVAVFGVSLAFAWAWDKSDKSQDTTAAHAS*
Ga0105239_101607511	3300010375	Corn Rhizosphere	SNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAP*
Ga0105239_120158961	3300010375	Corn Rhizosphere	NMRLIARFVVLMVAVFGVSLAFAWAWDKSDTPQDTATAPAPAHI*
Ga0126356_105428642	3300010877	Boreal Forest Soil	RFQMTQDLQLNMRLIARFVFLMVAVFGVSLAFAWAWDKSDKPQDAAVRASN*
Ga0105246_100204622	3300011119	Miscanthus Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRTAS*
Ga0164294_104618402	3300013006	Freshwater	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHAPPSATAPAAP*
Ga0157374_125583632	3300013296	Miscanthus Rhizosphere	LIARFVVLMVAVFGVSLAFAWAWDKSDKPQETTARADS*
Ga0157378_132913671	3300013297	Miscanthus Rhizosphere	MRLIARFVVLMVAVFGLSVAFAWAWDRSDAPKTTHNA*
Ga0157375_107819892	3300013308	Miscanthus Rhizosphere	MRLIVRFVVLMVAVFGVSLAFAWAWDHSDAQKATTTTTT
Ga0181534_108491082	3300014168	Bog	RLIARFVFLMVAVFGVSLAFAWAWDKSDKSQDASVHATSAT*
Ga0181534_109523992	3300014168	Bog	FVFLMVAVFGVSLAFAWAWDNSDAPRDAAVHAST*
Ga0163163_111934372	3300014325	Switchgrass Rhizosphere	ARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAS*
Ga0167669_11127602	3300015024	Glacier Forefield Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAAAHAS*
Ga0163161_112910401	3300017792	Switchgrass Rhizosphere	MRLIARFVVLMVAVFGLSVAFAWAWDRSDAPKTTAHNA
Ga0187883_102779332	3300018037	Peatland	MRLIARFVFIMIAVFGVSLAFAWAWDKSDKRQDAVASH
Ga0210403_112939362	3300020580	Soil	MRLIARFVFLMVAVFGVSLAFAWAWDKSDKPQDASVHATTAT
Ga0210400_106074381	3300021170	Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDTSQASVQAAHAS
Ga0213872_100640322	3300021361	Rhizosphere	MRLIARFVVLLAAVFGVSLAFAWAWDHSDTSAPTHAQGS
Ga0213872_100740752	3300021361	Rhizosphere	RVGVPALTMRLIARFVVLMAAVFGVSLAFAWAWDHSDTPTPTHTQGS
Ga0210397_100463822	3300021403	Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDTSQDAAAARAAS
Ga0210397_102738362	3300021403	Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTVAAHASS
Ga0210387_105309302	3300021405	Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAAHAAN
Ga0210392_107146241	3300021475	Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTAAHA
Ga0213853_105692732	3300021861	Watersheds	VLMVAVFGVSLAFAWAWDKSDKPRDAAAAVTPQQSS
Ga0212090_104798242	3300022561	Glacier Valley	MRLIARFVFLMVAVFGVSLAFAWAWDKSDKSQDTTAAHAS
Ga0247779_10050433	3300022908	Plant Litter	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTAAAHAAS
Ga0207427_1004223	3300025231	Arabidopsis Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATTTAHAAT
Ga0209677_1038333	3300025253	Arabidopsis Root	MRLIARFVVLMVAVFGVSLAFAWAWDKSDTPQDTATTHAPAHT
Ga0209759_100092513	3300025256	Arabidopsis Root	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQETSARADS
Ga0209759_10123552	3300025256	Arabidopsis Root	MRLIARFVFLMVAVFGVSLAFAWAWDKSDKPHDDATVRAAA
Ga0209759_10306762	3300025256	Arabidopsis Root	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDPAAAHAAT
Ga0209051_10018443	3300025303	Arabidopsis Root	MRLIARFVVLMVAVFGVSLAFAWAWDRSDTPPATTPVRGS
Ga0209051_10168352	3300025303	Arabidopsis Root	MRLIARFVVLMVAVFGLSIAFAWAWDRSDAPKTAQHA
Ga0207642_101506142	3300025899	Miscanthus Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAS
Ga0207705_100724782	3300025909	Corn Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQQDTSARADS
Ga0207705_100808292	3300025909	Corn Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDAPQDTATAPAPAHI
Ga0207705_108747912	3300025909	Corn Rhizosphere	IARFVVLMVAVFGVSLAFAWAWDKSDTPQDTATTHAPAHT
Ga0207695_111771331	3300025913	Corn Rhizosphere	RLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAP
Ga0207649_105989102	3300025920	Corn Rhizosphere	MRLIARFVVLMVAVFGLSVAFAWAWDRSDAPKTAHQE
Ga0207659_105024151	3300025926	Miscanthus Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQR
Ga0207644_118645411	3300025931	Switchgrass Rhizosphere	MRLIARFVVLMVAVFGLSVAFAWAWDRSDAPKTTHDA
Ga0207690_102831552	3300025932	Corn Rhizosphere	RFVVLMVAVFGVSLAFAWAWDKSDKPQDNTSARADS
Ga0207709_100092952	3300025935	Miscanthus Rhizosphere	MRLIARFVFLMVAVFGVSLAFAWAWDRSDTPRPTTPVHGS
Ga0207669_113651181	3300025937	Miscanthus Rhizosphere	DLRSNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDPAAAHAAT
Ga0207667_1001001012	3300025949	Corn Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAAAQRAAS
Ga0207667_101994172	3300025949	Corn Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQQDTHARADS
Ga0207667_104468012	3300025949	Corn Rhizosphere	CSSNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAP
Ga0207651_100068962	3300025960	Switchgrass Rhizosphere	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTTARADS
Ga0207712_118060232	3300025961	Switchgrass Rhizosphere	MRLIVRFVVLMVAVFGVSLAFAWAWDHSDAQKATTTTTTHAG
Ga0268264_119265872	3300028381	Switchgrass Rhizosphere	DRRACSSNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAQRAAS
Ga0302151_1000007834	3300028562	Bog	MRLLARFVFLMVAVFGVSLAFAWAWDNSDTQQDASVHAPA
Ga0302151_100115622	3300028562	Bog	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDATTAHAS
Ga0302262_101159392	3300028743	Fen	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPRDAVALHTS
Ga0302202_104345562	3300028762	Bog	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDATTAH
Ga0302279_103565201	3300028783	Bog	LARFVFLMVAVFGVSLAFAWAWDNSDTQQDASVHAPA
Ga0265338_111038782	3300028800	Rhizosphere	MRLLARFVFLMVAVFGVSLAFAWAWDKSDTPQDTVAAHAAN
Ga0302263_103151952	3300028869	Fen	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDTVAAHAAT
Ga0302254_102387842	3300028870	Fen	MRLLARFLVLLVAVFGVSLAFAWAWDKSDRSQPVAQVRAA
Ga0302235_100541832	3300028877	Palsa	MRLLARFVFLMVAVFGVSLAFAWAWDKSDTPQDDAVHTAN
Ga0302235_104450752	3300028877	Palsa	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAATVHAS
Ga0311327_100152217	3300029883	Bog	MRLLARFVFLMVAVFGVRLAFAWAWDNSDTQQDASVHAPA
Ga0311326_100875662	3300029917	Bog	MLLLARFVFLMVAVFGVSLAFAWAWDNSDTQQDASVHAPA
Ga0311330_102972192	3300029945	Bog	MRLIARFVFLMVAVFGVSLAFAWAWDKSDKPRDASVHANTAT
Ga0311330_105704302	3300029945	Bog	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDATAAHAS
Ga0311371_100075954	3300029951	Palsa	MRLIARFVVLMVAVFGVSLAFAWAWDKSDTSQDAATARAAS
Ga0311371_120138602	3300029951	Palsa	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAVHASN
Ga0311334_111041242	3300029987	Fen	MRLIARFVVLMVAVFGVSLAFAWAWDKYDTAQATVAAHT
Ga0311365_117559451	3300029989	Fen	MRLIARFVFLMVAVFGVSLAFAWAWDKSDNQHDTVAAQAHTPA
Ga0311344_100598541	3300030020	Bog	PHWPPDLQLTMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDATTAHAS
Ga0311349_101310543	3300030294	Fen	MRLIARFVVLMVAVFGVSLAFAWAWDKSDTAQATVAAHTPT
Ga0311372_114821772	3300030520	Palsa	MRLIARFVVLMVAVFGVSLAFAWAWDKSDTPQDAAAVRAAS
Ga0311357_102375202	3300030524	Palsa	LQLTMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAATVHAS
Ga0311356_102706272	3300030617	Palsa	MRLIARFVVLMVAVFGVSLAFAWSWDKSDKPQDATTAHAS
Ga0302317_101884251	3300030677	Palsa	RDLQLTMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDATTAHAS
Ga0302308_102220401	3300031027	Palsa	LQLTMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDATTAHAS
Ga0302323_1020957812	3300031232	Fen	MRLIARFVVLMVAVFGVSLAFAWAWDRSDSPSATQVHGS
Ga0307509_101921191	3300031507	Ectomycorrhiza	MRLFARFVVLMVAVFGVSLAFAWAWDRSDTRPATTPVHGS
Ga0318516_101156282	3300031543	Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQNAPTTAAS
Ga0307508_103730322	3300031616	Ectomycorrhiza	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPRDAAAAHAAS
Ga0307516_100048422	3300031730	Ectomycorrhiza	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAAVHAAT
Ga0307516_106895542	3300031730	Ectomycorrhiza	MRLIARFVFLMVAVFGVSLAFAWAWDKSDKPQDTVAAHAAT
Ga0318554_101013413	3300031765	Soil	WSQDLQSNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQNAPTTAAS
Ga0318547_110125121	3300031781	Soil	MRLIARFVVLMVAVFGLSVAFAWAWDRSDAPKTTTHNA
Ga0318520_105475801	3300031897	Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDATAERAAS
Ga0302322_1017955552	3300031902	Fen	LSRDLQPTMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPRDAVALHTS
Ga0311367_101807142	3300031918	Fen	MRQLARFAILIVAVCGVSLAFAWAWDRSEAPAAAVAPR
Ga0308174_105093692	3300031939	Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDGASVHAAS
Ga0308174_116213952	3300031939	Soil	MRLIVRFVVLMVAVFGLSVAFAWAWDRSDAPKTTHDA
Ga0308176_118489391	3300031996	Soil	MRLIARFVVLMVAVFGVSLAFAWAWDRSDTPPTTQVHGT
Ga0308173_116288061	3300032074	Soil	MRLIVRFVVLMVAVFGLSVAFAWAWDRSDAPKTTHEA
Ga0308173_118038012	3300032074	Soil	MPARDLLPNMRLIARFVVLMVAVFGVSLAFAWAWDKSDKPHDAPNPAHTAS
Ga0370487_0000097_16166_16300	3300034170	Untreated Peat Soil	LQLNMRLIARFVVLMIAVFGVSLAFAWAWDKSDKPRDAAAVHAS
Ga0370487_0032642_75_197	3300034170	Untreated Peat Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQDAAAVHAS
Ga0370487_0212087_139_264	3300034170	Untreated Peat Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQASAAAHAAS
Ga0370481_0118297_497_622	3300034281	Untreated Peat Soil	MRLIARFVVLMVAVFGVSLAFAWAWDKSDKPQATAAAHAAS
Ga0370545_056811_70_192	3300034643	Soil	MRLIARFVVLMVAVFGVSLAFAWAWDRSDNRPAAAQVRGS

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign