| Basic Information | |
|---|---|
| Family ID | F044520 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 154 |
| Average Sequence Length | 46 residues |
| Representative Sequence | FDPKERYKAGEIISHPEFGRGKIENVLRSSLLVRFPIGGLKSLMLR |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.31 % |
| % of genes near scaffold ends (potentially truncated) | 96.75 % |
| % of genes from short scaffolds (< 2000 bps) | 95.45 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.351 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.688 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.779 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (35.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 32.43% Coil/Unstructured: 67.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 9.74 |
| PF13432 | TPR_16 | 3.90 |
| PF00158 | Sigma54_activat | 3.25 |
| PF02518 | HATPase_c | 3.25 |
| PF14559 | TPR_19 | 1.95 |
| PF02954 | HTH_8 | 1.95 |
| PF05635 | 23S_rRNA_IVP | 1.30 |
| PF00206 | Lyase_1 | 0.65 |
| PF13277 | YmdB | 0.65 |
| PF01609 | DDE_Tnp_1 | 0.65 |
| PF13006 | Nterm_IS4 | 0.65 |
| PF00512 | HisKA | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.65 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.65 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.65 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.35 % |
| Unclassified | root | N/A | 0.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908040|B4_c_ConsensusfromContig144951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 929 | Open in IMG/M |
| 2140918008|ConsensusfromContig97472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 831 | Open in IMG/M |
| 2189573004|GZGWRS401DSNDD | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103084540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 712 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109938729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 675 | Open in IMG/M |
| 3300002568|C688J35102_119457650 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300004000|Ga0055458_10277388 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300004156|Ga0062589_100518360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1010 | Open in IMG/M |
| 3300004157|Ga0062590_100692054 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300005093|Ga0062594_101332152 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300005332|Ga0066388_103102457 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005332|Ga0066388_107538124 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005337|Ga0070682_101827876 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005340|Ga0070689_100913471 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300005341|Ga0070691_10555486 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300005345|Ga0070692_11119556 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005364|Ga0070673_102297643 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005434|Ga0070709_10185732 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300005451|Ga0066681_10426126 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300005564|Ga0070664_101764311 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005577|Ga0068857_100985115 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300005578|Ga0068854_101864018 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005598|Ga0066706_10449109 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300005602|Ga0070762_10335148 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300005617|Ga0068859_101074681 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300005712|Ga0070764_10128902 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300005764|Ga0066903_103503045 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300005764|Ga0066903_108018140 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005836|Ga0074470_10279252 | All Organisms → cellular organisms → Bacteria | 3519 | Open in IMG/M |
| 3300005950|Ga0066787_10117293 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005993|Ga0080027_10428121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300006358|Ga0068871_101804520 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300006844|Ga0075428_100751446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1038 | Open in IMG/M |
| 3300006881|Ga0068865_100031508 | All Organisms → cellular organisms → Bacteria | 3536 | Open in IMG/M |
| 3300007004|Ga0079218_10517230 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300009162|Ga0075423_12408891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300009179|Ga0115028_10589684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 828 | Open in IMG/M |
| 3300010362|Ga0126377_12646294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300010397|Ga0134124_10568389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1106 | Open in IMG/M |
| 3300010399|Ga0134127_10988892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 901 | Open in IMG/M |
| 3300010399|Ga0134127_13468997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300010401|Ga0134121_11400621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300010403|Ga0134123_10565204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1085 | Open in IMG/M |
| 3300010403|Ga0134123_12063396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300010403|Ga0134123_12357111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 597 | Open in IMG/M |
| 3300011120|Ga0150983_11766581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300011430|Ga0137423_1075101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1003 | Open in IMG/M |
| 3300012198|Ga0137364_11172168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300012212|Ga0150985_103486577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300012212|Ga0150985_110688842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1018 | Open in IMG/M |
| 3300012212|Ga0150985_112596134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300012212|Ga0150985_118337206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 985 | Open in IMG/M |
| 3300012231|Ga0137465_1095002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 893 | Open in IMG/M |
| 3300012469|Ga0150984_113489311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300012469|Ga0150984_114289580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300012469|Ga0150984_118209106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300012679|Ga0136616_10329211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300012913|Ga0157298_10303251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300012944|Ga0137410_11389803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300012958|Ga0164299_10151961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1282 | Open in IMG/M |
| 3300012971|Ga0126369_11225623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 840 | Open in IMG/M |
| 3300014152|Ga0181533_1285865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 603 | Open in IMG/M |
| 3300014161|Ga0181529_10043169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 3262 | Open in IMG/M |
| 3300014166|Ga0134079_10459393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300014494|Ga0182017_10562898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300018057|Ga0187858_10610841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300018058|Ga0187766_11256607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300019788|Ga0182028_1412931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1911 | Open in IMG/M |
| 3300019788|Ga0182028_1453250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1739 | Open in IMG/M |
| 3300020070|Ga0206356_10313662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300020076|Ga0206355_1272860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 714 | Open in IMG/M |
| 3300020080|Ga0206350_10149193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300021403|Ga0210397_11057463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300021478|Ga0210402_11827223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300022467|Ga0224712_10633616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300022708|Ga0242670_1039234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300022886|Ga0247746_1220701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 502 | Open in IMG/M |
| 3300023263|Ga0247800_1110460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 565 | Open in IMG/M |
| 3300024219|Ga0247665_1014601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 928 | Open in IMG/M |
| 3300024224|Ga0247673_1032432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 719 | Open in IMG/M |
| 3300025322|Ga0209641_10513376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
| 3300025627|Ga0208220_1097431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300025898|Ga0207692_10342059 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300025899|Ga0207642_11040478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 528 | Open in IMG/M |
| 3300025913|Ga0207695_11370915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300025918|Ga0207662_10053248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 2410 | Open in IMG/M |
| 3300025934|Ga0207686_10654083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 832 | Open in IMG/M |
| 3300025942|Ga0207689_10040762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3842 | Open in IMG/M |
| 3300025972|Ga0207668_11340720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300025981|Ga0207640_11758498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300026035|Ga0207703_11412342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 670 | Open in IMG/M |
| 3300026035|Ga0207703_11627885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300026078|Ga0207702_10799211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 932 | Open in IMG/M |
| 3300026078|Ga0207702_12029810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300026078|Ga0207702_12387003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300026095|Ga0207676_11020784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300026486|Ga0256820_1032177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 769 | Open in IMG/M |
| 3300027884|Ga0209275_10426884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300028381|Ga0268264_10217351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1758 | Open in IMG/M |
| 3300028577|Ga0265318_10370444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 523 | Open in IMG/M |
| 3300028653|Ga0265323_10100867 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 956 | Open in IMG/M |
| 3300028666|Ga0265336_10187856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300028739|Ga0302205_10158333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300028819|Ga0307296_10342749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300028869|Ga0302263_10438838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300029987|Ga0311334_11153116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 649 | Open in IMG/M |
| 3300029989|Ga0311365_11962068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 500 | Open in IMG/M |
| 3300030000|Ga0311337_11272329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 644 | Open in IMG/M |
| 3300030002|Ga0311350_11043164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 730 | Open in IMG/M |
| 3300030014|Ga0302175_10177121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300030114|Ga0311333_10512236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 984 | Open in IMG/M |
| 3300030294|Ga0311349_10112034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 2544 | Open in IMG/M |
| 3300030336|Ga0247826_10652685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 812 | Open in IMG/M |
| 3300031232|Ga0302323_102714549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300031235|Ga0265330_10486979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 524 | Open in IMG/M |
| 3300031241|Ga0265325_10384216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 617 | Open in IMG/M |
| 3300031242|Ga0265329_10093389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 955 | Open in IMG/M |
| 3300031250|Ga0265331_10158442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1026 | Open in IMG/M |
| 3300031344|Ga0265316_10892817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300031564|Ga0318573_10597285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300031576|Ga0247727_10683756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300031712|Ga0265342_10203494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1074 | Open in IMG/M |
| 3300031716|Ga0310813_11339631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300031727|Ga0316576_10355270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1090 | Open in IMG/M |
| 3300031740|Ga0307468_101179238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 689 | Open in IMG/M |
| 3300031764|Ga0318535_10128649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1122 | Open in IMG/M |
| 3300031769|Ga0318526_10324303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300031769|Ga0318526_10388195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300031771|Ga0318546_10744892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 690 | Open in IMG/M |
| 3300031782|Ga0318552_10728125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300031792|Ga0318529_10225457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 871 | Open in IMG/M |
| 3300031798|Ga0318523_10363689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300031805|Ga0318497_10319094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 866 | Open in IMG/M |
| 3300031846|Ga0318512_10457559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300031847|Ga0310907_10450650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300031858|Ga0310892_10913059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300031879|Ga0306919_10189699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1522 | Open in IMG/M |
| 3300031896|Ga0318551_10311484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 887 | Open in IMG/M |
| 3300031944|Ga0310884_10287421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 912 | Open in IMG/M |
| 3300031996|Ga0308176_11670256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 679 | Open in IMG/M |
| 3300032013|Ga0310906_11228782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300032067|Ga0318524_10693109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300032068|Ga0318553_10479283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300032074|Ga0308173_10370730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1252 | Open in IMG/M |
| 3300032074|Ga0308173_12340834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300032075|Ga0310890_11570251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300033414|Ga0316619_10824821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 795 | Open in IMG/M |
| 3300033433|Ga0326726_11072263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 783 | Open in IMG/M |
| 3300033487|Ga0316630_10102148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1923 | Open in IMG/M |
| 3300033743|Ga0334844_113616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 536 | Open in IMG/M |
| 3300033819|Ga0334816_108501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300034195|Ga0370501_0135504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 847 | Open in IMG/M |
| 3300034195|Ga0370501_0324275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.69% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 6.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 6.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.60% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.95% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.95% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.30% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.30% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.30% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.30% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.30% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.30% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.30% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.30% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.65% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.65% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.65% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.65% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.65% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.65% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.65% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.65% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908040 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004000 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026486 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PR6 | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Host-Associated | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033743 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 5-9 | Environmental | Open in IMG/M |
| 3300033819 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-M | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B4_c_05097390 | 2124908040 | Soil | TFNPRERYKVGEVXWHPEFGRGXVETVXRSXXLVRXXXGGXKXVMLX |
| Bog_all_C_02884350 | 2140918008 | Soil | TFNPRERYKVGEVIWHPEFGRGKVETVLRSSMLVRFASGGMKSVMLS |
| FG2_05656350 | 2189573004 | Grass Soil | CSKTVNAVEAIKTFDPKNRYKVGEIIFHPEYGRGKIENVLRSSLLVRFPVGGLKSLMLL |
| JGIcombinedJ13530_1030845402 | 3300001213 | Wetland | PFDARERYRVGEVISHPEFGRGKVETVLRSSLLVRFPTGGLKSLMLT* |
| JGIcombinedJ13530_1099387292 | 3300001213 | Wetland | RERYKVGEAISHPDFGRGKVETVLRSSVLVRFANGGLKSLMLT* |
| C688J35102_1194576502 | 3300002568 | Soil | ERYRPGDVISHPDYGRGKVETVLRSSLLVRFPQGGLKSLILI* |
| Ga0055458_102773882 | 3300004000 | Natural And Restored Wetlands | ARDRYKVGEVISHPDFGRGKVETVLRSSLLVRFLNGGLKLVMLT* |
| Ga0062589_1005183603 | 3300004156 | Soil | EVAAAATVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFSVGGLKSLMLQ* |
| Ga0062590_1006920543 | 3300004157 | Soil | SAASVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLV* |
| Ga0062594_1013321521 | 3300005093 | Soil | VKNFDPKERYRPGDIISHLEYGRGKVETVLRSSLLVRFPNGGLKSLLLM* |
| Ga0066388_1031024573 | 3300005332 | Tropical Forest Soil | RYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV* |
| Ga0066388_1075381241 | 3300005332 | Tropical Forest Soil | FDPKERYKAGEIIAHAEFGRGKIENVLRSSLLVRFPVGGLKSLMLS* |
| Ga0070682_1018278762 | 3300005337 | Corn Rhizosphere | VRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLV* |
| Ga0070689_1009134711 | 3300005340 | Switchgrass Rhizosphere | RYRSGEIIVHPQFGRGKIETVLRSSLLVRFSAGGLKSVMLN* |
| Ga0070691_105554861 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | EELAAAPDVRLFDPRERYKAGEIISHPEYGRGKIQNVLRSSLLVRFSVGGLKSLMLR* |
| Ga0070692_111195562 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | AATVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLV* |
| Ga0070673_1022976432 | 3300005364 | Switchgrass Rhizosphere | RVFDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV* |
| Ga0070709_101857323 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AQEVNAAAEIKSFDPKQRYKVGDIIAHPEFGRGKIENVLRSSLLVRFPIGGLKSLMLT* |
| Ga0066681_104261261 | 3300005451 | Soil | SAATVRVFDPKERYKAGEIIVHPEFGRGKIENVLRSSLLIRFPIGGLKSLMLI* |
| Ga0070664_1017643112 | 3300005564 | Corn Rhizosphere | FDPKERYKAGEIIVHAEYGRGKIQNVLRSSLLVRFSVGGLKSLMLQ* |
| Ga0068857_1009851152 | 3300005577 | Corn Rhizosphere | KERYKAGEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLM* |
| Ga0068854_1018640181 | 3300005578 | Corn Rhizosphere | VRSFNPKERYKAGEIISHPEYGRGKIENVLRASLLVRFSRAGLKPLMLQ* |
| Ga0066706_104491091 | 3300005598 | Soil | SAATVRVFDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLI* |
| Ga0070762_103351483 | 3300005602 | Soil | TVRVFDPKERYKAGEIIVHPEYGRGKIQNVLRSSLIVRFSAGGLKSLMLM* |
| Ga0068859_1010746813 | 3300005617 | Switchgrass Rhizosphere | GEIIVHAEFGRGKIENVLRSSLLVRFAIGGLKSLMLV* |
| Ga0070764_101289021 | 3300005712 | Soil | RLFDPRERYKAGEIISHPEYGRGKIQNVLRSSLLVRFSVGGLKSLMLR* |
| Ga0066903_1035030451 | 3300005764 | Tropical Forest Soil | FDPKERYKAGEIIAHPEYGRGKIENVLRSSLLVRFPVGGLKSLMLS* |
| Ga0066903_1080181401 | 3300005764 | Tropical Forest Soil | PKERYKAGEIIVHPDFGRGKVENVLRSSLLVRFSVGGLKSLMLV* |
| Ga0074470_102792521 | 3300005836 | Sediment (Intertidal) | IVHPEFGRGKIENVLRASLLVRFPIGGLKSLMLM* |
| Ga0066787_101172931 | 3300005950 | Soil | KERYKAGEIIVHPEYGRGKIQNVLRSSLIVRFSAGGLKSLMLM* |
| Ga0080027_104281211 | 3300005993 | Prmafrost Soil | EIISHAEYGRGKIENVLRSSLLVRFSVGGLKSLMLV* |
| Ga0068871_1018045202 | 3300006358 | Miscanthus Rhizosphere | KERYKAGEIIVHAEFGRGKIENVLRASLLVRFPIGGLKSLMLV* |
| Ga0075428_1007514463 | 3300006844 | Populus Rhizosphere | VAAAATVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFSVGGLKSLMLQ* |
| Ga0068865_1000315083 | 3300006881 | Miscanthus Rhizosphere | KERYKAGEIIVHPEFGRGKIENVLRSSLLVRFPIGGLKSLMLT* |
| Ga0079218_105172301 | 3300007004 | Agricultural Soil | EEVSAATQVRVFDPKQRYKAGEIIVHPEYGRGKIENVLRSSLLVRFASGGLKSLMLV* |
| Ga0075423_124088911 | 3300009162 | Populus Rhizosphere | KAGEIIVHAEYGRGKIQNVLRSSLLVRFSVGGLKSLMLQ* |
| Ga0115028_105896841 | 3300009179 | Wetland | AEVRPFDARERYKVGEAISHPDFGRGKVETVLRSSVLVRFANGGLKSLMLT* |
| Ga0126377_126462942 | 3300010362 | Tropical Forest Soil | GEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLL* |
| Ga0134124_105683891 | 3300010397 | Terrestrial Soil | KQRYKAGDIIAHPEFGRGKVENVLRSSLLVRFGTGGIKSLMLV* |
| Ga0134127_109888921 | 3300010399 | Terrestrial Soil | ERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV* |
| Ga0134127_134689971 | 3300010399 | Terrestrial Soil | IISHLEYGRGKVETVLRSSLLVRFANGGLKSLMLM* |
| Ga0134121_114006212 | 3300010401 | Terrestrial Soil | GDIIAHPEFGRGKVENVLRSSLLVRFSIGGLKSLMLS* |
| Ga0134123_105652043 | 3300010403 | Terrestrial Soil | KAGEIIVHAEFGRGKIENVLRSSLLVRFAIGGLKSLMLV* |
| Ga0134123_120633962 | 3300010403 | Terrestrial Soil | RVFDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFSIGGLKSLMLQ* |
| Ga0134123_123571112 | 3300010403 | Terrestrial Soil | GEEVAAAAQVRNFDPKERYKAGEIISHPEYGRGKIENVLRSSLLVRFSVGGLKSLMLL* |
| Ga0150983_117665812 | 3300011120 | Forest Soil | YKAGEIIAHPVYGRGKIENVLRSSLLVRFSAGGLKSLMLS* |
| Ga0137423_10751013 | 3300011430 | Soil | ANAADVKNFDPKERYRPGDVISHLEYGRGKVETVLRSSLLVRFANGGLKSLMLQ* |
| Ga0137364_111721682 | 3300012198 | Vadose Zone Soil | FDPKERYKAGEIIVHPEFGRGKIENVLRSSLLIRFPIGGLKSLMLI* |
| Ga0150985_1034865772 | 3300012212 | Avena Fatua Rhizosphere | ERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLL* |
| Ga0150985_1106888421 | 3300012212 | Avena Fatua Rhizosphere | VVTSAAVEVKSFDPKQRYRVGDIISHPEYGRGKIESVLRSSLLVRFAIGGLKSLMLT* |
| Ga0150985_1125961341 | 3300012212 | Avena Fatua Rhizosphere | EFDPKERYKAGEIIVHPEYGRGKIENVLRSSLLVRFPVGGLKSLMLS* |
| Ga0150985_1183372061 | 3300012212 | Avena Fatua Rhizosphere | LIVHPQFGRGKIETVLRSSLLVRFSAGGLKSVMLN* |
| Ga0137465_10950021 | 3300012231 | Soil | ATVRVFDPKERYKPGEIIVHAEYGRGKIENVLRSSLLVRFSVGGLKSLMLQ* |
| Ga0150984_1134893111 | 3300012469 | Avena Fatua Rhizosphere | VRSFNPKERYKAGEIISHPEYGRGKIENVLRSSLLVRFSRAGLKPLMLQ* |
| Ga0150984_1142895802 | 3300012469 | Avena Fatua Rhizosphere | RPGDIISHLEYGRGKVETVLRSSLLVRFPNGGLKSLMLM* |
| Ga0150984_1182091062 | 3300012469 | Avena Fatua Rhizosphere | AVEVKSFDPKQRYRVGDIISHPEYGRGKIESVLRSSLLVRFAIGGLKSLMLT* |
| Ga0136616_103292111 | 3300012679 | Polar Desert Sand | YRSGDIISHLEFGRGKVETVLRSSLLVRFANGGLKSLMLV* |
| Ga0157298_103032511 | 3300012913 | Soil | EEIAAAANVRVFDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV* |
| Ga0137410_113898031 | 3300012944 | Vadose Zone Soil | KERYKAGEIIAHAEYGRGKIENVLRSSLLVRFPVGGLKSLMLV* |
| Ga0164299_101519611 | 3300012958 | Soil | EIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLV* |
| Ga0126369_112256233 | 3300012971 | Tropical Forest Soil | IDPKERYKAGEIIAHPDFGRGKIENVLRSSLLVRFPVGGLKSLMLI* |
| Ga0181533_12858652 | 3300014152 | Bog | RAFDARERYRVGEVIAHPEFGRGKVETVLRSSLLVRFPAGGLKSLMLT* |
| Ga0181529_100431691 | 3300014161 | Bog | RYKVGEVISHPEFGRGKVETVLRSSMLVRFPNGGLKSLMLS* |
| Ga0134079_104593931 | 3300014166 | Grasslands Soil | RYTTEIKANEIILHPEHGRGKIENVLRSSLLVRFPIGGLKSLMLM* |
| Ga0182017_105628982 | 3300014494 | Fen | VIWHPEFGRGKVETVLRSSMLVRFASGGMKSVMLS* |
| Ga0187858_106108412 | 3300018057 | Peatland | ADVRTFNPRERYKVGEVIWHPEFGRGKVETVLRSSMLVRFASGGMKSVMLG |
| Ga0187766_112566071 | 3300018058 | Tropical Peatland | FDPKERYKAGQIIVHPEFGRGKIENVLRSSLLVRFPIGGLKSLMLI |
| Ga0182028_14129312 | 3300019788 | Fen | VRTFNPRERYKVGEVVWHPEFGRGKVETVLRSSMLVRFASGGMKSVMLS |
| Ga0182028_14532502 | 3300019788 | Fen | VGEVISHPEYGRGKVETVLRSSLLVRFPNGGLKSLMLS |
| Ga0206356_103136622 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAADNVRVFDPRERYKAGEIISHPEFGRGKIENVLRSSLLVRFSNGGLKSVMLQ |
| Ga0206355_12728602 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | DNVRVFDPRERYKAGEIISHPEFGRGKIENVLRSSLLVRFSNGGLKSVMLQ |
| Ga0206350_101491932 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | VRVFDPRERYKAGEIISHPEFGRGKIENVLRSSLLVRFSNGGLKSVMLQ |
| Ga0210397_110574631 | 3300021403 | Soil | GEIISHAEYGRGKVENVLRSSLLVRFSVGGLKSLMLM |
| Ga0210402_118272231 | 3300021478 | Soil | EEVASAADVRRFDPKERYKAGEIISHAEYGRGKVENVLRSSLLVRFSVGGLKSLMLS |
| Ga0224712_106336162 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | FDPKERYKAGEIISHPEFGRGKIENVLRSSLLVRFPIGGLKSLMLR |
| Ga0242670_10392342 | 3300022708 | Soil | AGEIISHPEYGRGKIQNVLRSSLLVRFSVGGLKSLMLR |
| Ga0247746_12207012 | 3300022886 | Soil | SVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLV |
| Ga0247800_11104601 | 3300023263 | Soil | ASVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLV |
| Ga0247665_10146011 | 3300024219 | Soil | GEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV |
| Ga0247673_10324322 | 3300024224 | Soil | VFDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV |
| Ga0209641_105133761 | 3300025322 | Soil | AGEILSHPEFGRGKIENVLPRSLLVRFSAGLKTLKLS |
| Ga0208220_10974311 | 3300025627 | Arctic Peat Soil | RYKAGEIIVHPEYGRGKIQNVLRSSLIVRFSAGGLKSLMLM |
| Ga0207692_103420591 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | DVKMFDPKERYKAGQIIVHPEYGRGKIENVLRSSLLVRFPVGGLKSLMLM |
| Ga0207642_110404781 | 3300025899 | Miscanthus Rhizosphere | DVRSFNPKERYKAGEIISHPEYGRGKIENVLRSSLLVRFSRAGLKPLMLQ |
| Ga0207695_113709151 | 3300025913 | Corn Rhizosphere | RKFDPKERYKAGEIISHAEYGRGKVENVLRSSLLVRFSVGGLKSLMLV |
| Ga0207662_100532481 | 3300025918 | Switchgrass Rhizosphere | AATVRVFDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV |
| Ga0207686_106540831 | 3300025934 | Miscanthus Rhizosphere | YKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV |
| Ga0207689_100407621 | 3300025942 | Miscanthus Rhizosphere | IIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV |
| Ga0207668_113407202 | 3300025972 | Switchgrass Rhizosphere | LGEEVSSAATVRVFDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV |
| Ga0207640_117584982 | 3300025981 | Corn Rhizosphere | VRSFNPKERYKAGEIISHPEYGRGKIENVLRASLLVRFSRAGLKPLMLQ |
| Ga0207703_114123421 | 3300026035 | Switchgrass Rhizosphere | KERYKAGEIIVHAEFGRGKIENVLRSSLLVRFSIGGLKSLMLQ |
| Ga0207703_116278851 | 3300026035 | Switchgrass Rhizosphere | IIVHAEFGRGKIENVLRSSLLVRFSIGGLKSLMLQ |
| Ga0207702_107992113 | 3300026078 | Corn Rhizosphere | ETVRTFDPRERYKAGEIISHPEFGRGKIENVLRSSLLVRFPNGGLKSIMLM |
| Ga0207702_120298102 | 3300026078 | Corn Rhizosphere | PRERYKAGEIISHPEFGRGKIENVLRSSMLVRFSNGGLKSVMLQ |
| Ga0207702_123870032 | 3300026078 | Corn Rhizosphere | GEIISHPEFGRGKIENVLRSSLLVRFSNGGLKSVMLQ |
| Ga0207676_110207843 | 3300026095 | Switchgrass Rhizosphere | KERYKTGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV |
| Ga0256820_10321772 | 3300026486 | Sediment | DRYKVGEILSHPEFGRGKVETVLRSSLLVRFPNGGLKSLMLT |
| Ga0209275_104268841 | 3300027884 | Soil | IIVHPEYGRGKIQNVLRSSLIVRFSAGGLKSLMLM |
| Ga0268264_102173511 | 3300028381 | Switchgrass Rhizosphere | DPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV |
| Ga0265318_102893972 | 3300028577 | Rhizosphere | RALGREVAEAEHIRTFEARERYKVGEIISHPDYGRGKVETVLRSSMLVRFPTGGLKSLML |
| Ga0265318_103704441 | 3300028577 | Rhizosphere | KERYKTGEIISHPEYGRGKIENVLRSSLLVRFSRSGLKPLTLL |
| Ga0265323_101008671 | 3300028653 | Rhizosphere | VRTFNPRERYKVGEVIWHPEFGRGKVETVLRSSMLVRFASGGMKSVMLS |
| Ga0265336_101878562 | 3300028666 | Rhizosphere | NAAAEVKSFDPKQRYKVGDIIAHSEYGRGKIENVLRSSLLVRFPIGGLKSLMLT |
| Ga0302205_101583332 | 3300028739 | Fen | DVRTFNPRERYKVGEAIWHPTFGRGKVQTVLRSSMLVRFASGGMKSVMLS |
| Ga0307296_103427493 | 3300028819 | Soil | VFDPKERYKAGEIIVHPEFGRGKIENVLRSSLLVRFAVGGLKSLMLL |
| Ga0302263_104388382 | 3300028869 | Fen | GEVIAHPDHGRGKVENVLRSSMLVRFPNSGLKSLMLN |
| Ga0311334_111531161 | 3300029987 | Fen | RAFDARDRYKVGEVISHSEYGRGKVETVLRSSMLVRFPNGGLKSLMLN |
| Ga0311365_119620681 | 3300029989 | Fen | DVISHPEYGRGKIQNVLRSSLLVRFSVGGLKSLMLR |
| Ga0311337_112723292 | 3300030000 | Fen | TSQVRVFDARDRYKVGEIISHPTYGRGKVETVLRSSMLVRFPIGGLKSLMLN |
| Ga0311350_110431641 | 3300030002 | Fen | YKVGEVIAHPDHGRGKVENVLRSSMLVRFPNSGLKSLMLN |
| Ga0302175_101771211 | 3300030014 | Fen | TDVRTFNPRERYKVGEVIWHPEFGRGKVETVLRSSMLVRFANGGMKSVMLS |
| Ga0311333_105122362 | 3300030114 | Fen | RELAESTNVRTFNARERYKVGEAISHPEFGRGKVETVLRSSLLVRFSNGGLKSLMLT |
| Ga0311349_101120341 | 3300030294 | Fen | PRERYKAGEIISHPEYGRGKIQNVLRSSLLVRFSVGGLKSLMLR |
| Ga0247826_106526851 | 3300030336 | Soil | AATVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFSVGGLKSLMLQ |
| Ga0302323_1027145491 | 3300031232 | Fen | GEVIWHPEFGRGKVETVLRSSMLVRFASGGMKSVMLS |
| Ga0265330_104869792 | 3300031235 | Rhizosphere | IISHPEFGRGKVETVLRSSLLARFPSGGLKSLMLN |
| Ga0265325_103842162 | 3300031241 | Rhizosphere | VGEIISHPDYGRGKVETVLRSSMLVRFPTGGLKSLMLS |
| Ga0265329_100933893 | 3300031242 | Rhizosphere | ADVRTFNPRERYKVGEVIWHPEFGRGKVQTVLRSSMLVRFASGGMKSVMLG |
| Ga0265331_101584422 | 3300031250 | Rhizosphere | EVAETSQVRVFDARDRYKVGEVISHPDYGRGKVETVLRSSMLVRFPNGGLKSLMLN |
| Ga0265316_108928172 | 3300031344 | Rhizosphere | ASTEVRLFDPRERYKAGEIISHPEYGRGKIQNVLRSSLLVRFSVGGLKSLMLR |
| Ga0318573_105972852 | 3300031564 | Soil | EVAAAETVRLFDPKERYKAGEIIAHPEFGRGKIENVLRSSLLVRFPVGGLKSLMLL |
| Ga0247727_106837561 | 3300031576 | Biofilm | VKTFDPKQRYRSGDVISHATFGRGKVETVLRASLLVRFPHGGLKSLMLN |
| Ga0265342_102034943 | 3300031712 | Rhizosphere | SFNPKERYKAGEIISHPEYGRGKIENVLRSSLLVRFSRSGLKPLTLL |
| Ga0310813_113396312 | 3300031716 | Soil | FDPKERYRPGDVISHVQFGRGKVETVLRSSVLVRFPNGGLKSLLLT |
| Ga0316576_103552701 | 3300031727 | Rhizosphere | ATAETVRPFDSRERYKVGEIISHPSYGRGKVENVLRSSMLVRFSSSGLKSLMLN |
| Ga0307468_1011792382 | 3300031740 | Hardwood Forest Soil | KAGEIISHPEYGRGKVENVLRSSLLVRFSVGGLKSLMLL |
| Ga0318535_101286491 | 3300031764 | Soil | YKAGEIIVHAEYGRGKVENVLRSSLLVRFSVGGLKSLMLV |
| Ga0318526_103243031 | 3300031769 | Soil | YKAGEIISHPDFGRGKVENVLRSSLLVRFSVGGLKSLMLV |
| Ga0318526_103881951 | 3300031769 | Soil | AGEIIAHPEFGRGKIENVLRSSLLVRFPVGGLKSLMLL |
| Ga0318546_107448922 | 3300031771 | Soil | YKAGEIIAHPEYGRGKVENVLRSSLLVRFPAGGLKSLMLM |
| Ga0318552_107281252 | 3300031782 | Soil | ISHPEFGRGKVENVLRSSLLVRFPQGGLKSLMLRD |
| Ga0318529_102254571 | 3300031792 | Soil | KERYKAGEIIAHPEFGRGKIENVLRSSLLVRFPVGGLKSLMLL |
| Ga0318523_103636892 | 3300031798 | Soil | PKERYKAGEIISHPDFGRGKVENVLRSSLLVRFSVGGLKSLMLV |
| Ga0318497_103190943 | 3300031805 | Soil | FDPKERYKAGEIIAHPEFGRGKIENVLRSSLLVRFPVGGLKSLMLL |
| Ga0318512_104575592 | 3300031846 | Soil | PKERYKAGEIISHPEYGRGKVENVLRSSLLVRFSVGGLKSLMLV |
| Ga0310907_104506502 | 3300031847 | Soil | RYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV |
| Ga0310892_109130591 | 3300031858 | Soil | VAAAATVRVFDPKERYKAGEIIVHAEYGRGKIENVLRASLLVRFSVGGLKSLMLQ |
| Ga0306919_101896993 | 3300031879 | Soil | KAGEIIAHPEFGRGKIENVLRSSLLVRFPVGGLKSIMLI |
| Ga0318551_103114843 | 3300031896 | Soil | AEEVAASDKVRVFDPKERYKAGEIISHPEFGRGKIENVLRSSLLVRFPNGGLKSIMLL |
| Ga0310884_102874213 | 3300031944 | Soil | EIIVHAEYGRGKIENVLRASLLVRFSVGGLKSLMLQ |
| Ga0308176_116702562 | 3300031996 | Soil | LASATTVRQFNPKERYKAGEIISHVEYGRGKIENVLRSSLLVRFSRAGLKPLTLY |
| Ga0310906_112287821 | 3300032013 | Soil | ERYKAGEIIVHPEYGRGKIENVLRSSLLVRFPIGGLKSLMLN |
| Ga0318524_106931091 | 3300032067 | Soil | EEVAAAQNVRYFDPKERYKAGEIIAHPEFGRGKIENVLRSSLLVRFPIGGLKSLMLV |
| Ga0318553_104792831 | 3300032068 | Soil | PKERYKAGEIIVHAEYGRGKVENVLRSSLLVRFSVGGLKSLMLV |
| Ga0308173_103707301 | 3300032074 | Soil | GQIISHPEFGRGKIENVLRSSLLVRFPIGGLKSLMLM |
| Ga0308173_123408341 | 3300032074 | Soil | GEIISHPEYGRGKIQNVLRSSLLVRFSVGGLKSLMLR |
| Ga0310890_115702512 | 3300032075 | Soil | YKAGEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLV |
| Ga0316619_108248211 | 3300033414 | Soil | EVRPFDARERYKVGETISHPEFGRGKVETVLRSSVLVRFANGGLKSLMLT |
| Ga0326726_110722631 | 3300033433 | Peat Soil | FDARDRYKVGEVLSHPEFGRGKVETVLRSSLLVRFPNGGLKSLMLT |
| Ga0316630_101021481 | 3300033487 | Soil | VFDARDRYKVGEVLSHPEFGRGKVETVLRSSLLVRFPNGGLKSLMLT |
| Ga0334844_113616_408_536 | 3300033743 | Soil | DRYKVGEILSHPIFGRGKVETVLRSSLLVRFPNGGLKSLMLN |
| Ga0334816_108501_2_169 | 3300033819 | Soil | LADVANVRSFNPRERYKVGEVIWHPEFGRGKVETVLRSSMLVRFASGGMKSVMLS |
| Ga0370501_0135504_2_151 | 3300034195 | Untreated Peat Soil | VRVFDARERYKVGEVISHPDYGRGKVENVLRSSMLVRFPNSGLKSLMLN |
| Ga0370501_0324275_388_555 | 3300034195 | Untreated Peat Soil | LAEVADVRTFNPRERYKVGEVIWHPEFGRGKVQTVLRSSMLVRFAAGGMKSVMLS |
| ⦗Top⦘ |