NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044516

Metagenome / Metatranscriptome Family F044516

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044516
Family Type Metagenome / Metatranscriptome
Number of Sequences 154
Average Sequence Length 88 residues
Representative Sequence MCRDTGYYEPRDDVAVKVVEEMVEKKNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKQHVEELLLIDDSDRELFEEE
Number of Associated Samples 130
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 79.08 %
% of genes near scaffold ends (potentially truncated) 20.78 %
% of genes from short scaffolds (< 2000 bps) 63.64 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.286 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(12.338 % of family members)
Environment Ontology (ENVO) Unclassified
(63.636 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.260 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.30%    β-sheet: 0.00%    Coil/Unstructured: 48.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 154 Family Scaffolds
PF02467Whib 3.25
PF00856SET 1.95
PF02195ParBc 1.95
PF06114Peptidase_M78 1.95
PF14311DUF4379 1.30
PF01464SLT 1.30



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.35 %
UnclassifiedrootN/A0.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10016505All Organisms → Viruses → Predicted Viral3678Open in IMG/M
3300000116|DelMOSpr2010_c10048466All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1872Open in IMG/M
3300000116|DelMOSpr2010_c10142634All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium832Open in IMG/M
3300000117|DelMOWin2010_c10006318All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium7112Open in IMG/M
3300001346|JGI20151J14362_10104573All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium962Open in IMG/M
3300001354|JGI20155J14468_10057209All Organisms → Viruses → Predicted Viral1601Open in IMG/M
3300001355|JGI20158J14315_10148623All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium720Open in IMG/M
3300001460|JGI24003J15210_10003068All Organisms → cellular organisms → Bacteria7262Open in IMG/M
3300001956|GOS2266_1010160All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium2510Open in IMG/M
3300005942|Ga0070742_10196178All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium564Open in IMG/M
3300006025|Ga0075474_10031137All Organisms → Viruses → Predicted Viral1876Open in IMG/M
3300006027|Ga0075462_10035862All Organisms → Viruses → Predicted Viral1591Open in IMG/M
3300006392|Ga0075507_1446897All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium538Open in IMG/M
3300006484|Ga0070744_10047737All Organisms → Viruses → Predicted Viral1257Open in IMG/M
3300006484|Ga0070744_10144051All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium684Open in IMG/M
3300006735|Ga0098038_1164099All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium734Open in IMG/M
3300006737|Ga0098037_1153565All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium771Open in IMG/M
3300006752|Ga0098048_1001358All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium10811Open in IMG/M
3300006752|Ga0098048_1009760All Organisms → Viruses → Predicted Viral3437Open in IMG/M
3300006793|Ga0098055_1002443All Organisms → cellular organisms → Bacteria9634Open in IMG/M
3300006793|Ga0098055_1097845All Organisms → Viruses → Predicted Viral1148Open in IMG/M
3300006802|Ga0070749_10126547All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1498Open in IMG/M
3300006810|Ga0070754_10345135All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium660Open in IMG/M
3300006867|Ga0075476_10265977All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium608Open in IMG/M
3300006916|Ga0070750_10071491All Organisms → Viruses → Predicted Viral1643Open in IMG/M
3300006922|Ga0098045_1006291All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium3562Open in IMG/M
3300007345|Ga0070752_1200746All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium795Open in IMG/M
3300007622|Ga0102863_1249068All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium521Open in IMG/M
3300007623|Ga0102948_1011793All Organisms → Viruses → Predicted Viral3045Open in IMG/M
3300007718|Ga0102852_1009428All Organisms → Viruses → Predicted Viral1709Open in IMG/M
3300007862|Ga0105737_1050451All Organisms → Viruses → Predicted Viral1008Open in IMG/M
3300007955|Ga0105740_1062719All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300007974|Ga0105747_1181328All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium689Open in IMG/M
3300009000|Ga0102960_1008009All Organisms → Viruses → Predicted Viral4027Open in IMG/M
3300009000|Ga0102960_1008261All Organisms → Viruses → Predicted Viral3962Open in IMG/M
3300009001|Ga0102963_1002802All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium7687Open in IMG/M
3300009001|Ga0102963_1033988All Organisms → Viruses → Predicted Viral2128Open in IMG/M
3300009077|Ga0115552_1014628All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium3949Open in IMG/M
3300009077|Ga0115552_1055290All Organisms → Viruses → Predicted Viral1801Open in IMG/M
3300009193|Ga0115551_1457729All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium545Open in IMG/M
3300009433|Ga0115545_1030965All Organisms → Viruses → Predicted Viral2150Open in IMG/M
3300009443|Ga0115557_1141318All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium980Open in IMG/M
3300009472|Ga0115554_1011896All Organisms → Viruses → Predicted Viral4995Open in IMG/M
3300009495|Ga0115571_1066436All Organisms → Viruses → Predicted Viral1626Open in IMG/M
3300009497|Ga0115569_10013007All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium5366Open in IMG/M
3300009498|Ga0115568_10051532All Organisms → Viruses → Predicted Viral2170Open in IMG/M
3300009507|Ga0115572_10284126All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium941Open in IMG/M
3300009508|Ga0115567_10720439All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium597Open in IMG/M
3300009508|Ga0115567_10850107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium543Open in IMG/M
3300009593|Ga0115011_11491208All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium597Open in IMG/M
3300010389|Ga0136549_10198110All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium875Open in IMG/M
3300011118|Ga0114922_10350567All Organisms → Viruses → Predicted Viral1228Open in IMG/M
3300012920|Ga0160423_10020724All Organisms → Viruses → Predicted Viral4948Open in IMG/M
3300012920|Ga0160423_10046102All Organisms → Viruses → Predicted Viral3180Open in IMG/M
3300012920|Ga0160423_10496220All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium830Open in IMG/M
3300012928|Ga0163110_10018005All Organisms → Viruses → Predicted Viral4103Open in IMG/M
3300012952|Ga0163180_10079271All Organisms → Viruses → Predicted Viral2047Open in IMG/M
3300012953|Ga0163179_10377743All Organisms → Viruses → Predicted Viral1143Open in IMG/M
3300017713|Ga0181391_1006892All Organisms → Viruses → Predicted Viral2999Open in IMG/M
3300017746|Ga0181389_1008061All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium3598Open in IMG/M
3300017746|Ga0181389_1037023All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1466Open in IMG/M
3300017748|Ga0181393_1060469All Organisms → Viruses → Predicted Viral1020Open in IMG/M
3300017751|Ga0187219_1051134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1367Open in IMG/M
3300017755|Ga0181411_1068179All Organisms → Viruses → Predicted Viral1078Open in IMG/M
3300017755|Ga0181411_1087212All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium931Open in IMG/M
3300017758|Ga0181409_1181093All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium612Open in IMG/M
3300017762|Ga0181422_1018856All Organisms → Viruses → Predicted Viral2270Open in IMG/M
3300017762|Ga0181422_1200361All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium601Open in IMG/M
3300017762|Ga0181422_1212802All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium580Open in IMG/M
3300017763|Ga0181410_1066614All Organisms → Viruses → Predicted Viral1080Open in IMG/M
3300017764|Ga0181385_1170713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium658Open in IMG/M
3300017770|Ga0187217_1026310All Organisms → Viruses → Predicted Viral2070Open in IMG/M
3300017783|Ga0181379_1269338All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium584Open in IMG/M
3300017818|Ga0181565_10022921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium4625Open in IMG/M
3300017824|Ga0181552_10219748All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium971Open in IMG/M
3300017949|Ga0181584_10014361All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon5851Open in IMG/M
3300017951|Ga0181577_10086423All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium2183Open in IMG/M
3300017956|Ga0181580_10959099All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium531Open in IMG/M
3300017967|Ga0181590_10586068All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium765Open in IMG/M
3300017986|Ga0181569_10030476All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium3894Open in IMG/M
3300018415|Ga0181559_10097988All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1804Open in IMG/M
3300018416|Ga0181553_10053628All Organisms → Viruses → Predicted Viral2663Open in IMG/M
3300018426|Ga0181566_10585595All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium776Open in IMG/M
3300019459|Ga0181562_10462013All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium606Open in IMG/M
3300019751|Ga0194029_1047282All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium705Open in IMG/M
3300019765|Ga0194024_1000711All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon6665Open in IMG/M
3300020165|Ga0206125_10007879All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium8170Open in IMG/M
3300020175|Ga0206124_10315127All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium594Open in IMG/M
3300020267|Ga0211648_1004956All Organisms → Viruses → Predicted Viral3562Open in IMG/M
3300020347|Ga0211504_1003247All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium6275Open in IMG/M
3300020377|Ga0211647_10081965All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1131Open in IMG/M
3300020379|Ga0211652_10002463All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium5871Open in IMG/M
3300020408|Ga0211651_10021030All Organisms → Viruses → Predicted Viral3150Open in IMG/M
3300020419|Ga0211512_10358208All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium659Open in IMG/M
3300020421|Ga0211653_10452513All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium549Open in IMG/M
3300020437|Ga0211539_10392544All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium578Open in IMG/M
3300020439|Ga0211558_10033356All Organisms → Viruses → Predicted Viral2609Open in IMG/M
3300020449|Ga0211642_10078873All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300020451|Ga0211473_10022196All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium3112Open in IMG/M
3300020451|Ga0211473_10353502All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium753Open in IMG/M
3300020462|Ga0211546_10056526All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1916Open in IMG/M
3300020474|Ga0211547_10139957All Organisms → Viruses → Predicted Viral1258Open in IMG/M
3300021356|Ga0213858_10542828All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium533Open in IMG/M
3300021365|Ga0206123_10265223All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium741Open in IMG/M
3300021368|Ga0213860_10004492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium5707Open in IMG/M
3300021375|Ga0213869_10074345All Organisms → Viruses → Predicted Viral1703Open in IMG/M
3300021375|Ga0213869_10448979All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium519Open in IMG/M
3300021378|Ga0213861_10285808All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium854Open in IMG/M
3300021957|Ga0222717_10624130All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium562Open in IMG/M
3300021958|Ga0222718_10001128All Organisms → cellular organisms → Bacteria26707Open in IMG/M
3300021958|Ga0222718_10045447All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium2827Open in IMG/M
3300021964|Ga0222719_10052356All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium3106Open in IMG/M
3300022050|Ga0196883_1008197All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1225Open in IMG/M
3300022057|Ga0212025_1017479All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1139Open in IMG/M
3300022057|Ga0212025_1020594All Organisms → Viruses → Predicted Viral1067Open in IMG/M
3300022074|Ga0224906_1202972All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium540Open in IMG/M
3300022187|Ga0196899_1057431All Organisms → Viruses → Predicted Viral1253Open in IMG/M
3300022306|Ga0224509_10165193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium786Open in IMG/M
3300023108|Ga0255784_10026979All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium3642Open in IMG/M
3300024297|Ga0228658_1087137All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium777Open in IMG/M
3300024346|Ga0244775_10160014All Organisms → Viruses → Predicted Viral1899Open in IMG/M
3300024346|Ga0244775_10339658All Organisms → Viruses → Predicted Viral1241Open in IMG/M
3300025070|Ga0208667_1039350All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium805Open in IMG/M
3300025083|Ga0208791_1007303All Organisms → Viruses → Predicted Viral2825Open in IMG/M
3300025083|Ga0208791_1031203All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300025085|Ga0208792_1023467All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1266Open in IMG/M
3300025108|Ga0208793_1022748All Organisms → Viruses → Predicted Viral2181Open in IMG/M
3300025108|Ga0208793_1070745All Organisms → Viruses → Predicted Viral1026Open in IMG/M
3300025120|Ga0209535_1000181All Organisms → cellular organisms → Bacteria42650Open in IMG/M
3300025483|Ga0209557_1060347All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium913Open in IMG/M
3300025626|Ga0209716_1098388All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium837Open in IMG/M
3300025630|Ga0208004_1124940All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium584Open in IMG/M
3300025671|Ga0208898_1182510All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium528Open in IMG/M
3300025694|Ga0209406_1011615All Organisms → Viruses → Predicted Viral4390Open in IMG/M
3300025751|Ga0208150_1138224All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium778Open in IMG/M
3300025759|Ga0208899_1035354All Organisms → Viruses → Predicted Viral2290Open in IMG/M
3300025759|Ga0208899_1257685All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium514Open in IMG/M
3300025816|Ga0209193_1006841All Organisms → Viruses → Predicted Viral4368Open in IMG/M
3300025816|Ga0209193_1007104All Organisms → Viruses → Predicted Viral4257Open in IMG/M
3300025869|Ga0209308_10004584All Organisms → cellular organisms → Bacteria10871Open in IMG/M
3300025890|Ga0209631_10045348All Organisms → Viruses → Predicted Viral2937Open in IMG/M
3300025892|Ga0209630_10367930All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium632Open in IMG/M
3300025894|Ga0209335_10014528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium6010Open in IMG/M
3300026125|Ga0209962_1014677All Organisms → Viruses → Predicted Viral1448Open in IMG/M
3300027906|Ga0209404_10451277All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium845Open in IMG/M
3300028132|Ga0228649_1117445All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium651Open in IMG/M
3300028196|Ga0257114_1016633All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium3705Open in IMG/M
3300028197|Ga0257110_1085511All Organisms → Viruses → Predicted Viral1336Open in IMG/M
3300031785|Ga0310343_11535274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium503Open in IMG/M
3300032136|Ga0316201_10695331All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium865Open in IMG/M
3300032254|Ga0316208_1141713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium550Open in IMG/M
3300034374|Ga0348335_076128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1150Open in IMG/M
3300034418|Ga0348337_073804All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1224Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.34%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.04%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine11.04%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater10.39%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine9.09%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh7.79%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.55%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine3.90%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.25%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.25%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.60%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.60%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water2.60%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.95%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.95%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.30%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.30%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.30%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.30%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water1.30%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.65%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.65%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.65%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.65%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.65%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.65%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.65%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001346Pelagic Microbial community sample from North Sea - COGITO 998_met_01EnvironmentalOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001956Marine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007622Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02EnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020267Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556026-ERR599108)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020377Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065)EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020408Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118)EnvironmentalOpen in IMG/M
3300020419Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020437Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020449Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020462Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986)EnvironmentalOpen in IMG/M
3300020474Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022050Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)EnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022306Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24EnvironmentalOpen in IMG/M
3300023108Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaGEnvironmentalOpen in IMG/M
3300024297Seawater microbial communities from Monterey Bay, California, United States - 71DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025483Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025694Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300026125Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028132Seawater microbial communities from Monterey Bay, California, United States - 61DEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300031785Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MGEnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032254Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyriteEnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1001650553300000116MarineMCRDTGYYEPRDDVTNKVVEEMFEKQNKSLMAYYLKMAYQDDQHTYMNDLYWVLQNKFDDVDLEAVESHVEELLLIDDSDRELFEEDE*
DelMOSpr2010_1004846633300000116MarineMCMDRGYYEPRNDVAVKVVEEMVEKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFEDVNLDAVKDHVQELLAIDDEDEELFEGMLNERN*
DelMOSpr2010_1014263413300000116MarineMCRDTGYYEPRDDVAVKVVEEMIKKNNLSLMAYYLKMAYQEDQHTYMNDLQWVLQNKFNDVDLEAVKQHVEELLLIDDSDRGLFEEEE*
DelMOWin2010_10006318113300000117MarineMCMDKGYYSPRQDVTDKVVEEMFEKQNKSLMAYYLRMAYEDDQHTYMNDLYWVLQNRFEDVDLEEVKEHVKEMLAIDDSDEDMFEEMLDD*
JGI20151J14362_1010457323300001346Pelagic MarineMCRDTGYYEPRNDVAVKVVEEMVERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEEQE*
JGI20155J14468_1005720953300001354Pelagic MarineMCRDTGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEEQE*
JGI20158J14315_1014862313300001355Pelagic MarineVVEEMFEKQNKSLMAYYLKMAYQDDQHTYMNDLHWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEEQE*
JGI24003J15210_1000306853300001460MarineMCRDTGYYEPRQDVATKVVEEMFEKQNKSLMTYYLKMAYMDDQHTYMNDLYWVLQNKFKDVDLEAVKSHVEELLLIDDSDRELFDN*
GOS2266_101016073300001956MarineMCRNTGYYEPRDDVAVKVVEEMIRKNNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVNLEEVKEHTKEMLLIDDSDEDLFENMLEEE*
Ga0070742_1019617813300005942EstuarineMCRDTGYYNPRSDVTNKVVEEMIEKQNKSLMAYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKSHVEELLLIDDSDRELFEEEEDE*
Ga0075474_1003113743300006025AqueousMTGYYEPRDDVAVKVIEEMIKKNNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKEHTKEMLLIDDSDEDLFENMLEEE*
Ga0075462_1003586243300006027AqueousMDKGYYSPRQDVTDKVVEEMFEKQNKSLMAYYLRMAYEDDQHTYMNDLYWVLQNRFEDVDLEEVKEHVKEMLAIDDSDEDMFEEMLDD*
Ga0075507_144689723300006392AqueousMCMDRGYYEPRNDVAVKVVEEMVEKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFEDVNLDAVKDHVQELLAIDDEDEELFEGMLEE*
Ga0070744_1004773743300006484EstuarineMCRDTGYYEPRQDVTTKVVEEMFEKQNKSLMTYYLKMAYQDDQHTYMNDLHWVLQNKFDDVDLNAVKNHVEDMLLIDDSDRELFEEEE*
Ga0070744_1014405133300006484EstuarineMCRDTGYYEPRQDVAMKVVEEMVEKKNLDLMVYYLKMAYMEDQHTYMNDLYWVMRNQFDDVDLQAVAKHVEEMLLIDDSDKELFEEV*
Ga0098038_116409923300006735MarineMCRDTGYYEPRDDVAVKVVEEMIEKKNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVNLEAVKEHTKEMLLIDDSDDDLFENMLEEDES*
Ga0098037_115356513300006737MarineMCRNTGYYEPRDDVAVKVVEEMIEKKNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVNLKAVKEHTKEMLLIDDSDDDLFENMLEEDES*
Ga0098048_100135853300006752MarineMCRDTGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEDQHTYMNDLYWILQNKFEDVDLEAVESHVEELLLIDDSDRALFEKEDE*
Ga0098048_100976093300006752MarineMCRDTGYYEPRQDVTTKVVEEMFEKQNKSLMAYYLKMAYQDDQHTYMNDLHWVLQNKFNDVDLEAVKQHVEELLLIDDSDRGLFEEEE*
Ga0098055_1002443213300006793MarineMCRDTGYYEPRQDVAKKVVQEMVEKMNLDLMVYYLKMAYQEDQHTYMNDLYWVMQNKFDDVDQEAVARHVEELLRIDDTDKELFEQV*
Ga0098055_109784523300006793MarineMCRDTGYYEPRNDVAVKVVEEMVERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFDGVDLEAVKSHVEELLLIDDSDRELFEEDND*
Ga0070749_1012654753300006802AqueousMCMDRGYYEPRNDVAVKVVEEMVEKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFDDVNLDAVKDHVQELLAIDDEDEELFEGMLNG*
Ga0070754_1034513513300006810AqueousDDVAVKVVEEMIKKNNLSLMAYYLKMAYQEDQHTYMNDLQWVLQNKFNDVDLEAVKQHVEELLLIDDSDRGLFEEEE*
Ga0075476_1026597713300006867AqueousPRNDVAVKVVEEMVEKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFDDVNLDAVKDHVQELLAIDDEDEELFEGMLNG*
Ga0070750_1007149163300006916AqueousMCRDTGYYEPRQDVATKVVEEMFEKQNKSLMIYYLKMAYQDDQHTYMNDLYWVLQNKFNDVDLEAVKQHVEELLLIDDTDKELFEEEE*
Ga0098045_100629143300006922MarineMCRDTGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEDQHTYMNDLYWILQNKFEDVDLEAVESHVEELLLIDDSDRALFENEEDE*
Ga0070752_120074643300007345AqueousYEPRDDVAVKVVEEMIKKNNLSLMAYYLKMAYQEDQHTYMNDLQWVLQNKFNDVDLEAVKQHVEELLLIDDSDRGLFEEEE*
Ga0102863_124906823300007622EstuarineMCRDTGYYDPRSDVTNKVVEEMIEKKNKSLMAYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKSHVEELLLIDDSDRELFEEEEDE*
Ga0102948_101179353300007623WaterMCRDTGYYEPRDDVAVKVVEEMVEKKNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKQHVEELLLIDDSDRELFEEE*
Ga0102852_100942833300007718EstuarineMCRDTGYYNPRDDVTVKVVEEMIEKKNYSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKEHVEELLLIDDSDRGLFEEEEDE*
Ga0105737_105045123300007862Estuary WaterMCRDTGYYNPRSDVTNKVVEEMIEKQNKSLMAYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKEHVEELLLIDDSDRGLFEEEEDE*
Ga0105740_106271923300007955Estuary WaterMCRDTGYYNPRDDVTVKVVEEMIEKKNYSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKEHVEEL
Ga0105747_118132823300007974Estuary WaterMCRDTGYYNPRDDVTVKVVEEMIEKKNYSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKSHVEELLLIDDSDRELFEEEEDE*
Ga0102960_100800963300009000Pond WaterMCRDTGYYEPRNDVAVKVVEEMVERKNYSLMVYYLTMAYQEDQHTYMNDLQWVLQNKFEGVDLEAVKNHVEELLLIDDSDRELFEEIDK*
Ga0102960_100826133300009000Pond WaterMCRDTGYYEPRSDVTNKVVEEMFEKQNKSLMAYYLTMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKSHVEELLLIDDSDRELFEEDE*
Ga0102963_1002802153300009001Pond WaterMCRDTGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEDQHTYMNDLQWVLQNKFEGVDLEAVKNHVEELLLIDDSDRELFEEIDK*
Ga0102963_103398833300009001Pond WaterMCRDTGYYEPRDDVTVKVVEEMIEKKNYSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKSHVEELLLIDDSDRELFEEDE*
Ga0115552_101462843300009077Pelagic MarineMCRDTGYYEPRQDVAKKVVEEMVENKNLDLMVYYLKMAYMEDQHTYMNDLYWVMQNKFDDVDQQAVAKHVEDLLRIDDTDKELFEQV*
Ga0115552_105529023300009077Pelagic MarineMCRNTGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEEQE*
Ga0115551_145772913300009193Pelagic MarineTGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEEQE*
Ga0115545_103096553300009433Pelagic MarineMCRDTGYYEPRNDVTNKVVEEMFEKQNKSLMAYYLKMAYQDDQHTYMNDLHWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEEQE*
Ga0115557_114131833300009443Pelagic MarineMCRDTGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEDE*
Ga0115554_101189643300009472Pelagic MarineMCRDTGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEEQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEEQE*
Ga0115571_106643623300009495Pelagic MarineMCRDTGYYEPRNDVTNKVVEEMFEKQNKSLMAYYLKMAYQDDQHTYMNDLYWVLQNKFDDVDLEAVKQHVEELLLIDDSDRELFEEEQE*
Ga0115569_1001300763300009497Pelagic MarineMCRDTGYYEPRNDVTNKVVEEMFEKQNKSLMAYYLKMAYQDDQHTYMNDLHWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEDE*
Ga0115568_1005153223300009498Pelagic MarineMCRDTGYYEPRNDVAVKVVEEMVERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEDE*
Ga0115572_1028412623300009507Pelagic MarineMCRDTGYYEPRNDVTNKVVEEMFEKQNKSLMAYYLKMAYQDDQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEDE*
Ga0115567_1072043913300009508Pelagic MarineKRMCRDTGYYEPRQDVAKKVVEEMVENKNLDLMVYYLKMAYMEDQHTYMNDLYWVMQNKFDDVDQQAVAKHVEDLLRIDDTDKELFEQV*
Ga0115567_1085010713300009508Pelagic MarineMCRDTGYYEPRNDVAVKVVEEMVERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFE
Ga0115011_1149120813300009593MarineRLMCRDTGYYTPRHDVSVKVVEEMVEKKNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVNLEAVKEHTKEMLLIDDSDEDLFENMLEEE*
Ga0136549_1019811043300010389Marine Methane Seep SedimentMDRGYYEPRNDVAVKVVEEMVKKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFDDVNLDAVKDHVQELLAIDDEDEELFEGMLNG*
Ga0114922_1035056723300011118Deep SubsurfaceMCRDTGYYEPRQDVTNKVVEEMFETQNKSLMAYYLKMAYQDDQHTYMNDLQWVLQNKFDDVDLSAVKNHVEELLLIDDTDRELFEEEE*
Ga0160423_1002072463300012920Surface SeawaterMCMDKGYYSPRQDVTDKVVEEMFETQNKSLMAYYLRMAYEDDQHTYMNDLYWVLQNRFEDVDLEEVKEHVKEMLAIDDTDEGMFEELLDD*
Ga0160423_1004610223300012920Surface SeawaterMCRDTGYFTPRDDVSTKVVEEMAEKGNWSLMNYYLKMAYQEDQHTYMNDLYWVLQNRFEDIDLKAVKEHVKELLLIDDTDEDLFEGMLDD*
Ga0160423_1049622023300012920Surface SeawaterMCRDTGYYEPRDDVAVKVVEEMVEKKNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVNLKAVKEHTKEMLLIDDSDEDLFENMLEEE*
Ga0163110_1001800533300012928Surface SeawaterVEIERNNLMCRDTGYYEPRDDVSVKVVEEMIETKNYSLMTYYLKMAYQEDQHTYMNDLYWVLQNRFDDVDLDAVKQHTKEMLLIDDSDRDLFEEMLDD*
Ga0163180_1007927133300012952SeawaterMCRDTGYYNPRDDVAVKVVEEMIEKKNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNRFDDVNLEAVKEHTKEMLLIDDSDEDLFENMLEEE*
Ga0163179_1037774333300012953SeawaterMCRDTGYYNPRDDVSTKVVEEMAEKGNWSLMNYYLKMAYQDDQHTYMNDLYWVLQNRFEDVDLSAVKEHVKELLLIDDTDEDLFEGMLND*
Ga0181391_100689243300017713SeawaterMCRDTGYYDPRSDVTNKVVEEMIEKKNKSLMAYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKSHVEELLVIDDSDRELFEEDE
Ga0181389_100806153300017746SeawaterMCRDTGYYEPRQDVAMKVVQEMVEKKNLDLMVYYLKMAYVEDQHTYMNDLYWVMRNQFDDVDLQAVAKHVEEMLLIDDSDKELFEEV
Ga0181389_103702323300017746SeawaterMCRDTGYYNPRSDVTNKVVEEMIEKKNKSLMAYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKSHVEELLVIDDSDRELFEEDE
Ga0181393_106046923300017748SeawaterMCRDTGYYNPRDDVTVKVVEEMIEKKNYSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKSHVEELLVIDDSDRELFEEDE
Ga0187219_105113433300017751SeawaterVVIMCRDTGYYDPRSDVTNKVVEEMIEKKNKSLMAYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKSHVEELLVIDDSDRELFEEDE
Ga0181411_106817943300017755SeawaterMCRDTGYYEPRPDVTTKVVEEMFEKQNKSLMTYYLKMAYQDDQHTYMNDLQWVLQNKFDDVDLNAVKNHVEELLLIDDSDRELFEEEQ
Ga0181411_108721213300017755SeawaterMCRDTGYYDPRSDVTNKVVEEMIEKKNKSLMAYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKEHVEELLLIDDSDRGLFEEEEDE
Ga0181409_118109323300017758SeawaterMCRDTGYYEPRPDVTTKVVEEMFEKQNKSLMTYYLKMAYQDDQHTYMNDLQWVLQNKFDDVDLNAVKNHVEELLLIDDSDRELFEEEE
Ga0181422_101885613300017762SeawaterMCRDTGYYNPRDDVTVKVVEEMIEKKNYSLMVYYLKMAYQEDQHTYMNDLQWVLQNKFDDVDLKAVKSHVEELLLIDDSDRELFEEE
Ga0181422_120036133300017762SeawaterMCRDTGYYEPRQDVTTKVVEEIFEKQNKSLMTYYLKMAYQDDQHTYMNDLQWVLQNKFDDVDLNAVKNHVEELLLIDDSDRELFQEEE
Ga0181422_121280213300017762SeawaterMCRDTGYYEPRDDVTVKVVEEMIEKKYYSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKEHVEELLLIDDSDRGLFEEEEDE
Ga0181410_106661443300017763SeawaterMCRDTGYYEPRQDVAMKVVQEMVEKKNLDLMVYYLKMAYMEDQHTYMNDLYWVMRNQFDDVDLQAVAKHVEEMLLIDDSDKELFEEVXLRHLLNIIIRNI
Ga0181385_117071313300017764SeawaterMCRDTGYYEPRDDVSTKVVEEMAEKGNWSLMNYYLKMAYQDDQHTYMNDLYWVLQNRFEDVDLNAVKDHVKELLLIDDTDEDLFEGMLND
Ga0187217_102631043300017770SeawaterMCRDTGYYEPRQDVAMKVVEEMVEKKNLDLMVYYLKMAYMEDQHTYMNDLYWVMRNQFDDVDLQAVAKHVEEMLLIDDSDKELFEEV
Ga0181379_126933813300017783SeawaterNRRYVVIMCRDTGYYNPRDDVTVKVVEEMIEKKNYSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKEHVEELLLIDDSDRGLFEEEEDE
Ga0181565_1002292183300017818Salt MarshMCMDRGYYEPRNDVAVKVVEEMVKKKDYDLMVYYLKMAYQDDQHTYMNDLYWVLQNRFEDVNLDAVKDHVKEMLAIDDEDEELFEGMLNG
Ga0181552_1021974813300017824Salt MarshMCMDKGYYSPRQDVTDKVVEEMFETQNKSLMAYYLRMAYEDDQHTYMNDLYWVLQNRFKDVDLEEVKEHVKEMLAIDDTDEGMFEE
Ga0181584_10014361123300017949Salt MarshMDRGYYEPRNDVAVKVVEEMVKKKDYDLMVYYLKMAYQDDQHTYMNDLYWVLQNRFEDVNLDAVKDHVKEMLAIDDEDEELFEGMLNG
Ga0181577_1008642343300017951Salt MarshMCMDRGYYEPRQDVAVKVVEEMVKKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFEDVNLDAVKDHVQELLAIDDEDEELFEGMLNG
Ga0181580_1095909923300017956Salt MarshMCRNTGYYNPRDDVAVKVVEQMDKDNNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFEDIDLEAVKEHTKEMLLIDDSDKDLFEDILEDSEW
Ga0181590_1058606823300017967Salt MarshMDKGYYSPRQDVTDKVVEEMFETQNKSLMAYYLRMAYEDDQHTYMNDLYWVLQNRFKDVDLEEVKEHVKEMLAIDDTDEGMFEELLDD
Ga0181569_1003047683300017986Salt MarshEPRNDVAVKVVEEMVKKKDYDLMVYYLKMAYQDDQHTYMNDLYWVLQNRFEDVNLDAVKDHVKEMLAIDDEDEELFEGMLNG
Ga0181559_1009798863300018415Salt MarshMCMDRGYYEPRNDVAVKVVEEMVKKKDYDLMVYYLKMAYQDDQHTYMNDLYWVLQNRFEDVNLDAVKDHVKEMLAIDDEDEEL
Ga0181553_1005362853300018416Salt MarshMCMDKGYYSPRQDVTDKVVEEMFETQNKSLMAYYLRMAYEDDQHTYMNDLYWVLQNRFKDVDLEEVKEHVKEMLAIDDTDEGMFEELLDD
Ga0181566_1058559533300018426Salt MarshMDKGYYSPRQDVTDKVVEEMFETQNKSLMAYYLRMAHEDDQHTYMNDLYWVLQNRFKDVDLEEVKEHVKEMLAIDDTDEGMFEELLDD
Ga0181562_1046201323300019459Salt MarshMCMDKGYYSPRQDVTDKVVEEMFETQNKSLMAYYLRMAYEDDQHTYMNDLYWVLQNRFKDVDLEEVKEHVKEMLAIDDTDEGMFEELLND
Ga0194029_104728223300019751FreshwaterMCMDRGYYEPRNDVAVKVVEEMVEKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFEDVNLDAVKDHVQELLAIDDEDEELFEGMLNERN
Ga0194024_1000711143300019765FreshwaterMDRGYYEPRNDVAVKVVEEMVEKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFDDVNLDAVKDHVQELLAIDDEDEELFEGMLNG
Ga0206125_1000787943300020165SeawaterMCRDTGYYEPRQDVAKKVVEEMVENKNLDLMVYYLKMAYMEDQHTYMNDLYWVMQNKFDDVDQQAVAKHVEDLLRIDDTDKELFEQV
Ga0206124_1031512723300020175SeawaterMCRDTGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEDE
Ga0211648_100495623300020267MarineMCRDTGYYEPRDDVAVKVVEEMIETRNYSLMAYYLKMAYQEDQHTYMNDLYWVLQNKFGDVNLEAVKEHTKEMLLIDDSDRDLFENMLEEE
Ga0211504_100324773300020347MarineMCRDTGYYEPRDDVTTKVVEEMFEKQNKMLMGYYLKMAYQDDQHTYMNDLYWVLQNKFEDVDLKAVESHVEELLLIDDSDRYLFEEDE
Ga0211647_1008196523300020377MarineMCRDTGYYEPRDDVSVKVVEEMIETKNYSLMTYYLKMAYQEDQHTYMNDLYWVLQNRFDDVDLDAVKQHTKEMLLIDDSDRDLFEEMLDD
Ga0211652_1000246313300020379MarineMCRDTGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEDQHTYMNDLYWILQNKFEDVDLEAVESHVEELLLIDDSDRALFEKEDE
Ga0211651_1002103053300020408MarineMCRDTGYFTPRDDVSTKVVEEMAEKGNWSLMNYYLKMAYQEDQHTYMNDLYWVLQNRFEDIDLKAVKEHVKELLLIDDTDEDLFEGMLDD
Ga0211512_1035820813300020419MarineMCRDTGYYNPRDDVAVKVVEEMIEKKNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNRFDDVNLEAVKEHTKEMLLIDDSD
Ga0211653_1045251313300020421MarineKERKRMCRDTGYYEPRQDVAKKVVQEMVEKMNLDLMVYYLKMAYQEDQHTYMNDLYWVMQNKFDDVDQEAVARHVEELLRIDDTDKELFEQV
Ga0211539_1039254413300020437MarineMCRDTGYYEPRDDVSTKVVEEMAEKGNWSLMNYYLKMAYQDDQHTYMNDLYWVLQNRFDDVDLDAVKDHVRELLLIDDTDEDLFEGMLND
Ga0211558_1003335643300020439MarineMDKGYYSPRDDVAVKVVEEMYEKKNLSLMVYYLKMAYEDDQHTYMNDLYWVLQNRFEDVDLPAVKEHVKEMLAIDDTDEDMFEEMLDD
Ga0211642_1007887323300020449MarineMCRDTGYYEPRDDVAVKVVEEMIETRNYSLMAYYLKMAYQEDQHTYMNDLYWVLQNKFGDVNLEAVREHTKEMLLIDDSDRDLFENMLEEE
Ga0211473_1002219653300020451MarineMCRDTGYYEPRDDVSTKVVEEMAEKGNWSLMNYYLKMAYQDDQHTYMNDLYWVLQNRFEDVDLSAVKEHVKELLLIDDTDEDLFEGMLND
Ga0211473_1035350223300020451MarineMCRDTGYYNPRDDVAVKVVEEMIEKKNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVNLEAVKEHTKEMLLIDDSDEDLFENMLEEE
Ga0211546_1005652623300020462MarineMCRDTGYYNPRDDVAVKVVEEMIEKKNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNRFDDVNLEAVKEHTKEMLLIDDSDEDLFENMLEEDES
Ga0211547_1013995723300020474MarineMCRDTGYYNPRDDVAVKVVEEMIEKKNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNRFDDVNLEAVKEHTKEMLLIDDSDEDLFENMLEEE
Ga0213858_1054282823300021356SeawaterMCFDRGYYEPRNDVAVKVVEEMVEKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFEDVNLDAVKDHVQELLAIDDEDEELFEGMLNG
Ga0206123_1026522313300021365SeawaterMCRDTGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEEQE
Ga0213860_10004492153300021368SeawaterMCRDTGYYEPRQDVATKVVEEMFEKQNKSLMIYYLKMAYQDDQHTYMNDLYWVLQNKFNDVDLEAVKQHVEELLLIDDTDKELFEEEE
Ga0213869_1007434533300021375SeawaterMCRDTGYYEPRDDVTNKVVEEMFEKQNKSLMAYYLKMAYQDDQHTYMNDLYWVLQNKFDDVDLEAVESHVEELLLIDDSDRELFEEDE
Ga0213869_1044897923300021375SeawaterMCRDTGYYSPRDDVSVKVVEEMAEKKNWSLMIYYLKMAYQEDQHTYMNDLYWVLQNRFDDVDLEAVKEHVKEMLLIDSVDEDLFEGMLGD
Ga0213861_1028580813300021378SeawaterMCRDRGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVESHVEELLLIDDSDREL
Ga0222717_1062413023300021957Estuarine WaterMCRDTGYYEPRDDVTVKVVEEMIEKKNYSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKSHVEELLLIDDSDRELFEEDE
Ga0222718_10001128393300021958Estuarine WaterMCRDTGYYEPRNDVAVKVVEEMVERKNYSLMVYYLTMAYQEDQHTYMNDLQWVLQNKFEGVDLEAVKNHVEELLLIDDSDRELFEEIDK
Ga0222718_1004544763300021958Estuarine WaterMCRDTGYYEPRDDVAVKVVEEMVEKKNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKQHVEELLLIDDSDRELFEEE
Ga0222714_1051494613300021961Estuarine WaterKEIIMCRSTGYYEPREDVAKKVVDNMFERNERSLMVYCLRMAYQDNQHFYMNDIRWVLDNKFEDMDLEAIKEHTKEMLAIDSEDDDMFEDILEEE
Ga0222719_1005235663300021964Estuarine WaterDTGYYEPRDDVTVKVVEEMIEKKNYSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKSHVEELLLIDDSDRELFEEDE
Ga0196883_100819723300022050AqueousMTGYYEPRDDVAVKVIEEMIKKNNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKEHTKEMLLIDDSDEDLFENMLEEE
Ga0212025_101747913300022057AqueousIMCMDRGYYEPRNDVAVKVVEEMVEKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFEDVNLDAVKDHVQELLAIDDEDEELFEGMLNERN
Ga0212025_102059433300022057AqueousMCRDTGYYEPRDDVAVKVVEEMIKKNNLSLMAYYLKMAYQEDQHTYMNDLQWVLQNKFNDVDLEAVKQHVEELLLIDDSDRGLFEEEE
Ga0224906_120297223300022074SeawaterMCRDTGYYEPRDDVSVKVVEEMVEKKNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNRFDDVNLDAVKEHVKEMLLIDTVDEDLFEGLLDD
Ga0196899_105743113300022187AqueousMCMDRGYYEPRNDVAVKVVEEMVEKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFEDVNLDAVKDHVQELL
Ga0224509_1016519313300022306SedimentMCRDTGYYEPRQDVTTKVVEEMFEKQNKSLMTYYLKMAYQDDQHTYMNDLQWVLQNKFDDVDLNAVKNHVEELLLIDDSDRELFEEEE
Ga0255784_1002697973300023108Salt MarshMCMDRGYYEPRQDVAVKVVEEMVKKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNRFEDVNLDAVKDHVKEMLAIDDEDEELFEGMLNG
Ga0228658_108713713300024297SeawaterMCRDTGYYNPRDDVTVKVVEEMIEKKNYSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKEHVEELLLIDDSDRGLFEEEEDE
Ga0244775_1016001433300024346EstuarineMCRDTGYYNPRSDVTNKVVEEMIEKQNKSLMAYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKSHVEELLLIDDSDRELFEEEEDE
Ga0244775_1033965843300024346EstuarineMCRDTGYYEPRQDVTTKVVEEMFEKQNKSLMTYYLKMAYQDDQHTYMNDLHWVLQNKFDDVDLNAVKNHVEDMLLIDDSDRELFEEEE
Ga0208667_103935033300025070MarineMCRDTGYYEPRQDVTTKVVEEMFEKQNKSLMAYYLKMAYQDDQHTYMNDLHWVLQNKFNDVDLEAVKQHVEELLLIDDSDRGLFEEEE
Ga0208791_100730393300025083MarineKVVEEMFEKQNKSLMAYYLKMAYQDDQHTYMNDLHWVLQNKFNDVDLEAVKQHVEELLLIDDSDRGLFEEEE
Ga0208791_103120333300025083MarineMCRDTGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEDQHTYMNDLYWILQNKFEDVDLEAVESHVEELLLIDDSDR
Ga0208792_102346733300025085MarineVVIMCRDTGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEDQHTYMNDLYWILQNKFEDVDLEAVESHVEELLLIDDSDRALFEKEDE
Ga0208793_102274823300025108MarineMCRDTGYYEPRQDVAKKVVQEMVEKMNLDLMVYYLKMAYQEDQHTYMNDLYWVMQNKFDDVDQEAVARHVEELLRIDDTDKELFEQV
Ga0208793_107074543300025108MarineMCRDTGYYEPRNDVAVKVVEEMVERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFDGVDLEAVKSHVEELLLIDDSDRELFEEDND
Ga0209535_1000181433300025120MarineMCRDTGYYEPRQDVATKVVEEMFEKQNKSLMTYYLKMAYMDDQHTYMNDLYWVLQNKFKDVDLEAVKSHVEELLLIDDSDRELFDN
Ga0209557_106034723300025483MarineMCRDTGYYDPRSDVTNKVVEEMIEKQNKSLMAYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKSHVEELLLIDDSDRELFEEEEDE
Ga0209716_109838813300025626Pelagic MarineMCRDTGYYEPRNDVTNKVVEEMFEKQNKSLMAYYLKMAYQDDQHTYMNDLYWVLQNKFDDVDLEAVKQHVEELLLIDDSDRELFEEEQE
Ga0208004_112494023300025630AqueousMDKGYYSPRQDVTDKVVEEMFEKQNKSLMAYYLRMAYEDDQHTYMNDLYWVLQNRFEDVDLEEVKEHVKEMLAIDDSDEDMFEEMLDD
Ga0208898_118251023300025671AqueousDVAVKVVEEMVEKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFEDVNLDAVKDHVQELLAIDDEDEELFEGMLNERN
Ga0209406_101161563300025694Pelagic MarineMCRDTGYYEPRNDVAVKVVEEMVERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEDE
Ga0208150_113822413300025751AqueousGYYEPRDDVAVKVVEEMIKKNNLSLMAYYLKMAYQEDQHTYMNDLQWVLQNKFNDVDLEAVKQHVEELLLIDDSDRGLFEEEE
Ga0208899_103535413300025759AqueousGIMCRDTGYYEPRQDVATKVVEEMFEKQNKSLMIYYLKMAYQDDQHTYMNDLYWVLQNKFNDVDLEAVKQHVEELLLIDDTDKELFEEEE
Ga0208899_125768523300025759AqueousMCMDRGYYEPRNDVAVKVVEEMVEKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFDDVNLDAVKDHVQELLAIDDEDEELFEGMLNG
Ga0209193_100684193300025816Pelagic MarineMCRDTGYYEPRQDVAKKVVEEMVENKNLDLMVYYLKMAYMEDQHTYMNDLYWVMQNKFDDVDQQAVAKHVED
Ga0209193_100710493300025816Pelagic MarineRQDVAKKVVEEMVENKNLDLMVYYLKMAYMEDQHTYMNDLYWVMQNKFDDVDQQAVAKHVEDLLRIDDTDKELFEQV
Ga0209308_10004584253300025869Pelagic MarineMCRDTGYYEPRNDVTNKVVEEMFEKQNKSLMAYYLKMAYQDDQHTYMNDLHWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEDE
Ga0209631_1004534863300025890Pelagic MarineMCRDTGYYEPRNDVTNKVVEEMFEKQNKSLMAYYLKMAYQDDQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEDE
Ga0209630_1036793023300025892Pelagic MarineMCRDTGYYEPRNDVAVKVVEEMVERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEEQE
Ga0209335_10014528103300025894Pelagic MarineMCRDTGYYEPRNDVTNKVVEEMFEKQNKSLMAYYLKMAYQDDQHTYMNDLHWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEEQE
Ga0209962_101467753300026125WaterVTVKVVEEMIEKKNYSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKQHVEELLLIDDSDRELFEEE
Ga0209404_1045127723300027906MarineMCRDTGYYTPRHDVSVKVVEEMVEKKNLSLMVYYLKMAYQEDQHTYMNDLYWVLQNKFDDVNLEAVKEHTKEMLLIDDSDEDLFENMLEEE
Ga0228649_111744523300028132SeawaterMCRDTGYYDPRSDVTNKVVEEMIEKQNKSLMAYYLKMAYQEDQHTYMNDLYWVLQNKFDDVDLEAVKSHVEELLLIDDSDRELFEEDE
Ga0257114_101663373300028196MarineMCRDTGYYEPRQDVAMKVVQEMVEKKNLDLMVYYLKMAYMEDQHTYMNDLYWVMRNQFDDVDLQAVAKHVEEMLLIDDSDKELFEEV
Ga0257110_108551143300028197MarineMCRDTGYYNPRDDVATKVVEEMIEKQNKGLMAYYLKMAYQEDQHTYMNDLYWVLQNRFDNVDLEAVKEHVEELLLIDDSDRGLFEEEEDE
Ga0310343_1153527413300031785SeawaterKNLYKVEIERNNLMCRDTGYYEPRDDVSTKVVEEMAEKGNWSLMNYYLKMAYQDDQHTYMNDLYWVLQNRFDDVDLDAVKKHVKELLLIDDTDEDLFEGMLND
Ga0316201_1069533123300032136Worm BurrowCLMCMDRGYYEPRNDVAVKVVEEMVEKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFEDVNLDAVKDHVQELLAIDDEDEELFEGMLNERN
Ga0316208_114171313300032254Microbial MatMCRDRGYYEPRNDVAVKVVEEMIERKNYSLMVYYLTMAYQEDQHTYMNDLYWVLQNKFEGVDLEAVKQHVEELLLIDDSDRELFEEDE
Ga0348335_076128_511_7833300034374AqueousMDRGYYEPRNDVAVKVVEEMVEKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFEDVNLDAVKDHVQELLAIDDEDEELFEGMLNERN
Ga0348337_073804_213_4853300034418AqueousMDRGYYEPRNDVAVKVVEEMVEKKNYDLMVYYLKMAYQDDQHTYMNDLYWVLQNKFEDVNLDAVKDHVQELLVIDDEDEELFEGMLNENS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.