| Basic Information | |
|---|---|
| Family ID | F044503 |
| Family Type | Metagenome |
| Number of Sequences | 154 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MRRRNLTEYEKELIFEKWQDRTPTKVIALEMGVSYACVYFQLKKRYLVG |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 5.84 % |
| % of genes near scaffold ends (potentially truncated) | 29.22 % |
| % of genes from short scaffolds (< 2000 bps) | 62.99 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.73 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (42.208 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (20.779 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.701 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.96% β-sheet: 0.00% Coil/Unstructured: 61.04% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.73 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| a.4.1.5: Paired domain | d1k78a1 | 1k78 | 0.84256 |
| a.4.1.2: Recombinase DNA-binding domain | d1tc3c_ | 1tc3 | 0.80961 |
| a.294.1.1: Tex N-terminal region-like | d3bzca3 | 3bzc | 0.7663 |
| a.4.1.2: Recombinase DNA-binding domain | d1ijwc_ | 1ijw | 0.75382 |
| c.26.2.0: automated matches | d2e18a_ | 2e18 | 0.74951 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF14090 | HTH_39 | 36.36 |
| PF14297 | DUF4373 | 14.29 |
| PF05565 | Sipho_Gp157 | 7.79 |
| PF00145 | DNA_methylase | 1.95 |
| PF01381 | HTH_3 | 1.95 |
| PF04404 | ERF | 1.95 |
| PF04466 | Terminase_3 | 1.95 |
| PF04883 | HK97-gp10_like | 1.30 |
| PF06199 | Phage_tail_2 | 0.65 |
| PF05065 | Phage_capsid | 0.65 |
| PF04586 | Peptidase_S78 | 0.65 |
| PF12844 | HTH_19 | 0.65 |
| PF08291 | Peptidase_M15_3 | 0.65 |
| PF01510 | Amidase_2 | 0.65 |
| PF13884 | Peptidase_S74 | 0.65 |
| PF02195 | ParBc | 0.65 |
| PF13489 | Methyltransf_23 | 0.65 |
| PF05521 | Phage_H_T_join | 0.65 |
| PF05866 | RusA | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.95 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 1.95 |
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.65 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.65 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.79 % |
| Unclassified | root | N/A | 42.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000882|FwDRAFT_10309678 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 589 | Open in IMG/M |
| 3300002408|B570J29032_109958392 | Not Available | 12696 | Open in IMG/M |
| 3300002835|B570J40625_100010676 | Not Available | 16655 | Open in IMG/M |
| 3300003277|JGI25908J49247_10160287 | Not Available | 523 | Open in IMG/M |
| 3300003404|JGI25920J50251_10005456 | All Organisms → Viruses | 4512 | Open in IMG/M |
| 3300003404|JGI25920J50251_10034824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1461 | Open in IMG/M |
| 3300003429|JGI25914J50564_10012074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2711 | Open in IMG/M |
| 3300003429|JGI25914J50564_10055390 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300004126|Ga0066179_10053944 | Not Available | 943 | Open in IMG/M |
| 3300004481|Ga0069718_15117373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300005581|Ga0049081_10124122 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300005581|Ga0049081_10320190 | Not Available | 531 | Open in IMG/M |
| 3300005583|Ga0049085_10304928 | Not Available | 517 | Open in IMG/M |
| 3300005805|Ga0079957_1014742 | Not Available | 5695 | Open in IMG/M |
| 3300005805|Ga0079957_1146448 | Not Available | 1208 | Open in IMG/M |
| 3300005805|Ga0079957_1364653 | Not Available | 626 | Open in IMG/M |
| 3300006484|Ga0070744_10001168 | Not Available | 7780 | Open in IMG/M |
| 3300006484|Ga0070744_10120822 | Not Available | 755 | Open in IMG/M |
| 3300006802|Ga0070749_10225235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1068 | Open in IMG/M |
| 3300006802|Ga0070749_10388038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300006803|Ga0075467_10407518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
| 3300006920|Ga0070748_1036130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2008 | Open in IMG/M |
| 3300006920|Ga0070748_1095567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1136 | Open in IMG/M |
| 3300006920|Ga0070748_1104343 | Not Available | 1078 | Open in IMG/M |
| 3300006920|Ga0070748_1163165 | Not Available | 825 | Open in IMG/M |
| 3300006920|Ga0070748_1373805 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 500 | Open in IMG/M |
| 3300007538|Ga0099851_1000606 | All Organisms → Viruses | 15013 | Open in IMG/M |
| 3300007538|Ga0099851_1065222 | All Organisms → Viruses → Predicted Viral | 1416 | Open in IMG/M |
| 3300007538|Ga0099851_1123369 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300007538|Ga0099851_1325247 | Not Available | 539 | Open in IMG/M |
| 3300007542|Ga0099846_1045260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1676 | Open in IMG/M |
| 3300007542|Ga0099846_1155760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | 820 | Open in IMG/M |
| 3300007542|Ga0099846_1185466 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 739 | Open in IMG/M |
| 3300007542|Ga0099846_1240160 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 631 | Open in IMG/M |
| 3300008107|Ga0114340_1084325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1305 | Open in IMG/M |
| 3300008107|Ga0114340_1159979 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1346 | Open in IMG/M |
| 3300008108|Ga0114341_10002417 | Not Available | 18052 | Open in IMG/M |
| 3300008110|Ga0114343_1019471 | All Organisms → cellular organisms → Bacteria | 3037 | Open in IMG/M |
| 3300008114|Ga0114347_1083026 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1277 | Open in IMG/M |
| 3300008120|Ga0114355_1067494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1534 | Open in IMG/M |
| 3300008120|Ga0114355_1108717 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1071 | Open in IMG/M |
| 3300008262|Ga0114337_1051677 | Not Available | 2147 | Open in IMG/M |
| 3300008266|Ga0114363_1001793 | Not Available | 25246 | Open in IMG/M |
| 3300008266|Ga0114363_1017238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3244 | Open in IMG/M |
| 3300008266|Ga0114363_1070955 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300008450|Ga0114880_1095075 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300008450|Ga0114880_1257464 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 539 | Open in IMG/M |
| 3300008459|Ga0114865_1051713 | All Organisms → Viruses | 1607 | Open in IMG/M |
| 3300009009|Ga0105105_10218010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
| 3300009082|Ga0105099_10800410 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 590 | Open in IMG/M |
| 3300009152|Ga0114980_10007705 | All Organisms → Viruses | 7055 | Open in IMG/M |
| 3300009160|Ga0114981_10151484 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1279 | Open in IMG/M |
| 3300009164|Ga0114975_10001394 | Not Available | 17230 | Open in IMG/M |
| 3300009165|Ga0105102_10124092 | All Organisms → Viruses | 1236 | Open in IMG/M |
| 3300009169|Ga0105097_10238940 | Not Available | 1001 | Open in IMG/M |
| 3300009470|Ga0126447_1012432 | All Organisms → Viruses | 2163 | Open in IMG/M |
| 3300010316|Ga0136655_1132233 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 747 | Open in IMG/M |
| 3300010354|Ga0129333_10140325 | All Organisms → Viruses → Predicted Viral | 2220 | Open in IMG/M |
| 3300010885|Ga0133913_12322699 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1316 | Open in IMG/M |
| 3300011334|Ga0153697_1123 | Not Available | 26781 | Open in IMG/M |
| 3300011336|Ga0153703_1185 | Not Available | 22917 | Open in IMG/M |
| 3300011336|Ga0153703_1253 | Not Available | 19420 | Open in IMG/M |
| 3300011336|Ga0153703_1481 | Not Available | 13457 | Open in IMG/M |
| 3300012013|Ga0153805_1088759 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012665|Ga0157210_1000810 | Not Available | 11159 | Open in IMG/M |
| 3300012665|Ga0157210_1066668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300013004|Ga0164293_10097940 | Not Available | 2257 | Open in IMG/M |
| 3300013004|Ga0164293_10098447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2250 | Open in IMG/M |
| 3300013004|Ga0164293_10131014 | Not Available | 1887 | Open in IMG/M |
| 3300013005|Ga0164292_10430949 | Not Available | 875 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10116398 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1841 | Open in IMG/M |
| 3300013372|Ga0177922_10516099 | Not Available | 689 | Open in IMG/M |
| 3300014811|Ga0119960_1006624 | Not Available | 992 | Open in IMG/M |
| 3300017701|Ga0181364_1002711 | Not Available | 3150 | Open in IMG/M |
| 3300017701|Ga0181364_1032740 | Not Available | 839 | Open in IMG/M |
| 3300017722|Ga0181347_1057395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1166 | Open in IMG/M |
| 3300017761|Ga0181356_1177703 | Not Available | 644 | Open in IMG/M |
| 3300017761|Ga0181356_1243484 | Not Available | 515 | Open in IMG/M |
| 3300017774|Ga0181358_1014614 | All Organisms → cellular organisms → Bacteria | 3195 | Open in IMG/M |
| 3300017778|Ga0181349_1032407 | Not Available | 2099 | Open in IMG/M |
| 3300017778|Ga0181349_1092142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1142 | Open in IMG/M |
| 3300017784|Ga0181348_1042732 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Sphingobacterium → unclassified Sphingobacterium → Sphingobacterium sp. 1.A.4 | 1874 | Open in IMG/M |
| 3300017785|Ga0181355_1039993 | Not Available | 2011 | Open in IMG/M |
| 3300017785|Ga0181355_1303500 | Not Available | 598 | Open in IMG/M |
| 3300018048|Ga0181606_10369208 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300019784|Ga0181359_1003220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4953 | Open in IMG/M |
| 3300019784|Ga0181359_1005039 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin234 | 4258 | Open in IMG/M |
| 3300019784|Ga0181359_1074160 | Not Available | 1284 | Open in IMG/M |
| 3300019784|Ga0181359_1101619 | Not Available | 1053 | Open in IMG/M |
| 3300019784|Ga0181359_1218643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300020048|Ga0207193_1002988 | Not Available | 28916 | Open in IMG/M |
| 3300020048|Ga0207193_1072363 | All Organisms → Viruses | 3358 | Open in IMG/M |
| 3300020048|Ga0207193_1073081 | All Organisms → cellular organisms → Bacteria | 3334 | Open in IMG/M |
| 3300020048|Ga0207193_1141284 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2048 | Open in IMG/M |
| 3300020048|Ga0207193_1144262 | Not Available | 2017 | Open in IMG/M |
| 3300020159|Ga0211734_11308929 | Not Available | 774 | Open in IMG/M |
| 3300020543|Ga0208089_1009971 | Not Available | 1545 | Open in IMG/M |
| 3300021961|Ga0222714_10001389 | All Organisms → cellular organisms → Bacteria | 27290 | Open in IMG/M |
| 3300021963|Ga0222712_10275455 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300022063|Ga0212029_1003582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1613 | Open in IMG/M |
| 3300022063|Ga0212029_1006537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1329 | Open in IMG/M |
| 3300022190|Ga0181354_1003768 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3823 | Open in IMG/M |
| 3300022190|Ga0181354_1029880 | Not Available | 1777 | Open in IMG/M |
| 3300022190|Ga0181354_1077802 | Not Available | 1096 | Open in IMG/M |
| 3300022200|Ga0196901_1000361 | Not Available | 24159 | Open in IMG/M |
| 3300022200|Ga0196901_1050479 | All Organisms → Viruses → Predicted Viral | 1555 | Open in IMG/M |
| 3300022200|Ga0196901_1140785 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300022200|Ga0196901_1197055 | Not Available | 648 | Open in IMG/M |
| 3300022407|Ga0181351_1023722 | All Organisms → cellular organisms → Bacteria | 2602 | Open in IMG/M |
| 3300022407|Ga0181351_1251071 | Not Available | 551 | Open in IMG/M |
| 3300024346|Ga0244775_10000596 | Not Available | 44117 | Open in IMG/M |
| 3300024346|Ga0244775_10456614 | Not Available | 1047 | Open in IMG/M |
| 3300025543|Ga0208303_1029287 | All Organisms → Viruses → Predicted Viral | 1478 | Open in IMG/M |
| 3300025645|Ga0208643_1029266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1835 | Open in IMG/M |
| 3300025645|Ga0208643_1030349 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300025646|Ga0208161_1059709 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1178 | Open in IMG/M |
| 3300025647|Ga0208160_1003137 | Not Available | 6478 | Open in IMG/M |
| 3300025647|Ga0208160_1061045 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300027679|Ga0209769_1082687 | Not Available | 1051 | Open in IMG/M |
| 3300027689|Ga0209551_1018244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2386 | Open in IMG/M |
| 3300027693|Ga0209704_1062422 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1031 | Open in IMG/M |
| 3300027693|Ga0209704_1165716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300027715|Ga0208665_10288955 | Not Available | 514 | Open in IMG/M |
| 3300027732|Ga0209442_1198563 | Not Available | 744 | Open in IMG/M |
| 3300027759|Ga0209296_1018766 | All Organisms → cellular organisms → Bacteria | 3979 | Open in IMG/M |
| 3300027785|Ga0209246_10082888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1251 | Open in IMG/M |
| 3300027808|Ga0209354_10153185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
| 3300027973|Ga0209298_10013997 | All Organisms → Viruses → Predicted Viral | 4165 | Open in IMG/M |
| 3300031758|Ga0315907_11055984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300031787|Ga0315900_10470408 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 964 | Open in IMG/M |
| 3300031857|Ga0315909_10022396 | Not Available | 6321 | Open in IMG/M |
| 3300031857|Ga0315909_10791653 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031951|Ga0315904_10082400 | All Organisms → Viruses → Predicted Viral | 3440 | Open in IMG/M |
| 3300031951|Ga0315904_10524331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1039 | Open in IMG/M |
| 3300031951|Ga0315904_10550487 | Not Available | 1005 | Open in IMG/M |
| 3300031951|Ga0315904_11274105 | Not Available | 558 | Open in IMG/M |
| 3300031999|Ga0315274_10241537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2203 | Open in IMG/M |
| 3300032093|Ga0315902_10011020 | All Organisms → Viruses | 11917 | Open in IMG/M |
| 3300033992|Ga0334992_0000548 | Not Available | 30895 | Open in IMG/M |
| 3300033992|Ga0334992_0018180 | Not Available | 4414 | Open in IMG/M |
| 3300033995|Ga0335003_0050824 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2225 | Open in IMG/M |
| 3300033995|Ga0335003_0097983 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium → unclassified Chryseobacterium → Chryseobacterium sp. | 1520 | Open in IMG/M |
| 3300033996|Ga0334979_0000348 | Not Available | 36190 | Open in IMG/M |
| 3300033996|Ga0334979_0005304 | Not Available | 9051 | Open in IMG/M |
| 3300033996|Ga0334979_0018186 | Not Available | 4770 | Open in IMG/M |
| 3300033996|Ga0334979_0323002 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 871 | Open in IMG/M |
| 3300033996|Ga0334979_0373770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
| 3300033996|Ga0334979_0700998 | Not Available | 528 | Open in IMG/M |
| 3300034012|Ga0334986_0005016 | Not Available | 10148 | Open in IMG/M |
| 3300034019|Ga0334998_0000655 | Not Available | 29755 | Open in IMG/M |
| 3300034061|Ga0334987_0269093 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1149 | Open in IMG/M |
| 3300034066|Ga0335019_0329688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
| 3300034104|Ga0335031_0000910 | Not Available | 22768 | Open in IMG/M |
| 3300034106|Ga0335036_0232879 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1257 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 20.78% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.18% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.64% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.84% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.90% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.90% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 3.25% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.60% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.95% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.95% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.30% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.30% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.30% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.65% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.65% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.65% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.65% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.65% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.65% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.65% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008459 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020543 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FwDRAFT_103096781 | 3300000882 | Freshwater And Marine | EYQKELIFEMWQDRTPIKVIALEMGRSYACIYSHLKSRYLVG* |
| B570J29032_10995839217 | 3300002408 | Freshwater | MRGRNLTEYQKELIFEAWQDRKQIKVIAQEMGLSYGCIYFQLKKRSLVG* |
| B570J40625_1000106767 | 3300002835 | Freshwater | MRGRNLTEYEKELIFKAWQDRKQIKVIAQEMGLSYGCIYFQLKKRSLVG* |
| JGI25908J49247_101602871 | 3300003277 | Freshwater Lake | MRGRNLTDQDKKRIFELWQDRIPTKVIALELGRSYACIYNQLKSRNLVG* |
| JGI25920J50251_100054561 | 3300003404 | Freshwater Lake | MRRKNLTDQDKKRIFELWQDRIPTKVIALELGRSYACIYNQLKSRNLVG* |
| JGI25920J50251_100348243 | 3300003404 | Freshwater Lake | MDGLKNMRQRNLTEYQKELIFEKWQDRKTIKVIALEMGRSYACIYSHLKSRYLVG* |
| JGI25914J50564_100120744 | 3300003429 | Freshwater Lake | MDGLKNMRQRNLTEYQKELIFEKWQDRTPIKVIALEMGRSYACIYSHLKSRYLVG* |
| JGI25914J50564_100553902 | 3300003429 | Freshwater Lake | MRGRNLTEHEKKMIFELWQDRIPTKVIALELGRSYACIYNQLKSRNLVG* |
| Ga0066179_100539441 | 3300004126 | Freshwater Lake | MKERGRNLTEYQKELIQEKRGEGKPIKVIALEIGRSYSCIYFH |
| Ga0069718_151173732 | 3300004481 | Sediment | MRRRNLTEYEKELIFEKWQDRTPTKVIALEMGVSYACVYFQLKKRYLVG* |
| Ga0049081_101241222 | 3300005581 | Freshwater Lentic | MKRRNLTEYEKELIFEKWQDRIPTKVIALEFGVTYSCIYQQLKKLNLVG* |
| Ga0049081_103201902 | 3300005581 | Freshwater Lentic | RNLTEHDKERIFELWQNRTPTKAIAIELGRSYACIYFHLKRRNLVG* |
| Ga0049085_103049282 | 3300005583 | Freshwater Lentic | MRGRNLTEHEKKMIFELWQDRMPTKVIALEIGRSYTCIYNQLKSRNLVG* |
| Ga0079957_10147424 | 3300005805 | Lake | MRRRNLTEYEKELIFERWQDRIPTKVIAIELGVTYSCIYQQLKKRYLVG* |
| Ga0079957_11464482 | 3300005805 | Lake | MRRRNLTEYEKELIFERWQDRIPTKVIALELGVTYSCVYQQLKKRYLVG* |
| Ga0079957_13646533 | 3300005805 | Lake | MRRRNLTEYEKELIFEKWQDRIPTKVIALELGVTYSCVYQQLKKRNLVG* |
| Ga0070744_1000116816 | 3300006484 | Estuarine | MRRRNLTEYEKIVIFEKWQDRVPTKVIAMEMGVSYMCIFNQLKKRCLVG* |
| Ga0070744_101208223 | 3300006484 | Estuarine | MRRRNLTEYEKIMIFERWQDRTPTKVIALEFGVSYMCIYNQLKSRNLVG* |
| Ga0070749_102252351 | 3300006802 | Aqueous | IFEKWQDRKPIKVIALEMGRSYGCIYFQLKQRSLVG* |
| Ga0070749_103880382 | 3300006802 | Aqueous | MRGRNLTDYEKEVIFEKWQDRKPIKVIALEMGRSYGCIYFHLKQRSLVG* |
| Ga0075467_104075182 | 3300006803 | Aqueous | MRGRNLTDYEKEVIFEKWQERKPIKVIALEMGRSYGCIYFQLKQRSLVG* |
| Ga0070748_10361303 | 3300006920 | Aqueous | MRGRNLTDYEKEVIFEKWQDRKPIKVIALEMGRSYGCIYFQLKQRSLVG* |
| Ga0070748_10955671 | 3300006920 | Aqueous | SCTLFFEKMRGRNLTEYEKEVIFEKWQDRKPIKVIALEMGRSYGCIYFQLKQRSLVG* |
| Ga0070748_11043431 | 3300006920 | Aqueous | MRGRNLTDYEKEVIFEKWQDRKPIKVIALEMGRSYGCIYFH |
| Ga0070748_11631653 | 3300006920 | Aqueous | MRGRNLTEYEKEVIFEKWQERKPIKVIALEMGRSYGCIYFQLKQRSLVG* |
| Ga0070748_13738051 | 3300006920 | Aqueous | NLTEYDKEVIFEKWQERKPIKVIALEMGRSYGCIYFHLKQRSLVG* |
| Ga0099851_100060620 | 3300007538 | Aqueous | MRRRNLTEYEKIVIFEMWQDRVPTKVIALTLGVTYSCIYQQLKKRYLVG* |
| Ga0099851_10652224 | 3300007538 | Aqueous | MRRRNLTEYEKELIFEKWQERTPTKVIAIELGASYACIYFHLKKRNLVG* |
| Ga0099851_11233692 | 3300007538 | Aqueous | MRRRNLTEYEKELIFERWQDRIPTKVIAIEFGVTYSCIYQQLKKRYLVG* |
| Ga0099851_13252473 | 3300007538 | Aqueous | MRRQNLTEIQKEAIFLMWQDRVPIKVIAITFGKTYACIHQYLRKRCLVG* |
| Ga0099846_10452607 | 3300007542 | Aqueous | MRRRNLTEYEKELIFERWQDRIPTKVIAIELGVTYSCIYQ |
| Ga0099846_11557603 | 3300007542 | Aqueous | LGKMRRRNLTEYEKELIFERWQDRIPTKVIAIELGVTYSCIYQQLKKRYLVG* |
| Ga0099846_11854661 | 3300007542 | Aqueous | RNLTEYEKELIFEKWQERTPTKVIAIELGASYACIYFHLKKRNLVG* |
| Ga0099846_12401602 | 3300007542 | Aqueous | MRRRNITEYEKELIFEMWQDRIPTKVIALTLGVTYSCIHQQLKKRSLVG* |
| Ga0114340_10843253 | 3300008107 | Freshwater, Plankton | MRGRNLTEYEKELIFEAWKDRKQIKVIAQEMGLSYGCIYFQLKKRCLVG* |
| Ga0114340_11599791 | 3300008107 | Freshwater, Plankton | MRRRNLTEYEKIVIFEKWQDRIPTKVIAMEMGVSYMCIYNQLKKRYLVG* |
| Ga0114341_1000241714 | 3300008108 | Freshwater, Plankton | MRGRNLTEYEKELIFEAWQDRKQIKVIAQEMGLSYGCIYFQLKKRCLVG* |
| Ga0114343_10194714 | 3300008110 | Freshwater, Plankton | MRRRNLTEYEKIVIFEMWQDRVPTKVIALTLGVTYSCIHQQLKKRSLVG* |
| Ga0114347_10830261 | 3300008114 | Freshwater, Plankton | ILTADEKQLIFEMWQDRTPTKVIAIKLNRTYACIYFQLKKRYLVG* |
| Ga0114355_10674946 | 3300008120 | Freshwater, Plankton | MRGRSLTEYEKELIFEAWQDRKQIKVIAQEMGLSYGCIYFQLKRRSLV |
| Ga0114355_11087173 | 3300008120 | Freshwater, Plankton | TEHEKELIFEGWQDRKPIKVIAIEMGLSYGCIYFQLKKRCLVG* |
| Ga0114337_10516773 | 3300008262 | Freshwater, Plankton | MRRRNLTEYEKIVIFEKWQDRIPTKVIAMEMGVSYMCIYNQLKKRCLVG* |
| Ga0114363_100179326 | 3300008266 | Freshwater, Plankton | MRRRNLTEYEKEVIFERWQDRIPTKVIAIEFGVSYMCIYNQLKRRNLVG* |
| Ga0114363_10172388 | 3300008266 | Freshwater, Plankton | MRGRSLTEYEKELIFEAWQDRKQIKVIAQEMGLSYGCIYFQLKRRSLVG* |
| Ga0114363_10709553 | 3300008266 | Freshwater, Plankton | MRRRNLTEYEKELIFERWQDRIPTKVIAIELGVTYSCVYQQLKKRYLVG* |
| Ga0114880_10950751 | 3300008450 | Freshwater Lake | YEKELIFERWQDRIPTKVIAIELGVTYSCVYQQLKKRYLVG* |
| Ga0114880_12574641 | 3300008450 | Freshwater Lake | MRGRNLTEYEKELIFEAWQDRKQIKVIAQEMGLSYGCIYFQLKKRSLVG* |
| Ga0114865_10517134 | 3300008459 | Freshwater Lake | IFEGWQDRKPIKVIAIELGRCYGTVYTELKKRYLVG* |
| Ga0105105_102180102 | 3300009009 | Freshwater Sediment | MRGRNLTEYQKELIFEGWQDRKPIKVIALELGVSYMCVYNQLKKRYLVG* |
| Ga0105099_108004102 | 3300009082 | Freshwater Sediment | QKELIFEGWQERKPIKVIAMEMGLSYGCIYFQLKKRSLVG* |
| Ga0114980_1000770512 | 3300009152 | Freshwater Lake | MRGRNLTEYEKNLIFEAWQDRKQIKVIAQEMGLSYGCIYFQLKRRSLVG* |
| Ga0114981_101514842 | 3300009160 | Freshwater Lake | MRGRNLTEHEKELIFEAWQDRKQIKVIAQEMGLSYGCIYFQLKRRSLVG* |
| Ga0114975_100013947 | 3300009164 | Freshwater Lake | MRRRNLTETEKELIFERWQDRIPTKVIALELGVTYACVFFHLKRRYLVG* |
| Ga0105102_101240921 | 3300009165 | Freshwater Sediment | LTEYEKELNFSRWQDRIPTKVIALELGVSYMCVYNQLKKRYLVG* |
| Ga0105097_102389402 | 3300009169 | Freshwater Sediment | MRGRNLTEYQKELIFEGWQDRKPIKVIAMEMGLSYGCIYFQLKKRCLVG* |
| Ga0126447_10124323 | 3300009470 | Meromictic Pond | MDGLKNIRGRNLTEYDKELIFEKWQDRKPIKVIALEMGRSYGCIYFQLKQRSLVG* |
| Ga0136655_11322332 | 3300010316 | Freshwater To Marine Saline Gradient | EKELIFKKWQDRTPTKVIALEMGVSYACIYFQLKKRNLVG* |
| Ga0129333_101403254 | 3300010354 | Freshwater To Marine Saline Gradient | EKWQDRKPIKVIALEMGRSYGCIYFQLKQRSLVG* |
| Ga0133913_123226991 | 3300010885 | Freshwater Lake | GSKLSPIQMRRRNLTETEKELIFERWQDRIPTKVIALELGVTYACVFFHLKRRYLVG* |
| Ga0153697_11232 | 3300011334 | Freshwater | MRRRYLTEYEKELIFERWQDRIPTKVIAIELGVSYMCVYNQLKKRYLVG* |
| Ga0153703_118520 | 3300011336 | Freshwater | MRRRNLTEYEKELIFEMWQDRIPTKVIALELGVSYMCIFNQLKKRYLVG* |
| Ga0153703_125326 | 3300011336 | Freshwater | MRRRYLTEYEKELIFERWQDRIPTKVIALELGVSYMCVYNQLKKRYLVG* |
| Ga0153703_148117 | 3300011336 | Freshwater | MRRRNLTEYEKELIFEMWQDRIPTKVIALKLGVSYMCIFNQLKKRYLVG* |
| Ga0153805_10887592 | 3300012013 | Surface Ice | MRRKNLTDQDKKRIFELWQDRIPTKVIALELGRSYACIYKQLKSRNLVG* |
| Ga0157210_10008102 | 3300012665 | Freshwater | MRRRNLTEYEKIVIFEMWQDRVPTKVIAMEMGVSYMCIYNQLKKRSLVG* |
| Ga0157210_10666682 | 3300012665 | Freshwater | MRGRSLTEYQKELIFEAWQDQKQIKVIAQEMGLSYGCIYFQLKKRSLVG* |
| Ga0164293_100979402 | 3300013004 | Freshwater | MRRRNLTEYEKIVIFERWQDRVPTKVIAMEMGVSYMCIFNQLKKRSLVG* |
| Ga0164293_100984472 | 3300013004 | Freshwater | MRGRSLTEYEKELIFEGWRDRKQIKVIAQEMGLSYGCIYFQLKKRCLVG* |
| Ga0164293_101310142 | 3300013004 | Freshwater | MRGRNLTEYDKERIFELWQDRTTTKVIAVELGRSYACIYFHLKRRNLVG* |
| Ga0164292_104309493 | 3300013005 | Freshwater | MRRRNLTEYEKELIFERWQDRIPTKVIAIEFGVSYMCIYNQLKRRNLVG* |
| (restricted) Ga0172367_101163983 | 3300013126 | Freshwater | MMRRRNLTIYEKELIFERWQDRIPTKVIALEFGVTYSCIYQQLKKRYLVG* |
| Ga0177922_105160993 | 3300013372 | Freshwater | MRRKNLTDQDKKRIFELWQDRIPTKVIALELGRSY |
| Ga0119960_10066241 | 3300014811 | Aquatic | MRRRNLTEYEKELIFERWQDRIPTKVIAIEFGVSYMCIYNQLKKRYLVG* |
| Ga0181364_10027111 | 3300017701 | Freshwater Lake | MKGRNLTEYEKELIFEAWQDRKQIKVIAQEMGLSYGCIYFQLKRRSLVG |
| Ga0181364_10327401 | 3300017701 | Freshwater Lake | MRRKNLTDQDKKRIFELWQDRIPTKVIALELGRAYACIYNQLKSRNRVG |
| Ga0181347_10573952 | 3300017722 | Freshwater Lake | MRGRNLTEYEKELIFEAWQERKQIKVIAQEMGLSYGCIYFQLKRRCLVG |
| Ga0181356_11777031 | 3300017761 | Freshwater Lake | MRGRNLTEYEKELIFEAWQDRKQIKVIAQEMGLSYGCVYFQLKKRSLVG |
| Ga0181356_12434841 | 3300017761 | Freshwater Lake | MGVKKLTEHEKRMIFELWQDRTPTKVIALELGRSYTCIYKQLKSRNLV |
| Ga0181358_10146148 | 3300017774 | Freshwater Lake | KRGDRHGYAREWQKSCTVFCKKMKGRNLTEYEKELIFEAWQDRKQIKVIAQEMGLSYGCIYFQLKRRSLVG |
| Ga0181349_10324078 | 3300017778 | Freshwater Lake | MRRKNLTDQDKKRIFELWQDRIPTKVIALELGRSYACI |
| Ga0181349_10921422 | 3300017778 | Freshwater Lake | MRQRNLTEYQKELIFEKWQDRKSTKVIALEMGRSYSCIYSHLKSRYLVG |
| Ga0181348_10427324 | 3300017784 | Freshwater Lake | EYQKELIFEKWQDRTQIKVIALEMGRSYSCIYSHLKSRYLVG |
| Ga0181355_10399931 | 3300017785 | Freshwater Lake | MRRKNLTDQDKKRIFELWQDRIPTKVIALELGRSYACIYNQ |
| Ga0181355_13035003 | 3300017785 | Freshwater Lake | MRRKNLTDQDKKRIFELWQDRIPTKVIALELGRSYACIYN |
| Ga0181606_103692081 | 3300018048 | Salt Marsh | KMRGRNLTEYDKEIIFEKWQERKPIKVIALEMGRSYGCIYFQLKQRSLVG |
| Ga0181359_10032202 | 3300019784 | Freshwater Lake | MRGRNLTEYEKELIFESWQDRKQIKVIAQEMGLSYGCIYFYLKRRCLVG |
| Ga0181359_10050398 | 3300019784 | Freshwater Lake | MRRKNLTEHEKKMIFELWQDRIPTKAIALELGRSYTCIYNQLKSRNLVG |
| Ga0181359_10741604 | 3300019784 | Freshwater Lake | MRGRNLTDQDKKRIFELWQDRIPTKVIALELGRSYACIYNQLKSRNLVG |
| Ga0181359_11016194 | 3300019784 | Freshwater Lake | MRGRNLTEHEKKMIFELWQDRIPTKVIALELGRSYACIYN |
| Ga0181359_12186431 | 3300019784 | Freshwater Lake | ELIYERWQDRTPTKVIALELGVTYSCIYQQLKKRYLVG |
| Ga0207193_100298828 | 3300020048 | Freshwater Lake Sediment | MRRRNLTEYEKQLIFEKWQDRTPTKVIALEMGVSYMCIYNQLKKRYLVG |
| Ga0207193_10723638 | 3300020048 | Freshwater Lake Sediment | MRGRNLTEYQKELIFEGWQDRKPIKVIALELGVSYMCVYNQLKKRYLVG |
| Ga0207193_10730813 | 3300020048 | Freshwater Lake Sediment | MRRRNLTEYEKEVIFERWQDRIPTKVIAIEFGVSYMCIYNQLKRRNLVG |
| Ga0207193_11412842 | 3300020048 | Freshwater Lake Sediment | MRRRNLTEYEKIVIFEMWQDRVPTKVIAMEMGVSYMCIFNQLKKRSLVG |
| Ga0207193_11442622 | 3300020048 | Freshwater Lake Sediment | MRRRNLTEYEKELIFERWQDRIPTKVIAIEFGVSYMCIYNQLKRRNLVG |
| Ga0211734_113089291 | 3300020159 | Freshwater | MTNGGRGRNLTDYQIELISEKEKEGKSIKVIAHEIGRSYSCIYFHLKK |
| Ga0208089_10099711 | 3300020543 | Freshwater | MRGRNLTEYEKELIFKAWQDRKQIKVIAQEMGLSYGCIYFQLKKRSLVG |
| Ga0222714_100013895 | 3300021961 | Estuarine Water | MRRRNLTEYEKELIFEMWQDRTPTKVIAIELGASYACIYFHLKKRNLVG |
| Ga0222712_102754552 | 3300021963 | Estuarine Water | MRRRNLTEYEKIVIFEKWQDRVPTKVIALEMGVSYMCIYNQLKKRCLVG |
| Ga0212029_10035821 | 3300022063 | Aqueous | MRRRNLTEYEKELIFERWQDRIPTKVIAIELGVTYSCIYQQLKKRYLVG |
| Ga0212029_10065373 | 3300022063 | Aqueous | ITEYEKIVIFEMWQDRVPTKVIALTLGVTYSCIYQQLKKRYLVG |
| Ga0181354_10037683 | 3300022190 | Freshwater Lake | MRGRNLTEYDKQLIFEAWQDRKATKVIAQEMGRSYACIYFHLKRRYLVG |
| Ga0181354_10298802 | 3300022190 | Freshwater Lake | MRRKNLTDQDKKRIFELWQDRIPTKVIALELGRSYACIYNQLKSRNLVG |
| Ga0181354_10778024 | 3300022190 | Freshwater Lake | MRRKNLTDQDKKRIFELWQDRIPTKVIALELGRSYACIYNQLKS |
| Ga0196901_100036121 | 3300022200 | Aqueous | MRRRNLTEYEKIVIFEMWQDRVPTKVIALTLGVTYSCIYQQLKKRYLVG |
| Ga0196901_10504791 | 3300022200 | Aqueous | MRRRNLTEYEKELIFEKWQERTPTKVIAIELGASYACIYFHLKKRNLVG |
| Ga0196901_11407852 | 3300022200 | Aqueous | TMRRRNLTEYEKELIFERWQDRIPTKVIAIELGVTYSCIYQQLKKRYLVG |
| Ga0196901_11970553 | 3300022200 | Aqueous | MRRRNLTEYEKELIFEKWQDRIPTKVIALELGVTYSCIYQQLKKRYL |
| Ga0181351_10237223 | 3300022407 | Freshwater Lake | MDGLKNMRQRNLTEYQKELIFEKWQDRTPIKVIALEMGRSYACIYSHLKSRYLVG |
| Ga0181351_12510711 | 3300022407 | Freshwater Lake | MKERGRNLTEYQKELIQEKRGEGKPIKVIALEIGRSYSCIYFHLKNN |
| Ga0244775_1000059649 | 3300024346 | Estuarine | MRRRNLTEYEKIVIFEKWQDRVPTKVIAMEMGVSYMCIFNQLKKRCLVG |
| Ga0244775_104566141 | 3300024346 | Estuarine | MRRRNLTEYEKIMIFERWQDRTPTKVIALEFGVSYMCIYNQLKSRNLVG |
| Ga0208303_10292873 | 3300025543 | Aqueous | MRGRNLTDYEKEVIFEKWQERKPIKVIALEMGRSYGCIYFQLKQRSLVG |
| Ga0208643_10292663 | 3300025645 | Aqueous | MRGRNLTDYEKEVIFEKWQDRKPIKVIALEMGRSYGCIYFQLKQRSLVG |
| Ga0208643_10303492 | 3300025645 | Aqueous | MRGRNLTEYEKEVIFEKWQERKPIKVIALEMGRSYGCIYFQLKQRSLVG |
| Ga0208161_10597093 | 3300025646 | Aqueous | MRRQNLTEIQKEAIFLMWQDRVPIKVIAITFGKTYACIHQYLRKRCLVG |
| Ga0208160_10031373 | 3300025647 | Aqueous | MRRRNLTEYEKELIFEKWQDRKATKVIALEMGLSYACIYFHLKKRNLVG |
| Ga0208160_10610452 | 3300025647 | Aqueous | MRRRNLTEYEKELIFERWQDRIPTKVIAIEFGVTYSCIYQQLKKRYLVG |
| Ga0209769_10826874 | 3300027679 | Freshwater Lake | MRGRNLTEHEKKMIFELWQDRIPTKVIALELGRSYACIYNQLKSRNLVG |
| Ga0209551_10182444 | 3300027689 | Freshwater Lake | MDGLKNMRQRNLTEYQKELIFEKWQDRKTIKVIALEMGRSYACIYSHLKSRYLVG |
| Ga0209704_10624223 | 3300027693 | Freshwater Sediment | MKRRRNLTEYEKEVIFEKWQDRVPTKVIAIEMGVSYMCIYNQLKKRYLVG |
| Ga0209704_11657161 | 3300027693 | Freshwater Sediment | TMRGRNLTEYQKELIFEGWQDRKPIKVIALELGVSYMCVYNQLKKRYLVG |
| Ga0208665_102889553 | 3300027715 | Deep Subsurface | MRRRNLTEFEKELIFERWQDRIPTKVIALELGVTYSCVFFHLKRR |
| Ga0209442_11985631 | 3300027732 | Freshwater Lake | MDGLKNMRQRNLTEYQKELIFEKWQDRKTIKVIALEMGRSYACIYSHLKSR |
| Ga0209296_10187663 | 3300027759 | Freshwater Lake | MRRRNLTETEKELIFERWQDRIPTKVIALELGVTYACVFFHLKRRYLVG |
| Ga0209246_100828884 | 3300027785 | Freshwater Lake | MRQQNLTEYQKELIFEKWQDRTPIKVIALEMGRSYSCIYSHLKSRYLVG |
| Ga0209354_101531852 | 3300027808 | Freshwater Lake | MRQRNLTEYQKELIFEKWQDRTRIKVIALEMGRSYSCIYSHLKSRYLVG |
| Ga0209298_100139977 | 3300027973 | Freshwater Lake | MRGRNLTEYEKNLIFEAWQDRKQIKVIAQEMGLSYGCIYFQLKRRSLVG |
| Ga0315907_110559842 | 3300031758 | Freshwater | MRRRNLTEYEKELIFEKWQDRIPTKVIALELGVTYSCVYQQLKKRNLVG |
| Ga0315900_104704082 | 3300031787 | Freshwater | LIFEGWQDRKPIKIIAIELGRCYGTIYTELKRRDLVG |
| Ga0315909_1002239617 | 3300031857 | Freshwater | MRRRNLTEYEKELIFERWQDRIPTKVIALELGVTYSCVYQQLKKRYLVG |
| Ga0315909_107916531 | 3300031857 | Freshwater | KELIFERWQDRIPTKVIAIELGVTYSCVYQQLKKRYLVG |
| Ga0315904_100824002 | 3300031951 | Freshwater | MRGRNLTEHEKELIFEGWQDRKPIKVIAIEMGLSYGCIYFQLKKRCLVG |
| Ga0315904_105243312 | 3300031951 | Freshwater | MRRRNLTEYEKELIFERWQDRIPTKVIAIEFGVSYMCIYNQLKSRNLVG |
| Ga0315904_105504874 | 3300031951 | Freshwater | MRRRNLTEYEKELIFERWQDRIPTKVIAIELGVTYSCVYQQLKKRYLVG |
| Ga0315904_112741052 | 3300031951 | Freshwater | MRGRSLTEYEKELIFEAWQDRKQIKVIAQEMGLSYGCIYFQLKRRSLVG |
| Ga0315274_102415372 | 3300031999 | Sediment | MRGRNLTEYEKDLIFEAWQDRKQIKVIAQEIGRSYACIYFHLKRRYLVG |
| Ga0315902_100110201 | 3300032093 | Freshwater | ELIFKGWQDRKPIKVIALEMGLSYGCIYFQLKKRSLVG |
| Ga0334992_0000548_24658_24807 | 3300033992 | Freshwater | MRGRNLTEYQKELIFEAWQDRKQIKVIAHEMGLSYGCIYFQLKKRCLVG |
| Ga0334992_0018180_2281_2430 | 3300033992 | Freshwater | MRGRNLTEYDKELIFDAWQDRKQIKVIAQEMGRSYACIYFHLKRRSLVG |
| Ga0335003_0050824_1680_1829 | 3300033995 | Freshwater | MRGRNLTEYDKELIFEAWQERKQIKVIAQEMGRSYACIYFHLKRRCLVG |
| Ga0335003_0097983_2_133 | 3300033995 | Freshwater | MRGRNLTEYDKERIFELWQDRTPTKVIALELGRSYTCIYFHLKR |
| Ga0334979_0000348_11787_11936 | 3300033996 | Freshwater | MRGRSLTEYEKELIFEGWRDRKQIKVIAQEMGLSYGCIYFQLKKRCLVG |
| Ga0334979_0005304_1923_2072 | 3300033996 | Freshwater | MRHRNLTEYEKQLIFEKWQDRTPTKVIALEMGVSYMCIYYQLKKRNLVG |
| Ga0334979_0018186_4114_4263 | 3300033996 | Freshwater | MRGRNLTEYDKERIFELWQDRTTTKVIAVELGRSYACIYFHLKRRNLVG |
| Ga0334979_0323002_10_159 | 3300033996 | Freshwater | MRGRNLTEYQKQLIFEAWQDRKQIKVIAQEMGLSYGCIYLQLKKRSLVG |
| Ga0334979_0373770_5_154 | 3300033996 | Freshwater | MRGRNLTEYQKELIFEGWQDRKPIKVIAMEMGLSYGCIYFQLKKRCLVG |
| Ga0334979_0700998_1_132 | 3300033996 | Freshwater | MRGRNLTEYQKELIFEGWQDRKPIKVIAMEMGLSYGCIYFQLKK |
| Ga0334986_0005016_6913_7062 | 3300034012 | Freshwater | MRGRNLTEHQKELIFEGWQDRKPIKVIAIEMGLSYGCIYFQLKKRCLVG |
| Ga0334998_0000655_23017_23184 | 3300034019 | Freshwater | MDGLKNMRGRNLTEYQKELIFEAWQDRKQIKVIAQEMGLSYGCIYFQLKKRSLVG |
| Ga0334987_0269093_1_123 | 3300034061 | Freshwater | QKELIFEGWQDRKPIKVIAMEMGLSYGCIYFQLKKRCLVG |
| Ga0335019_0329688_837_950 | 3300034066 | Freshwater | IIFEAWQDRKPIKVIAIELGRCYGTVYTELRKRNLVG |
| Ga0335031_0000910_6242_6391 | 3300034104 | Freshwater | MRGRNLTEYQKQLIFEAWQDRKQIKVIAQEMGLSYGCIYFQLKKRSLVG |
| Ga0335036_0232879_1056_1223 | 3300034106 | Freshwater | MDGLKNMRGRNLTEYQKELIFEAWQDRKQIKVIAQEMGLSYGCIYFQLKKRCLVG |
| ⦗Top⦘ |