 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F044495 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 154 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MNKFEKALVALAVAGTVGFAFAFAALKGIPEAFDWELDDEESYE |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 87.58 % |
| % of genes near scaffold ends (potentially truncated) | 18.83 % |
| % of genes from short scaffolds (< 2000 bps) | 61.69 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.779 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.494 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.234 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 34.72% β-sheet: 0.00% Coil/Unstructured: 65.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF11753 | DUF3310 | 49.35 |
| PF13384 | HTH_23 | 18.18 |
| PF01930 | Cas_Cas4 | 9.74 |
| PF00154 | RecA | 1.30 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.30 |
| PF14579 | HHH_6 | 1.30 |
| PF07691 | PA14 | 1.30 |
| PF11397 | GlcNAc | 1.30 |
| PF13662 | Toprim_4 | 0.65 |
| PF13155 | Toprim_2 | 0.65 |
| PF12855 | Ecl1 | 0.65 |
| PF10145 | PhageMin_Tail | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 9.74 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 1.30 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.78 % |
| All Organisms | root | All Organisms | 29.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.39% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 10.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.79% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 7.14% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.19% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.60% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.95% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.95% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.95% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 1.30% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.65% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.65% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.65% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.65% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.65% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300027132 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027154 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24766J26685_100002425 | 3300002161 | Freshwater And Sediment | MNKIEXTXXAXAVXGXVGFGFAXAVLKGIPEAFDWELDEEENYE* |
| JGI24766J26685_100236374 | 3300002161 | Freshwater And Sediment | KTMNKFEKALVAIAVAGSVGFAFALAALKGIPETFDWESDEEESYE* |
| B570J29032_1095549892 | 3300002408 | Freshwater | MNKLEKALVALAVIGTVGFGFAISVLKGIPEAFDWEEDDE* |
| B570J29032_1098281884 | 3300002408 | Freshwater | MSKFEKALVALAVAGTVGFAFAFATLKGIPEAFDWELDDEESYE* |
| B570J29032_1099006074 | 3300002408 | Freshwater | MNKFEKTLIALAVAGTVGFGFAFAVLKGIPEAFDWELDEEEDYE* |
| B570J29032_1099264823 | 3300002408 | Freshwater | MNKVEKALVALAVAGSVGFAFAFAVLKGIPETFDWESDEEESYE* |
| B570J40625_1000849445 | 3300002835 | Freshwater | MNKFEKALVAIAVAGSVGFAFALAALKGIPETFDWESDEEESYE* |
| B570J40625_1002250452 | 3300002835 | Freshwater | MSRFEKALVAMAVVGMVGFGFAIATLKGIPEAFDWEEDDE* |
| B570J40625_1002715143 | 3300002835 | Freshwater | MNKFEKALIALAVAGSVGFAFAFAALKGIPETFDWESDEEESYE* |
| B570J40625_1008607772 | 3300002835 | Freshwater | MNKFEKTLVALAVAGTVGFSFAFAVLKGVPEAFDWDLDEEENYE* |
| JGI25917J50250_10014483 | 3300003395 | Freshwater Lake | MNKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWETDDE* |
| JGI25917J50250_10973852 | 3300003395 | Freshwater Lake | MNKFEKTLIALAVAGAVGFSFAFAVLKGVPEAFDWEEDDE* |
| JGI25922J50271_100005177 | 3300003413 | Freshwater Lake | MSKVEKTLIAIAVAGMVGFGFAIASLKGIPEAFDWEEDDSE* |
| JGI25921J50272_100124434 | 3300003430 | Freshwater Lake | VEKALVALAVAGTVGFAFAFAALKGIPEAFDWELDEEESYE* |
| JGI25926J51410_10027235 | 3300003490 | Freshwater Lake | MNKVEKAFVALAVAGTVGFVFAFAALKGIPEAFDWDIEEEIDNEF* |
| JGI25926J51410_10199711 | 3300003490 | Freshwater Lake | MNRVEKALVALAVTGAVGFAFAFAALKGIPESFDWELDEEESYE* |
| JGI25925J51416_101341591 | 3300003497 | Freshwater Lake | SKVEKTLVALAIAGTVGFAFAFAALKGIPEAFDWEEDDE* |
| Ga0063233_101310053 | 3300003986 | Freshwater Lake | MSKVEKTLVALAIAGTVGFAFAFAALKGIPEAFDWEEDDE* |
| Ga0066177_102713892 | 3300004096 | Freshwater Lake | MNKFEKTLIALAVAGTVGFAFAFAALKGIPEVFEWELDEEESYE* |
| Ga0066177_102774703 | 3300004096 | Freshwater Lake | MSKFEKALVALAVAGTVGFAFAFAALKGIPEAFDWDTEEEIDNEF* |
| Ga0066178_100423844 | 3300004124 | Freshwater Lake | KALVSLAVAGAVGFSFAFALLKGIPETFDWELDEEENYE* |
| Ga0007761_1138143510 | 3300004792 | Freshwater Lake | MNKIEKALVALAVAGAVGFSFAFALLKGIPETFDWELDEEENYE* |
| Ga0070374_100037545 | 3300005517 | Freshwater Lake | MNKFEKALVAIAIAGTVGFAFAFAALKGIPEAFDWEPDEEESYE* |
| Ga0070374_100162545 | 3300005517 | Freshwater Lake | EVETMSKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWELDEEESYE* |
| Ga0070374_100314791 | 3300005517 | Freshwater Lake | EVETMSKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWETDDE* |
| Ga0070374_100883093 | 3300005517 | Freshwater Lake | MNKIEKALVALAIAGTVGFAFAFAALKGIPEAFDWEPDDE* |
| Ga0070374_104387113 | 3300005517 | Freshwater Lake | SKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWETDDE* |
| Ga0070374_106192223 | 3300005517 | Freshwater Lake | MNKVEKALVALAVTGAVGFAFAFAALKGIPESFDWEPDDE* |
| Ga0068876_107953601 | 3300005527 | Freshwater Lake | IKTMNKIEKTLVAVAVVGMVGFGFAIAVLKGIPEAFDWELDEEENYE* |
| Ga0049082_1000001928 | 3300005584 | Freshwater Lentic | MSKVEKALVAIAVVGMVGFGFAITALKGIPEAFDWEEDDE* |
| Ga0078894_100436064 | 3300005662 | Freshwater Lake | MSKVEKALVAIAVAGTVGFAFAFAALRGIPEAFDWELDEEESHE* |
| Ga0078894_101166693 | 3300005662 | Freshwater Lake | MNKVEKTLVALAVAGTVGFAFAFAALKGIPEAFDWESDDE* |
| Ga0078894_101354815 | 3300005662 | Freshwater Lake | MKKLEKTLIAVAVIGMVGFGFAIAVLKGIPEAFDWEVDDE* |
| Ga0078894_101726043 | 3300005662 | Freshwater Lake | MNKFEKALVALAVAGSVGFAFAFAALKGIPETFDWESDEEESYE* |
| Ga0078894_104010505 | 3300005662 | Freshwater Lake | MSKVEKALVALAVAGTVGFAFAFAALKGIPEAFDW |
| Ga0078894_104753193 | 3300005662 | Freshwater Lake | MNKFEKALVALAVAGSVGFAFAFAALKGIPETFDWETDEEESYE* |
| Ga0078894_106332344 | 3300005662 | Freshwater Lake | MSKFEKALVAIAVVGMVGFGFAIATLTGIPEAFDWEEDD |
| Ga0078894_111894392 | 3300005662 | Freshwater Lake | MSKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWETDDE* |
| Ga0070743_102186833 | 3300005941 | Estuarine | MSKVEKALVAIAVAGTVGFAFAFAALKGIPEAFDWEEEDE* |
| Ga0070743_102988932 | 3300005941 | Estuarine | MNKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWESDDE* |
| Ga0070744_100277214 | 3300006484 | Estuarine | MNKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWEEDDE* |
| Ga0070744_100640212 | 3300006484 | Estuarine | MSKLEKTLVAIAVVGMVGFGFAIATLTGIPEAFDWEEDDE* |
| Ga0079302_10309811 | 3300007165 | Deep Subsurface | MNKFEKALVAIAVAGSVGFAFAFAALKGIPETFDWESDEEESYE* |
| Ga0102879_10596863 | 3300007549 | Estuarine | MSKFEKALVALAVAGTVGFAFAFAALKGIPEAFDWETDDE* |
| Ga0102880_11277742 | 3300007550 | Estuarine | MSKVEKALVALAVAGSVGFAFAFAALKGIPETFDWESDEEESYE* |
| Ga0102817_10456944 | 3300007555 | Estuarine | MNKFEKALVALAVAGSVGFAFAFAALKGIPETFDW |
| Ga0102821_11579381 | 3300007557 | Estuarine | ETMNRVEKALVALAVTGAVGFAFAFAALKGIPESFDWELDEEESYE* |
| Ga0102917_12483413 | 3300007590 | Estuarine | MSKFEKALVALAVAGTVGFAFAFAALKGIPEAFDWESDDE* |
| Ga0102824_11275791 | 3300007681 | Estuarine | MNKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWESDD |
| Ga0102859_10863433 | 3300007708 | Estuarine | MNKFEKTLIALAVAGTVGFSFAFAVLKGVPESFDWEVEEDDE* |
| Ga0114340_10056244 | 3300008107 | Freshwater, Plankton | MSKFEKALVALAVAGTVGFAFAFAALKGIPEAFDWELDDEESYE* |
| Ga0114340_10259237 | 3300008107 | Freshwater, Plankton | MNKIEKTLVAVAVVGMVGFGFAIAVLKGIPEAFDWELDEEENYE* |
| Ga0114341_103408781 | 3300008108 | Freshwater, Plankton | KFEKALIALAVAGTVGFAFAFAALKGIPEAFDWELDDEESYE* |
| Ga0114346_10396283 | 3300008113 | Freshwater, Plankton | MNKIEKVLVATAIVGMVGFGFAISVLRGIPEAFDWEEDDER* |
| Ga0114346_10634572 | 3300008113 | Freshwater, Plankton | MNKFEKTLIAVAVVGMVGFGFAISALKGIPEAFDWEEDDE* |
| Ga0114336_10811964 | 3300008261 | Freshwater, Plankton | MSKFEKALIALAVAGTVGFAFAFAALKGIPEAFDWELDDEESYE* |
| Ga0114336_13199091 | 3300008261 | Freshwater, Plankton | LVALAVAGTVGFAFAFAALKGIPEAFDWELDDEESYE* |
| Ga0102831_10206864 | 3300008996 | Estuarine | MNRVEKSLVALAVTGAVGFAFAFAALKGIPESFDWELDEEESYE* |
| Ga0102831_11577131 | 3300008996 | Estuarine | WIKEVETMNKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWESDDE* |
| Ga0102830_11288433 | 3300009059 | Estuarine | MSKVEKALVAIAVAGTVGFAFAFAALRGIPEVFDWDLEEEIDDEF* |
| Ga0102812_102326711 | 3300009086 | Estuarine | MSKVEKALVAIAVAGTVGFAFAFAALKGIPEAFDWERDDE* |
| Ga0114980_100059185 | 3300009152 | Freshwater Lake | MKRIEKTLIALAVAGAVGFSFAFALLKGIPETFDWELDEEENYE* |
| Ga0114980_100135872 | 3300009152 | Freshwater Lake | MNRVEKALVALAVTGAVGFAFAFTALKGIPESFDWELDEEESYE* |
| Ga0114977_101911824 | 3300009158 | Freshwater Lake | MSKVEKALVALAIAGTVGFAFAFAALKGIPEAFDWEDDE* |
| Ga0114979_107849312 | 3300009180 | Freshwater Lake | MNKFEKALVALAVAGTVGFAFAFAALRGIPEAFDWETDDE* |
| Ga0114982_10271743 | 3300009419 | Deep Subsurface | MNKLEKALVALAVAGSVGFAFAFAALKGIPETFDWESDEEESYE* |
| Ga0129333_100577409 | 3300010354 | Freshwater To Marine Saline Gradient | MNKFEKALIALAVAGSVGFAFAFAALRGIPETFDWESDEEESYE* |
| Ga0133913_132021432 | 3300010885 | Freshwater Lake | MNRVEKALVALAVTGAVGFAFAFAALKGIPESFDWEPDEEESYE* |
| Ga0139557_10119625 | 3300011010 | Freshwater | MNKIEKALVSLAVAGAVGFSFAFALLKGIPETFDWELDEEENYE* |
| Ga0139557_10613403 | 3300011010 | Freshwater | MSKFEKTLIALAVAGAVGFSFAFAVLKGVPESFDWETDDE* |
| Ga0136709_10476152 | 3300011184 | Freshwater | MNKFEKALVAIAVAGSVGFAFAFAALKGIPETFDWELDEEEDHER* |
| Ga0157138_10303241 | 3300012352 | Freshwater | MNKFEKTMVGLAVVGMVGFGFAIATLRGIPEAFDWEEDDE* |
| Ga0157203_10008265 | 3300012663 | Freshwater | MNKIEKALIALAVVGSVGFAFAFTILKGVPEAFDWEEDDE* |
| Ga0157210_10014714 | 3300012665 | Freshwater | MNKFEKALVALAVAGSVGFAFAFSALKGIPETFDWESDEEESYE* |
| Ga0164294_104985442 | 3300013006 | Freshwater | MSRLEKALVALAVTGAVGFAFAFAALKGIPESFDWELDEEESYE* |
| Ga0177922_103357651 | 3300013372 | Freshwater | MKRIEKTLIALAVAGAVGFSFAFALLKGIPETFDWELDEEENY |
| Ga0181362_11140442 | 3300017723 | Freshwater Lake | MNKIEKALVALAVAGTVGFAFAFAALKGIPEAFDWETDDE |
| Ga0181358_12194932 | 3300017774 | Freshwater Lake | MNKFEKTLIALAVAGAVGFSFAFAVLKGVPEAFDWEEDDE |
| Ga0181349_10262622 | 3300017778 | Freshwater Lake | MNKIEKALVALAVAGAVGFSFAFALLKGIAETFDWELDEEENYE |
| Ga0181359_100016011 | 3300019784 | Freshwater Lake | MNKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWETDDE |
| Ga0207193_10746205 | 3300020048 | Freshwater Lake Sediment | MNKFEKALVALAVAGSVGFAFAFAALKGIPETFDWESDEEESYE |
| Ga0211732_11594477 | 3300020141 | Freshwater | MSKFEKALVALAVAGTVGFAFAFAALKGIPEAFDWEVDDEESYE |
| Ga0211732_11854482 | 3300020141 | Freshwater | MSKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWEEDDE |
| Ga0211732_118561513 | 3300020141 | Freshwater | MSKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWETDDE |
| Ga0211732_12512952 | 3300020141 | Freshwater | MNKFEKALVALAIAGTVGFAFAFAALKGIPEAFDWEEDDE |
| Ga0211732_13323203 | 3300020141 | Freshwater | MNKVEKALVALAVAGAVGFAFAFAALKGIPEAFDWESDDE |
| Ga0211736_105453266 | 3300020151 | Freshwater | MNKIEKALVALAVAGTVGFAFAFAALKGIPEAFDWEPDDE |
| Ga0211736_106810134 | 3300020151 | Freshwater | MSKFEKALVALAVAGTVGFAFAFAALKGIPEAFDWELDDEESYE |
| Ga0211736_109763633 | 3300020151 | Freshwater | MNKAEKSLVAIAVIGMVGFGFAISVLKGIPEAFDWELDEEEHDE |
| Ga0211726_104337101 | 3300020161 | Freshwater | IWIKEIKAMNKFEKALVALAIAGTVGFAFAFAALKGIPEAFDWEEDDE |
| Ga0211731_101897753 | 3300020205 | Freshwater | MNKVEKALVALAVTGAVGFAFAFAALKGIPESFDWETDDE |
| Ga0211731_107954594 | 3300020205 | Freshwater | MNKVEKSLVAIAVIGMVGFGFAISVLKGIPEVFDWEIDEEQQDE |
| Ga0208091_10066742 | 3300020506 | Freshwater | MNKVEKALVALAVAGSVGFAFAFAVLKGIPETFDWESDEEESYE |
| Ga0207941_10266273 | 3300020539 | Freshwater | MNKLEKALVALAVIGTVGFGFAISVLKGIPEAFDWEEDDE |
| Ga0208597_10400643 | 3300020562 | Freshwater | MNKFEKTLIALAVAGTVGFGFAFAVLKGIPEAFDWELDEEEDYE |
| Ga0207909_10163612 | 3300020572 | Freshwater | MNKFEKALVAIAVAGSVGFAFALAALKGIPETFDWESDEEESYE |
| Ga0222712_104736403 | 3300021963 | Estuarine Water | MSKFEKTLVAMAVVGMVGFGFAIATLKGIPEAFDWEEDDE |
| Ga0181354_10016683 | 3300022190 | Freshwater Lake | MNKIEKALVALAVAGAVGFSFAFALLKGIPETFDWELDEEENYE |
| Ga0181351_12622612 | 3300022407 | Freshwater Lake | MNKFEKALVAIAIAGTVGFAFAFAALKGIPEAFDWEPDEEESYE |
| Ga0214921_100007646 | 3300023174 | Freshwater | MSKIEKALVAIAVAGTVGFAFAFAALRGIPEAFDWEEDDE |
| Ga0244775_100534514 | 3300024346 | Estuarine | MSKVEKALVAIAVAGTVGFAFAFAALKGIPEAFDWEEEDE |
| Ga0244775_101018254 | 3300024346 | Estuarine | MSKLEKTLVAIAVVGMVGFGFAIATLTGIPEAFDWEEDDE |
| Ga0244775_104351024 | 3300024346 | Estuarine | MNRVEKSLVALAVTGAVGFAFAFAALKGIPESFDWELDEEES |
| Ga0244775_105356103 | 3300024346 | Estuarine | MNKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWEEDDE |
| Ga0244775_105620492 | 3300024346 | Estuarine | MNKFEKALVALAVAGTVGFAFAFAALKGIPEAFDWELDDEESYE |
| Ga0244775_105724622 | 3300024346 | Estuarine | MNKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWESDDE |
| Ga0244775_114432063 | 3300024346 | Estuarine | GERREEVEEALVALAVAGTVGFAFAFAALRGIPEAFDWELDEEEFHDE |
| Ga0244776_101814425 | 3300024348 | Estuarine | MNKFEKTLIALAVAGTVGFSFAFAVLKGVPESFDWEVEEDDE |
| Ga0244776_106072103 | 3300024348 | Estuarine | MSKVEKALVAIAVVGMVGFGFAITALKGIPEAFDWEEDDE |
| Ga0244776_106776043 | 3300024348 | Estuarine | MNKVEKVLVALAVVGTVGFAFAFSALKGIPETFDWEEDDE |
| Ga0255110_10028595 | 3300027132 | Freshwater | MNKIEKALVALAIAGTVGFAFAFAALKGIPEAFDWEPDDE |
| Ga0255114_10529163 | 3300027145 | Freshwater | MNKVEKALVALAVIGAVGFAFAFTALKGVPEAFDWEEDDE |
| Ga0255111_11016541 | 3300027154 | Freshwater | LPCKIWIKEVKTMNKVEKALVALAVIGAVGFAFAFTALKGVPEAFDWEEDDE |
| Ga0208439_10264113 | 3300027278 | Estuarine | MSKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWESDDE |
| Ga0208022_10042334 | 3300027418 | Estuarine | MNRVEKSLVALAVTGAVGFAFAFAALKGIPESFDWELDEEESYE |
| Ga0209552_100002732 | 3300027563 | Freshwater Lake | MNKVEKAFVALAVAGTVGFVFAFAALKGIPEAFDWDIEEEIDNEF |
| Ga0209769_12398693 | 3300027679 | Freshwater Lake | MSKVEKALVALAVTGAVGFAFAFAALKGIPESFDWELDEEESYE |
| Ga0209551_10089904 | 3300027689 | Freshwater Lake | MSKVEKTLIAIAVAGMVGFGFAIASLKGIPEAFDWEEDDSE |
| Ga0209551_11122623 | 3300027689 | Freshwater Lake | MNKFEKTLIALAVAGTVGFAFAFAALKGIPEVFEWELDEEESYE |
| Ga0209551_11241953 | 3300027689 | Freshwater Lake | MNRVEKALVALAVTGAVGFAFAFAALKGIPESLDWELDEEESYE |
| Ga0209599_100272373 | 3300027710 | Deep Subsurface | MNKLEKALVALAVAGSVGFAFAFAALKGIPETFDWESDEEESYE |
| Ga0209617_101336533 | 3300027720 | Freshwater And Sediment | MSKVEKALVALAVAGTVGFAFALAALKGIPEAFDWETDDE |
| Ga0209297_12382063 | 3300027733 | Freshwater Lake | MSKVEKALVALAIAGTVGFAFAFAALKGIPEAFDWEDDE |
| Ga0209444_100162964 | 3300027756 | Freshwater Lake | MSKVEKTLVALAIAGTVGFAFAFAALKGIPEAFDWEEDDE |
| Ga0209088_1000003166 | 3300027763 | Freshwater Lake | MKRIEKTLIALAVAGAVGFSFAFALLKGIPETFDWELDEEENYE |
| Ga0209088_100079502 | 3300027763 | Freshwater Lake | MNRVEKALVALAVTGAVGFAFAFTALKGIPESFDWELDEEESYE |
| Ga0209770_100034898 | 3300027769 | Freshwater Lake | MNKFEKALIALAVAGSVGFAFAFAALKGIPETFDWESDEEESYE |
| Ga0209770_100130554 | 3300027769 | Freshwater Lake | MSKVEKALVALAVAGTVGFAFAFAALKGIPEAFDWELDEEESYE |
| Ga0209107_105462901 | 3300027797 | Freshwater And Sediment | MNRVEKALVALAVTGAVGFAFAFAALKGIPESFDWELDEEE |
| Ga0209229_102194723 | 3300027805 | Freshwater And Sediment | MSKFEKALVALAVAGTVGFAFAFAALKGIPEAFDWDMEEEIDNEF |
| Ga0209229_102406003 | 3300027805 | Freshwater And Sediment | MNKVEKALVALAVAGAVGFAFAFAALKGIPEAFDWETDDE |
| Ga0209550_100706884 | 3300027892 | Freshwater Lake | VEKALVALAVAGTVGFAFAFAALKGIPEAFDWETDDE |
| Ga0209550_106672523 | 3300027892 | Freshwater Lake | IKEVETMSKFEKALIALAVAGTVGFAFAFAALKGIPEAFDWDTEEEIDNEF |
| Ga0209550_106751503 | 3300027892 | Freshwater Lake | MSKVEKALVAIAVAGTVGFAFAFAALRGIPEAFDWELDEEESHE |
| Ga0209298_100000415 | 3300027973 | Freshwater Lake | MNKFEKALVALAVAGTVGFVFAFAALKGIPEAFDWEDDDEESMWGHDLGGEA |
| Ga0247723_100216311 | 3300028025 | Deep Subsurface Sediment | MSKFEKALVAMAVVGMVGFGFAIATLKGIPEAFDWEEDDE |
| Ga0247723_10111275 | 3300028025 | Deep Subsurface Sediment | EKALVALAVAGSVGFAFAFAALKGIPETFDWESDEEESYE |
| Ga0247722_1000558812 | 3300028027 | Deep Subsurface Sediment | MNKFEKALVALAVAGSVGFAFAFAALKGIPETFDWESDEEES |
| Ga0315905_103145172 | 3300032092 | Freshwater | MNKFEKTLVAVAVVGMVGFGFAISALKGIPEAFDWEEDDE |
| Ga0315905_109764002 | 3300032092 | Freshwater | MNKIEKALVALAVAGAIGFSFAFALLKGIPETFDWELDEEENYE |
| Ga0335003_0000127_8390_8527 | 3300033995 | Freshwater | MSKVEKAFIALAIAGTVGFAFAFAALKGIPEVFDWDLEEEIDDEF |
| Ga0335003_0357734_75_209 | 3300033995 | Freshwater | MNKFEKALVAIAVAGSVGFAFAFAALKGIPETFDWESDEEESYE |
| Ga0334991_0015599_2209_2343 | 3300034013 | Freshwater | MKKFEKALIALAVAGTVGFAFAFAALKGIPEAFDWELDEEESHE |
| Ga0334991_0032300_2375_2509 | 3300034013 | Freshwater | MNKFEKTLVALAVAGTVGFSFAFAVLKGVPESFDWQLDEEEDNE |
| Ga0334991_0356714_121_243 | 3300034013 | Freshwater | MNKVEKALVALAVAGAVGFAFAFAALKGIPEAFDWETEDE |
| Ga0335005_0030982_2427_2561 | 3300034022 | Freshwater | MNRVEKALVALAVTGAVGFAFAFAALKGIPESFDWELDEEESHE |
| Ga0335005_0702990_356_490 | 3300034022 | Freshwater | MNKFEKTLVALAVAGTVGFSFAFAVLKGVPEAFDWDLDEEENYE |
| Ga0335028_0007209_4130_4264 | 3300034071 | Freshwater | MSKFEKALVALAVAGTVGFAFAFATLKGIPEAFDWELDDEESYE |
| Ga0335010_0143807_262_384 | 3300034092 | Freshwater | MSRFEKALVAMAVVGMVGFGFAIATLKGIPEAFDWEEDDE |
| Ga0335027_0005486_5641_5775 | 3300034101 | Freshwater | MNKFEKTLIALAVAGTVGFSFAFAVLKRVPEAFDWEFDEEENYE |
| Ga0335055_0373041_469_594 | 3300034110 | Freshwater | MNKFEKALIALAVAGSVGFAFAFAALKGIPETFDWESDEEES |
| Ga0335068_0375735_571_684 | 3300034116 | Freshwater | LIALAVAGSVGFAFAFAALKGIPETFDWESDEEESYE |
| Ga0335049_0461778_239_373 | 3300034272 | Freshwater | MNKFEKTLIALAVAGTVGFSFAFAVLKGVPETFDWELDEEENYE |
| Ga0335007_0011652_2413_2547 | 3300034283 | Freshwater | MSKFEKTLVAMAVVGMVGFAFAFAALKGIPESFDWELDEEESYE |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |