Metagenome / Metatranscriptome Family F044406

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F044406
Family Type	Metagenome / Metatranscriptome
Number of Sequences	154
Average Sequence Length	42 residues
Representative Sequence	MLPVAEMLPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK
Number of Associated Samples	105
Number of Associated Scaffolds	154

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	75.50 %
% of genes near scaffold ends (potentially truncated)	18.18 %
% of genes from short scaffolds (< 2000 bps)	85.71 %
Associated GOLD sequencing projects	94
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (59.091 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere (9.091 % of family members)
Environment Ontology (ENVO)	Unclassified (29.221 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (52.597 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.49
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 154 Family Scaffolds
PF01343	Peptidase_S49	11.69
PF11897	DUF3417	3.90
PF00005	ABC_tran	2.60
PF06170	DUF983	2.60
PF02548	Pantoate_transf	1.95
PF01408	GFO_IDH_MocA	1.30
PF07589	PEP-CTERM	1.30
PF00111	Fer2	1.30
PF14559	TPR_19	1.30
PF07609	DUF1572	1.30
PF01844	HNH	0.65
PF01906	YbjQ_1	0.65
PF00126	HTH_1	0.65
PF01368	DHH	0.65
PF02321	OEP	0.65
PF13560	HTH_31	0.65
PF01479	S4	0.65
PF00677	Lum_binding	0.65
PF16542	PNKP_ligase	0.65
PF13810	DUF4185	0.65
PF00067	p450	0.65
PF13377	Peripla_BP_3	0.65
PF13302	Acetyltransf_3	0.65
PF12796	Ank_2	0.65
PF04367	DUF502	0.65

COG ID	Name	Functional Category	% Frequency in 154 Family Scaffolds
COG0616	Periplasmic serine protease, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	23.38
COG5349	Uncharacterized conserved protein, DUF983 family	Function unknown [S]	2.60
COG0413	Ketopantoate hydroxymethyltransferase	Coenzyme transport and metabolism [H]	1.95
COG1538	Outer membrane protein TolC	Cell wall/membrane/envelope biogenesis [M]	1.30
COG0307	Riboflavin synthase alpha chain	Coenzyme transport and metabolism [H]	0.65
COG0393	Uncharacterized pentameric protein YbjQ, UPF0145 family	Function unknown [S]	0.65
COG2124	Cytochrome P450	Defense mechanisms [V]	0.65
COG2928	Uncharacterized membrane protein	Function unknown [S]	0.65

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	59.09 %
Unclassified	root	N/A	40.91 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	59.09 %
Unclassified	root	N/A	40.91 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	59.09 %
Unclassified	root	N/A	40.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.91 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	34.42 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.30 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.91 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	33.12 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1.30 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.65 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.91 %
Phycisphaerae	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	31.17 %
Verrucomicrobiae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	0.65 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.65 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.91 %
unclassified Phycisphaerae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae	5.84 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples	4.55 %
Phycisphaerales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales	1.30 %
Verrucomicrobiales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales	0.65 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.65 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.91 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	5.84 %
uncultured Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium	4.55 %
unclassified Phycisphaerales	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales	1.30 %
Verrucomicrobia subdivision 3	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3	0.65 %
Sorangiineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae	0.65 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.91 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	5.84 %
uncultured Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium	4.55 %
Phycisphaerales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium	1.30 %
Pedosphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera	0.65 %
Polyangiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae	0.65 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.91 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	5.84 %
uncultured Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium	4.55 %
Phycisphaerales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium	1.30 %
Pedosphaera parvula	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula	0.65 %
Sorangium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium	0.65 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	40.91 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	5.84 %
uncultured Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium	4.55 %
Phycisphaerales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium	1.30 %
Sorangium cellulosum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum	0.65 %
Pedosphaera parvula	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula	0.65 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.65 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908004\|PBDC3_FIDWTPW02P9HH9	Not Available	506	Open in IMG/M
2124908004\|PBDC3_FIDWTPW02RBNCB	Not Available	508	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101557883	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	971	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_104716560	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium	593	Open in IMG/M
3300001537\|A2065W1_10019867	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium	2066	Open in IMG/M
3300001538\|A10PFW1_11742787	All Organisms → cellular organisms → Bacteria	1176	Open in IMG/M
3300004114\|Ga0062593_100128399	All Organisms → cellular organisms → Bacteria	1867	Open in IMG/M
3300004114\|Ga0062593_100458812	All Organisms → cellular organisms → Bacteria	1164	Open in IMG/M
3300004114\|Ga0062593_100470493	All Organisms → cellular organisms → Bacteria	1153	Open in IMG/M
3300004114\|Ga0062593_103195845	Not Available	525	Open in IMG/M
3300004156\|Ga0062589_101721952	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	626	Open in IMG/M
3300004157\|Ga0062590_101221509	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	734	Open in IMG/M
3300004480\|Ga0062592_102303906	Not Available	538	Open in IMG/M
3300005175\|Ga0066673_10117961	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	1445	Open in IMG/M
3300005187\|Ga0066675_10890392	Not Available	673	Open in IMG/M
3300005329\|Ga0070683_100367624	All Organisms → cellular organisms → Bacteria	1370	Open in IMG/M
3300005331\|Ga0070670_100927492	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	790	Open in IMG/M
3300005335\|Ga0070666_10922751	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	646	Open in IMG/M
3300005336\|Ga0070680_100884590	Not Available	770	Open in IMG/M
3300005345\|Ga0070692_10818884	All Organisms → cellular organisms → Bacteria	637	Open in IMG/M
3300005355\|Ga0070671_100351872	All Organisms → cellular organisms → Bacteria	1257	Open in IMG/M
3300005356\|Ga0070674_101982155	Not Available	530	Open in IMG/M
3300005367\|Ga0070667_101590021	Not Available	614	Open in IMG/M
3300005435\|Ga0070714_100345615	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1396	Open in IMG/M
3300005435\|Ga0070714_100789354	Not Available	919	Open in IMG/M
3300005455\|Ga0070663_101038251	Not Available	714	Open in IMG/M
3300005548\|Ga0070665_101531904	Not Available	675	Open in IMG/M
3300005719\|Ga0068861_102392345	Not Available	531	Open in IMG/M
3300005842\|Ga0068858_101679248	Not Available	627	Open in IMG/M
3300005844\|Ga0068862_100511395	Not Available	1141	Open in IMG/M
3300005944\|Ga0066788_10090303	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	752	Open in IMG/M
3300005993\|Ga0080027_10273187	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	669	Open in IMG/M
3300006046\|Ga0066652_100791556	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium	906	Open in IMG/M
3300006755\|Ga0079222_11553283	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300006844\|Ga0075428_100381484	All Organisms → cellular organisms → Bacteria	1511	Open in IMG/M
3300006854\|Ga0075425_100501410	All Organisms → cellular organisms → Bacteria	1398	Open in IMG/M
3300006871\|Ga0075434_102665082	Not Available	500	Open in IMG/M
3300006876\|Ga0079217_10263543	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	929	Open in IMG/M
3300006876\|Ga0079217_10342365	Not Available	852	Open in IMG/M
3300006894\|Ga0079215_11619183	Not Available	515	Open in IMG/M
3300007004\|Ga0079218_10451693	All Organisms → cellular organisms → Bacteria	1117	Open in IMG/M
3300007004\|Ga0079218_11864643	Not Available	678	Open in IMG/M
3300007521\|Ga0105044_11306581	Not Available	531	Open in IMG/M
3300009012\|Ga0066710_104696477	All Organisms → cellular organisms → Bacteria	511	Open in IMG/M
3300009083\|Ga0105047_10019166	All Organisms → cellular organisms → Bacteria	10572	Open in IMG/M
3300009083\|Ga0105047_10061732	All Organisms → cellular organisms → Bacteria	5058	Open in IMG/M
3300009093\|Ga0105240_11194374	Not Available	806	Open in IMG/M
3300009098\|Ga0105245_12311717	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	591	Open in IMG/M
3300009098\|Ga0105245_12986938	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	524	Open in IMG/M
3300009100\|Ga0075418_11129223	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	849	Open in IMG/M
3300009137\|Ga0066709_100353281	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2021	Open in IMG/M
3300009137\|Ga0066709_100832128	All Organisms → cellular organisms → Bacteria	1340	Open in IMG/M
3300009137\|Ga0066709_102399108	Not Available	717	Open in IMG/M
3300009137\|Ga0066709_102509853	Not Available	695	Open in IMG/M
3300009148\|Ga0105243_11832353	Not Available	638	Open in IMG/M
3300009156\|Ga0111538_11107604	All Organisms → cellular organisms → Bacteria	1001	Open in IMG/M
3300009156\|Ga0111538_11221102	Not Available	950	Open in IMG/M
3300009177\|Ga0105248_12007592	Not Available	657	Open in IMG/M
3300009177\|Ga0105248_12691291	Not Available	567	Open in IMG/M
3300009553\|Ga0105249_12552956	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300009840\|Ga0126313_10913273	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	717	Open in IMG/M
3300009840\|Ga0126313_11206067	Not Available	624	Open in IMG/M
3300010039\|Ga0126309_10731280	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	639	Open in IMG/M
3300010040\|Ga0126308_10871097	Not Available	626	Open in IMG/M
3300010042\|Ga0126314_11158242	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	577	Open in IMG/M
3300010044\|Ga0126310_11186684	Not Available	612	Open in IMG/M
3300010154\|Ga0127503_10103380	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	645	Open in IMG/M
3300011333\|Ga0127502_10808150	Not Available	1007	Open in IMG/M
3300011415\|Ga0137325_1050268	Not Available	887	Open in IMG/M
3300011423\|Ga0137436_1099163	Not Available	768	Open in IMG/M
3300012046\|Ga0136634_10447716	All Organisms → cellular organisms → Bacteria	544	Open in IMG/M
3300012212\|Ga0150985_100711759	Not Available	644	Open in IMG/M
3300012212\|Ga0150985_101952382	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium	567	Open in IMG/M
3300012212\|Ga0150985_105170740	Not Available	1022	Open in IMG/M
3300012212\|Ga0150985_106248819	Not Available	844	Open in IMG/M
3300012212\|Ga0150985_109660248	Not Available	681	Open in IMG/M
3300012212\|Ga0150985_112254734	Not Available	1348	Open in IMG/M
3300012212\|Ga0150985_112425817	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	540	Open in IMG/M
3300012212\|Ga0150985_115142399	All Organisms → cellular organisms → Bacteria	1350	Open in IMG/M
3300012212\|Ga0150985_115299278	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	649	Open in IMG/M
3300012212\|Ga0150985_117661426	Not Available	560	Open in IMG/M
3300012212\|Ga0150985_119603664	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	588	Open in IMG/M
3300012212\|Ga0150985_119974272	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	576	Open in IMG/M
3300012212\|Ga0150985_120260800	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	584	Open in IMG/M
3300012212\|Ga0150985_121478069	Not Available	696	Open in IMG/M
3300012469\|Ga0150984_103184736	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	912	Open in IMG/M
3300012469\|Ga0150984_104431712	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	649	Open in IMG/M
3300012469\|Ga0150984_106949142	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	608	Open in IMG/M
3300012469\|Ga0150984_107964910	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula	517	Open in IMG/M
3300012469\|Ga0150984_110338792	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium	582	Open in IMG/M
3300012469\|Ga0150984_112553553	Not Available	617	Open in IMG/M
3300012469\|Ga0150984_116416842	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	542	Open in IMG/M
3300012469\|Ga0150984_117489912	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	656	Open in IMG/M
3300012469\|Ga0150984_118188329	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	707	Open in IMG/M
3300012469\|Ga0150984_119618526	Not Available	1473	Open in IMG/M
3300012469\|Ga0150984_122808644	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	825	Open in IMG/M
3300012532\|Ga0137373_11137599	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	556	Open in IMG/M
3300012956\|Ga0154020_10033970	All Organisms → cellular organisms → Bacteria	5475	Open in IMG/M
3300013296\|Ga0157374_11926782	All Organisms → cellular organisms → Bacteria	617	Open in IMG/M
3300013307\|Ga0157372_10144692	All Organisms → cellular organisms → Bacteria	2741	Open in IMG/M
3300013308\|Ga0157375_12312490	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	641	Open in IMG/M
3300014501\|Ga0182024_10098844	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	4258	Open in IMG/M
3300015052\|Ga0137411_1218376	Not Available	667	Open in IMG/M
3300015360\|Ga0163144_10004866	All Organisms → cellular organisms → Bacteria	30086	Open in IMG/M
3300015360\|Ga0163144_10046667	All Organisms → cellular organisms → Bacteria	7794	Open in IMG/M
3300015360\|Ga0163144_10407890	All Organisms → cellular organisms → Bacteria	1615	Open in IMG/M
3300015371\|Ga0132258_10505316	All Organisms → cellular organisms → Bacteria	3024	Open in IMG/M
3300015371\|Ga0132258_12451952	All Organisms → cellular organisms → Bacteria	1306	Open in IMG/M
3300015371\|Ga0132258_13236535	Not Available	1122	Open in IMG/M
3300015371\|Ga0132258_13798228	Not Available	1029	Open in IMG/M
3300017658\|Ga0182738_1035532	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	3344	Open in IMG/M
3300018073\|Ga0184624_10218018	Not Available	853	Open in IMG/M
3300018422\|Ga0190265_13406247	Not Available	530	Open in IMG/M
3300018432\|Ga0190275_11799338	All Organisms → cellular organisms → Bacteria	691	Open in IMG/M
3300018476\|Ga0190274_10607709	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	1121	Open in IMG/M
3300018482\|Ga0066669_10567485	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium	991	Open in IMG/M
3300018890\|Ga0193595_1000020	All Organisms → cellular organisms → Bacteria	62687	Open in IMG/M
3300019362\|Ga0173479_10568849	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	586	Open in IMG/M
3300020005\|Ga0193697_1007905	All Organisms → cellular organisms → Bacteria	2590	Open in IMG/M
3300020180\|Ga0163155_10377943	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	633	Open in IMG/M
3300021344\|Ga0193719_10006559	All Organisms → cellular organisms → Bacteria	4798	Open in IMG/M
3300022756\|Ga0222622_10362802	Not Available	1012	Open in IMG/M
3300022756\|Ga0222622_11253259	Not Available	546	Open in IMG/M
3300023272\|Ga0247760_1187582	Not Available	532	Open in IMG/M
3300025893\|Ga0207682_10062637	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium	1560	Open in IMG/M
3300025903\|Ga0207680_10465687	All Organisms → cellular organisms → Bacteria	898	Open in IMG/M
3300025908\|Ga0207643_10335934	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	946	Open in IMG/M
3300025913\|Ga0207695_11431407	Not Available	571	Open in IMG/M
3300025917\|Ga0207660_10529094	Not Available	958	Open in IMG/M
3300025925\|Ga0207650_10782800	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	808	Open in IMG/M
3300025929\|Ga0207664_10304413	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1403	Open in IMG/M
3300025931\|Ga0207644_11828705	Not Available	508	Open in IMG/M
3300025935\|Ga0207709_10684868	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	819	Open in IMG/M
3300025937\|Ga0207669_11053990	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium	685	Open in IMG/M
3300026088\|Ga0207641_10815446	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	924	Open in IMG/M
3300026089\|Ga0207648_11932187	Not Available	552	Open in IMG/M
3300026536\|Ga0209058_1345247	Not Available	515	Open in IMG/M
3300027637\|Ga0209818_1096329	Not Available	778	Open in IMG/M
3300027907\|Ga0207428_10982214	Not Available	594	Open in IMG/M
3300027909\|Ga0209382_10202544	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum	2274	Open in IMG/M
3300028380\|Ga0268265_10673062	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium	997	Open in IMG/M
3300031022\|Ga0138301_1367601	Not Available	502	Open in IMG/M
3300031093\|Ga0308197_10408754	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	533	Open in IMG/M
3300031938\|Ga0308175_100008858	All Organisms → cellular organisms → Bacteria	7433	Open in IMG/M
3300031995\|Ga0307409_100844315	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	926	Open in IMG/M
3300031995\|Ga0307409_102703324	Not Available	524	Open in IMG/M
3300032002\|Ga0307416_100086088	All Organisms → cellular organisms → Bacteria	2678	Open in IMG/M
3300032069\|Ga0315282_10039400	All Organisms → cellular organisms → Bacteria	5571	Open in IMG/M
3300032420\|Ga0335397_10039259	All Organisms → cellular organisms → Bacteria	5315	Open in IMG/M
3300034384\|Ga0372946_0287489	Not Available	797	Open in IMG/M
3300034384\|Ga0372946_0509491	Not Available	584	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	51.30%
Host-Associated	Host-Associated	46.75%
Engineered	Engineered	1.95%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	46.75%
Terrestrial	Environmental → Terrestrial	40.26%
Aquatic	Environmental → Aquatic	11.04%
Solid Waste	Engineered → Solid Waste	1.30%
Wastewater	Engineered → Wastewater	0.65%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	39.61%
Rhizosphere	Host-Associated → Plants → Rhizosphere	30.52%
Rhizoplane	Host-Associated → Plants → Rhizoplane	16.23%
Freshwater	Environmental → Aquatic → Freshwater	7.79%
Sediment	Environmental → Aquatic → Sediment	3.25%
Wood	Engineered → Solid Waste → Wood	1.30%
Plant Litter	Environmental → Terrestrial → Plant Litter	0.65%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.65%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	31.82%
Soil	Host-Associated → Plants → Rhizosphere → Soil	15.58%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.94%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	11.69%
Loam	Environmental → Terrestrial → Soil → Loam	5.19%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.55%
Lake	Environmental → Aquatic → Freshwater → Lake	3.25%
Ice	Environmental → Aquatic → Freshwater → Ice	3.25%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.25%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.95%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.30%
Composting	Engineered → Solid Waste → Wood → Composting	1.30%
Sand	Environmental → Terrestrial → Soil → Sand	0.65%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	0.65%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.65%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	15.58%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.94%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	11.69%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	10.39%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	9.09%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.14%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.55%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.55%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.25%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	2.60%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	2.60%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.95%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.95%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.95%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.30%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.30%
Bioreactor	Engineered → Solid Waste → Wood → Composting → Bioreactor	1.30%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.65%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.65%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.65%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.65%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	0.65%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.65%

Habitat	Taxonomy	Distribution
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	9.09%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	7.79%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.19%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	4.55%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	4.55%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	3.90%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.25%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.25%
Freshwater Microbial Mat	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat	2.60%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	2.60%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.95%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.95%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.95%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	1.95%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.95%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.95%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.95%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	1.30%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.30%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.30%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.30%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	1.30%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.30%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.30%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.30%
Poplar Biomass Bioreactor	Engineered → Solid Waste → Wood → Composting → Bioreactor → Poplar Biomass Bioreactor	1.30%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.65%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.65%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.65%
Compost	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost	0.65%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.65%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.65%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.65%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.65%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.65%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.65%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.65%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.65%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.65%
Active Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge	0.65%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908004	Poplar biomass bioreactor microbial communities from Brookhaven National Lab, NY - total biomass decay community	Engineered	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001537	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina	Environmental	Open in IMG/M
3300001538	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005944	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048	Environmental	Open in IMG/M
3300005993	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300007521	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009083	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly)	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010154	Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300011333	Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300011415	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2	Environmental	Open in IMG/M
3300011423	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2	Environmental	Open in IMG/M
3300012046	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012956	Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG	Engineered	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300015052	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015360	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300017658	Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C BE-Lig MG (version 2)	Environmental	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300018890	Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, bundles v1	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300020005	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2	Environmental	Open in IMG/M
3300020180	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.SP4.G1	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300023272	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L171-409R-4	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300027637	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031022	Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300031093	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032069	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032420	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly)	Environmental	Open in IMG/M
3300034384	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
PBDC3_01467650	2124908004	Poplar Biomass Bioreactor	MLATALPVAAAGWAFLVWLFGGGFGLALVVFFVLKFWAGNADRR
PBDC3_04765720	2124908004	Poplar Biomass Bioreactor	MLATALPVAAAGWAFLVWLFGGGFGLALVVFFVLKVLGRYADRR
INPhiseqgaiiFebDRAFT_1015578832	3300000364	Soil	MEPLVMAIPLAAAGWAFLVWLCGGGFGLALVVFVVLKMLGK*
INPhiseqgaiiFebDRAFT_1047165601	3300000364	Soil	METLAMMLPAAAAGWAFLVWLCGGGFGLALLVFIVLKILGR*
A2065W1_100198674	3300001537	Permafrost	MSSELLAVMFPMAAAGPAFLVWLCGGGFGLAVVVFIVLKLFGK*
A10PFW1_117427873	3300001538	Permafrost	DSAKGETMSSELLAVMFPMAAAGPAFLVWLCGGGFGLAVVVFIVLKLFGK*
Ga0062593_1001283993	3300004114	Soil	MEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK*
Ga0062593_1004588121	3300004114	Soil	MMELATIFPLAAAGWAFLVWLFGGGFGLAILVFIVLKVLGR*
Ga0062593_1004704932	3300004114	Soil	MELATIVPLAAAGWAFLVWLFGGGFGLAILVFIVLKMLGK*
Ga0062593_1031958451	3300004114	Soil	MLELATIIPLAAAGWAFLVWLFGGGFGLAVLVFIVLKLLGR*
Ga0062589_1017219521	3300004156	Soil	PAGLTCGSREREETMEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK*
Ga0062590_1012215091	3300004157	Soil	GVGPTKERKPMEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK*
Ga0062592_1023039061	3300004480	Soil	MLELATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR*
Ga0066673_101179611	3300005175	Soil	MELATIFPLAAAGWAFLVWLCGGGFGLALLVFIVLKMLGR*
Ga0066675_108903922	3300005187	Soil	MLDLATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR*
Ga0070683_1003676241	3300005329	Corn Rhizosphere	MLPVAEMLPLAAAGWAFLVWLCGGGVGLALVVFIVLKVLGK*
Ga0070670_1009274921	3300005331	Switchgrass Rhizosphere	METLALMMPLAAAGWAALVWLFGGGFGLALVVFIVLKLFGR*
Ga0070666_109227511	3300005335	Switchgrass Rhizosphere	EAAIMIPMAAAGWAFILTWLFGGGIGLFLLLFVVLKMLGK*
Ga0070680_1008845902	3300005336	Corn Rhizosphere	MLIPMLPAAAAGWAGLVWLLGGGLPLAIIVFIVLKMMGR*
Ga0070692_108188841	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	MLELATILPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR*
Ga0070671_1003518722	3300005355	Switchgrass Rhizosphere	MLIETALPMAAAGWAFLVWLFGGGLGMALVVFVVLKMLGR*
Ga0070674_1019821552	3300005356	Miscanthus Rhizosphere	MTVDMILPMAAAGWAFLVWLFGGGFGLALLVFIVLKMFGK*
Ga0070667_1015900212	3300005367	Switchgrass Rhizosphere	MENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR*
Ga0070714_1003456151	3300005435	Agricultural Soil	MIELATMLPLAAAGWAFLVWLFGGGFGLALVVFIVLKLLGD*
Ga0070714_1007893542	3300005435	Agricultural Soil	MVETVAMVVPVAAAGWAFLTWIFSGSIGLALVVFIVLKAMGR*
Ga0070663_1010382512	3300005455	Corn Rhizosphere	VVPVAEMMPLAAAGWAFLVWLCGGGVGLAVVVFIVLKLLGK*
Ga0070665_1015319042	3300005548	Switchgrass Rhizosphere	MMLELLPVAAAGWAFLVWLFGGGLGFALVVFVVLKMIGK*
Ga0068861_1023923452	3300005719	Switchgrass Rhizosphere	MELATIVPLAAAGWAFLVWLFGGGFGLALVVFIVLKMLGK*
Ga0068858_1016792482	3300005842	Switchgrass Rhizosphere	METLAMMVPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR*
Ga0068862_1005113952	3300005844	Switchgrass Rhizosphere	MLPVAEMLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK*
Ga0066788_100903032	3300005944	Soil	MMTPFATMFPMAAAGWAFLVWLCGGGFGLALVVFVVLKLLGR*
Ga0080027_102731872	3300005993	Prmafrost Soil	MELVATMFPVAAAGWAFLVWLGGGGFGLALVVFVVLKLLGR*
Ga0066652_1007915563	3300006046	Soil	MYDLATMLPVAAAGWAFLVWLCGGGFGLAILVFIVLKMLGR*
Ga0079222_115532831	3300006755	Agricultural Soil	MEDLVVPVAEMMPLGGGQAFLVWLCGGGVGLTVIVFIVLKLLGK*
Ga0075428_1003814842	3300006844	Populus Rhizosphere	MIEIMTMLPLAAAGWAFLVWLFGGGLGLALIVFIVMKIVGH*
Ga0075425_1005014102	3300006854	Populus Rhizosphere	MSELATILPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR*
Ga0075434_1026650821	3300006871	Populus Rhizosphere	MLELAAVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR*
Ga0079217_102635432	3300006876	Agricultural Soil	MELIVQSIPLAAAGWAFLVWLFGGGVGLALAVFLVLKLLGK*
Ga0079217_103423653	3300006876	Agricultural Soil	MLPVAEILPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK*
Ga0079215_116191832	3300006894	Agricultural Soil	MELIVQSIPLAAAGWAFLVWLFGGGLGLALAVFLVLKLLGK*
Ga0079218_104516932	3300007004	Agricultural Soil	MIEIMTMMPLAAAGWAFLVWLFGGGLGLALIVFLVMKLMGQ*
Ga0079218_118646433	3300007004	Agricultural Soil	AEILPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK*
Ga0105044_113065812	3300007521	Freshwater	LEDNMLLTLIPVAAAGWAFLVWLVGGGFGLALLVFLGLKLLGK*
Ga0066710_1046964772	3300009012	Grasslands Soil	MLELATIAPLAAAGWAFLTYLFTGSVGLALLVFIVLKIVGR
Ga0105047_100191662	3300009083	Freshwater	MLDILALTIPLAAAGYALLVWLFGGGLGLALVVFVLMKMLGK*
Ga0105047_100617322	3300009083	Freshwater	MLEVIHPTLEAAAAGWAFLVWLFGGGFTLAIIVFVVMKMMGK*
Ga0105240_111943742	3300009093	Corn Rhizosphere	MVETVAMIAPVAAAGWAFLTWILSGSFGLAIVVFIFLKVLGR*
Ga0105245_123117172	3300009098	Miscanthus Rhizosphere	MLEMLPVAAAGWAFLVWLFGGGLGLALVVFVVLKLLGQ*
Ga0105245_129869382	3300009098	Miscanthus Rhizosphere	LPMAAAGWAFLVWLFGGGLGMALVVCVVLKMLGR*
Ga0075418_111292232	3300009100	Populus Rhizosphere	MMLEMLPVAAAGWAFLVWLFGGGLGLALVVFVVLKLLGQ*
Ga0066709_1003532812	3300009137	Grasslands Soil	MLPLAALGWAFLVWLFGGGLGLAVVVFIVLKLMGK*
Ga0066709_1008321282	3300009137	Grasslands Soil	MLELATIAPLAAAGWAFLTYLFTGSVGLALLVFIVLKIVGR*
Ga0066709_1023991081	3300009137	Grasslands Soil	MVPVAEVLPLAAAGWAFLVWLFGGGLGLAVVVFIVLKLLGK*
Ga0066709_1025098532	3300009137	Grasslands Soil	MTPELMLPVAAAGWAFLAWLFGGGFGLAVVVFIVLKMLGR*
Ga0105243_118323531	3300009148	Miscanthus Rhizosphere	MMPLAAAGWAFLVWLCGGGVGLAVVVFIVLKLLGK*
Ga0111538_111076042	3300009156	Populus Rhizosphere	MLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK*
Ga0111538_112211022	3300009156	Populus Rhizosphere	MIEVMTMVPLAAAGWAFLVWLFGGGLGIAFIVFIVMKMLGH*
Ga0105248_120075922	3300009177	Switchgrass Rhizosphere	MFTEMLPMAAAGWAFLVWLFGGGFGLALVVFIVLKALGR*
Ga0105248_126912912	3300009177	Switchgrass Rhizosphere	METLALMMPLAAAGWAFLVWLFGGGFGLARVVVIVLKLFGR*
Ga0105249_125529562	3300009553	Switchgrass Rhizosphere	VPLAAAGWAFLVWLFGGGFGLAILVFIVLKMLGK*
Ga0126313_109132732	3300009840	Serpentine Soil	MMLELLPVAAAGWAFLVWLFGGGLGLALVVFVVMKLIGH*
Ga0126313_112060671	3300009840	Serpentine Soil	MMPLAAAGWAFLVWLCGGGVGLAIVVFIVLKLLGK*
Ga0126309_107312802	3300010039	Serpentine Soil	MAIPLAAAGWAFLVWLCGGGFGLALVVFIVLKMFGK*
Ga0126308_108710971	3300010040	Serpentine Soil	MNIMFVTEMLPLAAAGLAFLVWLFGGGLGFALVVFIVLKMLGK*
Ga0126314_111582422	3300010042	Serpentine Soil	MITMLPAAAAGWAFLVWLFGGGFGLALVVFIVLKMLGK*
Ga0126310_111866842	3300010044	Serpentine Soil	MILPVAAAGWAFLVWLFGGGFGLALVVFIVLKMLGR*
Ga0127503_101033801	3300010154	Soil	ARDNQENAMETLAMILPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR*
Ga0127502_108081502	3300011333	Soil	MLEVATLIPLAAAGWAFLVWLFGGGLGLALIVFVALKLMGK*
Ga0137325_10502682	3300011415	Soil	MMELATVLPMAAAGWAFLVWLLGGGLGLAIVVFIVLKMLGR*
Ga0137436_10991632	3300011423	Soil	MMEIMTMMPLAAAGWAFLVWLFGGGLGLALIVFLGMKMLGK*
Ga0136634_104477162	3300012046	Polar Desert Sand	GDRKMELATLLPVAAAGWAFLVWLLGGGLGLALLVFIVLKVIGR*
Ga0150985_1007117591	3300012212	Avena Fatua Rhizosphere	MLELATLFPLAAAGWAFLVWLFGGGFGLAVLVFIVLKVLGR*
Ga0150985_1019523821	3300012212	Avena Fatua Rhizosphere	RLVYERRSCMETLATILPLAAAGWAFLVWLFGGGFGLALVVFVVLKMLGK*
Ga0150985_1051707401	3300012212	Avena Fatua Rhizosphere	MVPMLSEMMILGAAGWAFLVWLCGGGFGLAILVFIVLKVLGK*
Ga0150985_1062488192	3300012212	Avena Fatua Rhizosphere	MLPVAEVLPLAAAGWAFLVWLCGGGFGLAVVVFIVLKLMGK*
Ga0150985_1096602482	3300012212	Avena Fatua Rhizosphere	MIIEMVPFAAAGWAFLVWLFGGGFGLALVVFLVLKMMGR*
Ga0150985_1122547341	3300012212	Avena Fatua Rhizosphere	MVPMVAEMAILGAAGWAFLVWLCGGGFGLAIVVFIVLKLLGK*
Ga0150985_1124258171	3300012212	Avena Fatua Rhizosphere	QRSRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR*
Ga0150985_1151423991	3300012212	Avena Fatua Rhizosphere	MITTMLPAAAAGWAFLVWLFGGGFGLAVVVFIVLKMLGR*
Ga0150985_1152992782	3300012212	Avena Fatua Rhizosphere	RALPQRSRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR*
Ga0150985_1176614262	3300012212	Avena Fatua Rhizosphere	MVPMVAEMAILGAAGWAFLVWLCGGGFGLAVVVFIVLKLLGK*
Ga0150985_1196036641	3300012212	Avena Fatua Rhizosphere	METLAMIFPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR*
Ga0150985_1199742721	3300012212	Avena Fatua Rhizosphere	RHTPERKDHVMMLELLPVAAAGWAFLVWLFGGGLGLALVVFVVLKLIGQ*
Ga0150985_1202608002	3300012212	Avena Fatua Rhizosphere	METLAMMIPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR*
Ga0150985_1214780692	3300012212	Avena Fatua Rhizosphere	MLELATILPMAAAGWAFLVWLFGGGFGLAILVFIVLKALGR*
Ga0150984_1031847362	3300012469	Avena Fatua Rhizosphere	RTQMETLAMIFPMAAAGWAFLVWLCGGGFGLPLLVFIVLKVLGR*
Ga0150984_1044317121	3300012469	Avena Fatua Rhizosphere	RALPQRRRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR*
Ga0150984_1063561172	3300012469	Avena Fatua Rhizosphere	DVCSSDLNHMLEAAIMIPMAAAGWAFILTWLFGGGIGLFLLLFVVLKMLGK*
Ga0150984_1069491422	3300012469	Avena Fatua Rhizosphere	KRALPQRSRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR*
Ga0150984_1079649101	3300012469	Avena Fatua Rhizosphere	MQELAMMYPMAAAGWAFLVWLFGGGIGAALVVFVLLKMLGK*
Ga0150984_1103387922	3300012469	Avena Fatua Rhizosphere	MLELATMVPMAAAGWAFLVWLFGGGFGLALIVFIVLKMIGR*
Ga0150984_1125535532	3300012469	Avena Fatua Rhizosphere	MFPMAAAGWAFLVWLFGGGFGLALLVFIVLKMMGR*
Ga0150984_1164168421	3300012469	Avena Fatua Rhizosphere	ALPQRSRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR*
Ga0150984_1174899122	3300012469	Avena Fatua Rhizosphere	MLELATILPMAAAGWAFLVWLFGGGFGLAVVVFIVLKMLGR*
Ga0150984_1181883292	3300012469	Avena Fatua Rhizosphere	MATEMLPLAAAGWAFLVWLFGGGFGLALVVFVVLKMLGR*
Ga0150984_1196185261	3300012469	Avena Fatua Rhizosphere	MVPMLSEMMILGAAGWAFLVWLCGGGVGLAILVFIVLKVLGK*
Ga0150984_1228086441	3300012469	Avena Fatua Rhizosphere	MMLELLPVAAAGWAFLVWLFGGGLGLALVVFVVLKLIGQ*
Ga0137373_111375991	3300012532	Vadose Zone Soil	MVTTMLPAAAAGWAFLVWLFGGGFGLALVVFIVLKMLGR*
Ga0154020_100339704	3300012956	Active Sludge	MMMAELIPLAAAGWAFLAWLLGGGLGLAILVFIVLKLLGK*
Ga0157374_119267821	3300013296	Miscanthus Rhizosphere	MLPVAEMLPLAAAGWAFLVWLFGGGLGMALVVFVVLKMLGR*
Ga0157372_101446923	3300013307	Corn Rhizosphere	MVETVAMIAPVAAAGWAFLTWILSGSFGLALVVFVFLKMLGR*
Ga0157375_123124902	3300013308	Miscanthus Rhizosphere	QQMLITDMLPLAAAGWAFLVWLFGGGFGLAVLVFIVLKMLGR*
Ga0182024_100988442	3300014501	Permafrost	MMTLALILPVAAAGWAFLYWLFGGGLGGAFAIFIVLKLLGK*
Ga0137411_12183761	3300015052	Vadose Zone Soil	FMLELATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR*
Ga0163144_1000486614	3300015360	Freshwater Microbial Mat	MVPMIAEVLPLAAAGWAFLVWLVGGGFGLAIIVFILLKVLGK*
Ga0163144_100466676	3300015360	Freshwater Microbial Mat	MLIPLIPVAAAGYAFLVWLFGGGFALALVVFVALKVLGK*
Ga0163144_104078902	3300015360	Freshwater Microbial Mat	MIDLLANIYPMAAGGWALLVWLAGGGFGLAILVFIILKVMGK*
Ga0132258_105053162	3300015371	Arabidopsis Rhizosphere	MHELAIIFPLAAAGWAFLVWLFGGGFGLALVVFVALKVLGR*
Ga0132258_124519522	3300015371	Arabidopsis Rhizosphere	MVPVAEMLPLAAAGWAFLVWLCGGGFGLAVVVFIVLKLMGK*
Ga0132258_132365352	3300015371	Arabidopsis Rhizosphere	MVPVAEILPLAAAGWAFLVWLCGGGFGLAVVVFIVLKLMGK*
Ga0132258_137982282	3300015371	Arabidopsis Rhizosphere	MLPVAEMLPLAAAGWAFLVWLCGGGVGLALVVFIVLKALGK*
Ga0182738_10355322	3300017658	Compost	MPPLELMLPLAAAGWAFLVWLCGGGLGLAILVFIVLKVLGH
Ga0184624_102180181	3300018073	Groundwater Sediment	VVPVAEMMPLAAAGWAFLVWLCGGGVGLAVVVFIVLKLLGK
Ga0190265_134062472	3300018422	Soil	MLELAAILPMAAAGWAFLVWLLGGGLGLAIVVFIVLKMLGR
Ga0190275_117993382	3300018432	Soil	MLPVAEMLPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK
Ga0190274_106077091	3300018476	Soil	METLALTMPLAAGGWAFLVWLFGGGLGLALVVFVVLKLFGR
Ga0066669_105674852	3300018482	Grasslands Soil	MLEIATIFPLAAAGWAFLVWLFGGGFGLALLVFIVLKVLGR
Ga0193595_10000206	3300018890	Soil	MVELAMLFPMAALGWAFLVWLFGGGLGLAVLVFIVMKVLGH
Ga0173479_105688492	3300019362	Soil	HSDGLGVGPTKERKPMEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK
Ga0193697_10079052	3300020005	Soil	MLPVAEMLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK
Ga0163155_103779432	3300020180	Freshwater Microbial Mat	IYPMAAGGWALLVWLAGGGFGLAILVFIILKVMGK
Ga0193719_100065595	3300021344	Soil	MLELATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR
Ga0222622_103628021	3300022756	Groundwater Sediment	VAEMLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK
Ga0222622_112532592	3300022756	Groundwater Sediment	MLPVAEMLPLAAAGWAFLVWLCGGGVGLALLVFIVLKMIGK
Ga0247760_11875822	3300023272	Plant Litter	MIETLALTLPVAAAGWAFLVWLFGGGFGLALLVFIVLKVLGK
Ga0207682_100626372	3300025893	Miscanthus Rhizosphere	MEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK
Ga0207680_104656872	3300025903	Switchgrass Rhizosphere	MLPVAEMLPLAAAGWAFLVWLCGGGVGLALVVFIVLKVLGK
Ga0207643_103359341	3300025908	Miscanthus Rhizosphere	MLELATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGH
Ga0207695_114314071	3300025913	Corn Rhizosphere	MVETVAMIAPVAAAGWAFLTWILSGSFGLAIVVFIFLKVLGR
Ga0207660_105290942	3300025917	Corn Rhizosphere	MLIPMLPAAAAGWAGLVWLLGGGLPLAIIVFIVLKMMGR
Ga0207650_107828001	3300025925	Switchgrass Rhizosphere	METLALMMPLAAAGWAALVWLFGGGFGLALVVFIVLKLFGR
Ga0207664_103044132	3300025929	Agricultural Soil	MIELATMLPLAAAGWAFLVWLFGGGFGLALVVFIVLKLLGD
Ga0207644_118287051	3300025931	Switchgrass Rhizosphere	MLELATLFPLAAAGWAFLVWLFGGGFGLAVLVFIVLKVLGR
Ga0207709_106848682	3300025935	Miscanthus Rhizosphere	MLIETALPMAAAGWAFLVWLFGGGLGMALVVFVVLKMLGR
Ga0207669_110539902	3300025937	Miscanthus Rhizosphere	MLEAAIMIPMAAAGWAFILTWLFGGGIGLFLLLFVVLKMLGK
Ga0207641_108154461	3300026088	Switchgrass Rhizosphere	METLAMMVPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR
Ga0207648_119321871	3300026089	Miscanthus Rhizosphere	MLIETALPMAAAGWAFLVWLFGGGLGMALVVFVVLKMLGA
Ga0209058_13452472	3300026536	Soil	VVLIADMLPLAALGWAFLVWLFGGGLGLAVVVFIVLKLMGK
Ga0209818_10963291	3300027637	Agricultural Soil	MLPVAEILPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK
Ga0207428_109822142	3300027907	Populus Rhizosphere	LPVAEMLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK
Ga0209382_102025442	3300027909	Populus Rhizosphere	MIEIMTMLPLAAAGWAFLVWLFGGGLGLALIVFIVMKIVGH
Ga0268265_106730621	3300028380	Switchgrass Rhizosphere	VTLALGYPLAAAGWAFMVWLFGGGLGLALLVFVVLKIL
Ga0138301_13676012	3300031022	Soil	MSLAEILPLAAAGWAFLVWLSGGGLGLALLVFVVLEVLGR
Ga0308197_104087542	3300031093	Soil	LEAAIMIPMAAAGWAFILTWLFGGGIGLFLLLFVVLKMLGK
Ga0308175_1000088582	3300031938	Soil	MTGLEIIPLAAAGWAFLTWLFTGSIGLALLVFIVLKLIGR
Ga0307409_1008443152	3300031995	Rhizosphere	MELFAQSIPLAAAGWAFLVWLFGGGLGLAVAVFVVMKLLGK
Ga0307409_1027033242	3300031995	Rhizosphere	MDLLAQSIPLAAAGWAFLVWLFGGGLGLAVAVFVVLKLLGK
Ga0307416_1000860883	3300032002	Rhizosphere	MDLLAQSIPLAAAGWAFLVWLFGGGLGLAVAVFVVLKLMGK
Ga0315282_100394006	3300032069	Sediment	MLAVLSTIILAAAGWAFLVWLCGGGVGLAILVFIVLKVLGH
Ga0308173_103825342	3300032074	Soil	MLIPMLPAAAAGWAGLVWLLGGGLPLAIIVFVVLKMMGR
Ga0308173_110834171	3300032074	Soil	TVEAPMVPMLAEMMIVGAAGWAFLVWLCGGGFGLAILVFIVLKVLGK
Ga0335397_100392595	3300032420	Freshwater	MLDILALTIPLAAAGYALLVWLFGGGLGLALVVFVLMKMLGK
Ga0372946_0287489_428_553	3300034384	Soil	MFLVAEMLPLAAAGWAFLVWLFGGGLGLAALVFIVLKMLGK
Ga0372946_0509491_67_174	3300034384	Soil	MIPLAAAGWAFLVWLFGGGLGLAVVVFIVLKLLGK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F044406

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences