| Basic Information | |
|---|---|
| Family ID | F044406 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 154 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLPVAEMLPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.50 % |
| % of genes near scaffold ends (potentially truncated) | 18.18 % |
| % of genes from short scaffolds (< 2000 bps) | 85.71 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.091 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere (9.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.221 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.597 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF01343 | Peptidase_S49 | 11.69 |
| PF11897 | DUF3417 | 3.90 |
| PF00005 | ABC_tran | 2.60 |
| PF06170 | DUF983 | 2.60 |
| PF02548 | Pantoate_transf | 1.95 |
| PF01408 | GFO_IDH_MocA | 1.30 |
| PF07589 | PEP-CTERM | 1.30 |
| PF00111 | Fer2 | 1.30 |
| PF14559 | TPR_19 | 1.30 |
| PF07609 | DUF1572 | 1.30 |
| PF01844 | HNH | 0.65 |
| PF01906 | YbjQ_1 | 0.65 |
| PF00126 | HTH_1 | 0.65 |
| PF01368 | DHH | 0.65 |
| PF02321 | OEP | 0.65 |
| PF13560 | HTH_31 | 0.65 |
| PF01479 | S4 | 0.65 |
| PF00677 | Lum_binding | 0.65 |
| PF16542 | PNKP_ligase | 0.65 |
| PF13810 | DUF4185 | 0.65 |
| PF00067 | p450 | 0.65 |
| PF13377 | Peripla_BP_3 | 0.65 |
| PF13302 | Acetyltransf_3 | 0.65 |
| PF12796 | Ank_2 | 0.65 |
| PF04367 | DUF502 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 23.38 |
| COG5349 | Uncharacterized conserved protein, DUF983 family | Function unknown [S] | 2.60 |
| COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 1.95 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.30 |
| COG0307 | Riboflavin synthase alpha chain | Coenzyme transport and metabolism [H] | 0.65 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.65 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.65 |
| COG2928 | Uncharacterized membrane protein | Function unknown [S] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.09 % |
| Unclassified | root | N/A | 40.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908004|PBDC3_FIDWTPW02P9HH9 | Not Available | 506 | Open in IMG/M |
| 2124908004|PBDC3_FIDWTPW02RBNCB | Not Available | 508 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101557883 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 971 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104716560 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium | 593 | Open in IMG/M |
| 3300001537|A2065W1_10019867 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 2066 | Open in IMG/M |
| 3300001538|A10PFW1_11742787 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300004114|Ga0062593_100128399 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300004114|Ga0062593_100458812 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300004114|Ga0062593_100470493 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300004114|Ga0062593_103195845 | Not Available | 525 | Open in IMG/M |
| 3300004156|Ga0062589_101721952 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 626 | Open in IMG/M |
| 3300004157|Ga0062590_101221509 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 734 | Open in IMG/M |
| 3300004480|Ga0062592_102303906 | Not Available | 538 | Open in IMG/M |
| 3300005175|Ga0066673_10117961 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1445 | Open in IMG/M |
| 3300005187|Ga0066675_10890392 | Not Available | 673 | Open in IMG/M |
| 3300005329|Ga0070683_100367624 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300005331|Ga0070670_100927492 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 790 | Open in IMG/M |
| 3300005335|Ga0070666_10922751 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 646 | Open in IMG/M |
| 3300005336|Ga0070680_100884590 | Not Available | 770 | Open in IMG/M |
| 3300005345|Ga0070692_10818884 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005355|Ga0070671_100351872 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300005356|Ga0070674_101982155 | Not Available | 530 | Open in IMG/M |
| 3300005367|Ga0070667_101590021 | Not Available | 614 | Open in IMG/M |
| 3300005435|Ga0070714_100345615 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1396 | Open in IMG/M |
| 3300005435|Ga0070714_100789354 | Not Available | 919 | Open in IMG/M |
| 3300005455|Ga0070663_101038251 | Not Available | 714 | Open in IMG/M |
| 3300005548|Ga0070665_101531904 | Not Available | 675 | Open in IMG/M |
| 3300005719|Ga0068861_102392345 | Not Available | 531 | Open in IMG/M |
| 3300005842|Ga0068858_101679248 | Not Available | 627 | Open in IMG/M |
| 3300005844|Ga0068862_100511395 | Not Available | 1141 | Open in IMG/M |
| 3300005944|Ga0066788_10090303 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 752 | Open in IMG/M |
| 3300005993|Ga0080027_10273187 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 669 | Open in IMG/M |
| 3300006046|Ga0066652_100791556 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium | 906 | Open in IMG/M |
| 3300006755|Ga0079222_11553283 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300006844|Ga0075428_100381484 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300006854|Ga0075425_100501410 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300006871|Ga0075434_102665082 | Not Available | 500 | Open in IMG/M |
| 3300006876|Ga0079217_10263543 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 929 | Open in IMG/M |
| 3300006876|Ga0079217_10342365 | Not Available | 852 | Open in IMG/M |
| 3300006894|Ga0079215_11619183 | Not Available | 515 | Open in IMG/M |
| 3300007004|Ga0079218_10451693 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300007004|Ga0079218_11864643 | Not Available | 678 | Open in IMG/M |
| 3300007521|Ga0105044_11306581 | Not Available | 531 | Open in IMG/M |
| 3300009012|Ga0066710_104696477 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300009083|Ga0105047_10019166 | All Organisms → cellular organisms → Bacteria | 10572 | Open in IMG/M |
| 3300009083|Ga0105047_10061732 | All Organisms → cellular organisms → Bacteria | 5058 | Open in IMG/M |
| 3300009093|Ga0105240_11194374 | Not Available | 806 | Open in IMG/M |
| 3300009098|Ga0105245_12311717 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 591 | Open in IMG/M |
| 3300009098|Ga0105245_12986938 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 524 | Open in IMG/M |
| 3300009100|Ga0075418_11129223 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 849 | Open in IMG/M |
| 3300009137|Ga0066709_100353281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2021 | Open in IMG/M |
| 3300009137|Ga0066709_100832128 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300009137|Ga0066709_102399108 | Not Available | 717 | Open in IMG/M |
| 3300009137|Ga0066709_102509853 | Not Available | 695 | Open in IMG/M |
| 3300009148|Ga0105243_11832353 | Not Available | 638 | Open in IMG/M |
| 3300009156|Ga0111538_11107604 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300009156|Ga0111538_11221102 | Not Available | 950 | Open in IMG/M |
| 3300009177|Ga0105248_12007592 | Not Available | 657 | Open in IMG/M |
| 3300009177|Ga0105248_12691291 | Not Available | 567 | Open in IMG/M |
| 3300009553|Ga0105249_12552956 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300009840|Ga0126313_10913273 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 717 | Open in IMG/M |
| 3300009840|Ga0126313_11206067 | Not Available | 624 | Open in IMG/M |
| 3300010039|Ga0126309_10731280 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 639 | Open in IMG/M |
| 3300010040|Ga0126308_10871097 | Not Available | 626 | Open in IMG/M |
| 3300010042|Ga0126314_11158242 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 577 | Open in IMG/M |
| 3300010044|Ga0126310_11186684 | Not Available | 612 | Open in IMG/M |
| 3300010154|Ga0127503_10103380 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 645 | Open in IMG/M |
| 3300011333|Ga0127502_10808150 | Not Available | 1007 | Open in IMG/M |
| 3300011415|Ga0137325_1050268 | Not Available | 887 | Open in IMG/M |
| 3300011423|Ga0137436_1099163 | Not Available | 768 | Open in IMG/M |
| 3300012046|Ga0136634_10447716 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012212|Ga0150985_100711759 | Not Available | 644 | Open in IMG/M |
| 3300012212|Ga0150985_101952382 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium | 567 | Open in IMG/M |
| 3300012212|Ga0150985_105170740 | Not Available | 1022 | Open in IMG/M |
| 3300012212|Ga0150985_106248819 | Not Available | 844 | Open in IMG/M |
| 3300012212|Ga0150985_109660248 | Not Available | 681 | Open in IMG/M |
| 3300012212|Ga0150985_112254734 | Not Available | 1348 | Open in IMG/M |
| 3300012212|Ga0150985_112425817 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 540 | Open in IMG/M |
| 3300012212|Ga0150985_115142399 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300012212|Ga0150985_115299278 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 649 | Open in IMG/M |
| 3300012212|Ga0150985_117661426 | Not Available | 560 | Open in IMG/M |
| 3300012212|Ga0150985_119603664 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 588 | Open in IMG/M |
| 3300012212|Ga0150985_119974272 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 576 | Open in IMG/M |
| 3300012212|Ga0150985_120260800 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 584 | Open in IMG/M |
| 3300012212|Ga0150985_121478069 | Not Available | 696 | Open in IMG/M |
| 3300012469|Ga0150984_103184736 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 912 | Open in IMG/M |
| 3300012469|Ga0150984_104431712 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 649 | Open in IMG/M |
| 3300012469|Ga0150984_106949142 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 608 | Open in IMG/M |
| 3300012469|Ga0150984_107964910 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 517 | Open in IMG/M |
| 3300012469|Ga0150984_110338792 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium | 582 | Open in IMG/M |
| 3300012469|Ga0150984_112553553 | Not Available | 617 | Open in IMG/M |
| 3300012469|Ga0150984_116416842 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 542 | Open in IMG/M |
| 3300012469|Ga0150984_117489912 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 656 | Open in IMG/M |
| 3300012469|Ga0150984_118188329 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 707 | Open in IMG/M |
| 3300012469|Ga0150984_119618526 | Not Available | 1473 | Open in IMG/M |
| 3300012469|Ga0150984_122808644 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 825 | Open in IMG/M |
| 3300012532|Ga0137373_11137599 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 556 | Open in IMG/M |
| 3300012956|Ga0154020_10033970 | All Organisms → cellular organisms → Bacteria | 5475 | Open in IMG/M |
| 3300013296|Ga0157374_11926782 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300013307|Ga0157372_10144692 | All Organisms → cellular organisms → Bacteria | 2741 | Open in IMG/M |
| 3300013308|Ga0157375_12312490 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 641 | Open in IMG/M |
| 3300014501|Ga0182024_10098844 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4258 | Open in IMG/M |
| 3300015052|Ga0137411_1218376 | Not Available | 667 | Open in IMG/M |
| 3300015360|Ga0163144_10004866 | All Organisms → cellular organisms → Bacteria | 30086 | Open in IMG/M |
| 3300015360|Ga0163144_10046667 | All Organisms → cellular organisms → Bacteria | 7794 | Open in IMG/M |
| 3300015360|Ga0163144_10407890 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300015371|Ga0132258_10505316 | All Organisms → cellular organisms → Bacteria | 3024 | Open in IMG/M |
| 3300015371|Ga0132258_12451952 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300015371|Ga0132258_13236535 | Not Available | 1122 | Open in IMG/M |
| 3300015371|Ga0132258_13798228 | Not Available | 1029 | Open in IMG/M |
| 3300017658|Ga0182738_1035532 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 3344 | Open in IMG/M |
| 3300018073|Ga0184624_10218018 | Not Available | 853 | Open in IMG/M |
| 3300018422|Ga0190265_13406247 | Not Available | 530 | Open in IMG/M |
| 3300018432|Ga0190275_11799338 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300018476|Ga0190274_10607709 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1121 | Open in IMG/M |
| 3300018482|Ga0066669_10567485 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium | 991 | Open in IMG/M |
| 3300018890|Ga0193595_1000020 | All Organisms → cellular organisms → Bacteria | 62687 | Open in IMG/M |
| 3300019362|Ga0173479_10568849 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 586 | Open in IMG/M |
| 3300020005|Ga0193697_1007905 | All Organisms → cellular organisms → Bacteria | 2590 | Open in IMG/M |
| 3300020180|Ga0163155_10377943 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 633 | Open in IMG/M |
| 3300021344|Ga0193719_10006559 | All Organisms → cellular organisms → Bacteria | 4798 | Open in IMG/M |
| 3300022756|Ga0222622_10362802 | Not Available | 1012 | Open in IMG/M |
| 3300022756|Ga0222622_11253259 | Not Available | 546 | Open in IMG/M |
| 3300023272|Ga0247760_1187582 | Not Available | 532 | Open in IMG/M |
| 3300025893|Ga0207682_10062637 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1560 | Open in IMG/M |
| 3300025903|Ga0207680_10465687 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300025908|Ga0207643_10335934 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 946 | Open in IMG/M |
| 3300025913|Ga0207695_11431407 | Not Available | 571 | Open in IMG/M |
| 3300025917|Ga0207660_10529094 | Not Available | 958 | Open in IMG/M |
| 3300025925|Ga0207650_10782800 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 808 | Open in IMG/M |
| 3300025929|Ga0207664_10304413 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1403 | Open in IMG/M |
| 3300025931|Ga0207644_11828705 | Not Available | 508 | Open in IMG/M |
| 3300025935|Ga0207709_10684868 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 819 | Open in IMG/M |
| 3300025937|Ga0207669_11053990 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium | 685 | Open in IMG/M |
| 3300026088|Ga0207641_10815446 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 924 | Open in IMG/M |
| 3300026089|Ga0207648_11932187 | Not Available | 552 | Open in IMG/M |
| 3300026536|Ga0209058_1345247 | Not Available | 515 | Open in IMG/M |
| 3300027637|Ga0209818_1096329 | Not Available | 778 | Open in IMG/M |
| 3300027907|Ga0207428_10982214 | Not Available | 594 | Open in IMG/M |
| 3300027909|Ga0209382_10202544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 2274 | Open in IMG/M |
| 3300028380|Ga0268265_10673062 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium | 997 | Open in IMG/M |
| 3300031022|Ga0138301_1367601 | Not Available | 502 | Open in IMG/M |
| 3300031093|Ga0308197_10408754 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 533 | Open in IMG/M |
| 3300031938|Ga0308175_100008858 | All Organisms → cellular organisms → Bacteria | 7433 | Open in IMG/M |
| 3300031995|Ga0307409_100844315 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 926 | Open in IMG/M |
| 3300031995|Ga0307409_102703324 | Not Available | 524 | Open in IMG/M |
| 3300032002|Ga0307416_100086088 | All Organisms → cellular organisms → Bacteria | 2678 | Open in IMG/M |
| 3300032069|Ga0315282_10039400 | All Organisms → cellular organisms → Bacteria | 5571 | Open in IMG/M |
| 3300032420|Ga0335397_10039259 | All Organisms → cellular organisms → Bacteria | 5315 | Open in IMG/M |
| 3300034384|Ga0372946_0287489 | Not Available | 797 | Open in IMG/M |
| 3300034384|Ga0372946_0509491 | Not Available | 584 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 9.09% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 7.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.55% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.25% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 2.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.95% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.30% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.30% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.30% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.30% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.30% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.30% |
| Poplar Biomass Bioreactor | Engineered → Solid Waste → Wood → Composting → Bioreactor → Poplar Biomass Bioreactor | 1.30% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.65% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.65% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.65% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.65% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.65% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.65% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908004 | Poplar biomass bioreactor microbial communities from Brookhaven National Lab, NY - total biomass decay community | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017658 | Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C BE-Lig MG (version 2) | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300018890 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, bundles v1 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020180 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.SP4.G1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023272 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L171-409R-4 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032420 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly) | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| PBDC3_01467650 | 2124908004 | Poplar Biomass Bioreactor | MLATALPVAAAGWAFLVWLFGGGFGLALVVFFVLKFWAGNADRR |
| PBDC3_04765720 | 2124908004 | Poplar Biomass Bioreactor | MLATALPVAAAGWAFLVWLFGGGFGLALVVFFVLKVLGRYADRR |
| INPhiseqgaiiFebDRAFT_1015578832 | 3300000364 | Soil | MEPLVMAIPLAAAGWAFLVWLCGGGFGLALVVFVVLKMLGK* |
| INPhiseqgaiiFebDRAFT_1047165601 | 3300000364 | Soil | METLAMMLPAAAAGWAFLVWLCGGGFGLALLVFIVLKILGR* |
| A2065W1_100198674 | 3300001537 | Permafrost | MSSELLAVMFPMAAAGPAFLVWLCGGGFGLAVVVFIVLKLFGK* |
| A10PFW1_117427873 | 3300001538 | Permafrost | DSAKGETMSSELLAVMFPMAAAGPAFLVWLCGGGFGLAVVVFIVLKLFGK* |
| Ga0062593_1001283993 | 3300004114 | Soil | MEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK* |
| Ga0062593_1004588121 | 3300004114 | Soil | MMELATIFPLAAAGWAFLVWLFGGGFGLAILVFIVLKVLGR* |
| Ga0062593_1004704932 | 3300004114 | Soil | MELATIVPLAAAGWAFLVWLFGGGFGLAILVFIVLKMLGK* |
| Ga0062593_1031958451 | 3300004114 | Soil | MLELATIIPLAAAGWAFLVWLFGGGFGLAVLVFIVLKLLGR* |
| Ga0062589_1017219521 | 3300004156 | Soil | PAGLTCGSREREETMEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK* |
| Ga0062590_1012215091 | 3300004157 | Soil | GVGPTKERKPMEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK* |
| Ga0062592_1023039061 | 3300004480 | Soil | MLELATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR* |
| Ga0066673_101179611 | 3300005175 | Soil | MELATIFPLAAAGWAFLVWLCGGGFGLALLVFIVLKMLGR* |
| Ga0066675_108903922 | 3300005187 | Soil | MLDLATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR* |
| Ga0070683_1003676241 | 3300005329 | Corn Rhizosphere | MLPVAEMLPLAAAGWAFLVWLCGGGVGLALVVFIVLKVLGK* |
| Ga0070670_1009274921 | 3300005331 | Switchgrass Rhizosphere | METLALMMPLAAAGWAALVWLFGGGFGLALVVFIVLKLFGR* |
| Ga0070666_109227511 | 3300005335 | Switchgrass Rhizosphere | EAAIMIPMAAAGWAFILTWLFGGGIGLFLLLFVVLKMLGK* |
| Ga0070680_1008845902 | 3300005336 | Corn Rhizosphere | MLIPMLPAAAAGWAGLVWLLGGGLPLAIIVFIVLKMMGR* |
| Ga0070692_108188841 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MLELATILPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR* |
| Ga0070671_1003518722 | 3300005355 | Switchgrass Rhizosphere | MLIETALPMAAAGWAFLVWLFGGGLGMALVVFVVLKMLGR* |
| Ga0070674_1019821552 | 3300005356 | Miscanthus Rhizosphere | MTVDMILPMAAAGWAFLVWLFGGGFGLALLVFIVLKMFGK* |
| Ga0070667_1015900212 | 3300005367 | Switchgrass Rhizosphere | MENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR* |
| Ga0070714_1003456151 | 3300005435 | Agricultural Soil | MIELATMLPLAAAGWAFLVWLFGGGFGLALVVFIVLKLLGD* |
| Ga0070714_1007893542 | 3300005435 | Agricultural Soil | MVETVAMVVPVAAAGWAFLTWIFSGSIGLALVVFIVLKAMGR* |
| Ga0070663_1010382512 | 3300005455 | Corn Rhizosphere | VVPVAEMMPLAAAGWAFLVWLCGGGVGLAVVVFIVLKLLGK* |
| Ga0070665_1015319042 | 3300005548 | Switchgrass Rhizosphere | MMLELLPVAAAGWAFLVWLFGGGLGFALVVFVVLKMIGK* |
| Ga0068861_1023923452 | 3300005719 | Switchgrass Rhizosphere | MELATIVPLAAAGWAFLVWLFGGGFGLALVVFIVLKMLGK* |
| Ga0068858_1016792482 | 3300005842 | Switchgrass Rhizosphere | METLAMMVPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR* |
| Ga0068862_1005113952 | 3300005844 | Switchgrass Rhizosphere | MLPVAEMLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK* |
| Ga0066788_100903032 | 3300005944 | Soil | MMTPFATMFPMAAAGWAFLVWLCGGGFGLALVVFVVLKLLGR* |
| Ga0080027_102731872 | 3300005993 | Prmafrost Soil | MELVATMFPVAAAGWAFLVWLGGGGFGLALVVFVVLKLLGR* |
| Ga0066652_1007915563 | 3300006046 | Soil | MYDLATMLPVAAAGWAFLVWLCGGGFGLAILVFIVLKMLGR* |
| Ga0079222_115532831 | 3300006755 | Agricultural Soil | MEDLVVPVAEMMPLGGGQAFLVWLCGGGVGLTVIVFIVLKLLGK* |
| Ga0075428_1003814842 | 3300006844 | Populus Rhizosphere | MIEIMTMLPLAAAGWAFLVWLFGGGLGLALIVFIVMKIVGH* |
| Ga0075425_1005014102 | 3300006854 | Populus Rhizosphere | MSELATILPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR* |
| Ga0075434_1026650821 | 3300006871 | Populus Rhizosphere | MLELAAVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR* |
| Ga0079217_102635432 | 3300006876 | Agricultural Soil | MELIVQSIPLAAAGWAFLVWLFGGGVGLALAVFLVLKLLGK* |
| Ga0079217_103423653 | 3300006876 | Agricultural Soil | MLPVAEILPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK* |
| Ga0079215_116191832 | 3300006894 | Agricultural Soil | MELIVQSIPLAAAGWAFLVWLFGGGLGLALAVFLVLKLLGK* |
| Ga0079218_104516932 | 3300007004 | Agricultural Soil | MIEIMTMMPLAAAGWAFLVWLFGGGLGLALIVFLVMKLMGQ* |
| Ga0079218_118646433 | 3300007004 | Agricultural Soil | AEILPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK* |
| Ga0105044_113065812 | 3300007521 | Freshwater | LEDNMLLTLIPVAAAGWAFLVWLVGGGFGLALLVFLGLKLLGK* |
| Ga0066710_1046964772 | 3300009012 | Grasslands Soil | MLELATIAPLAAAGWAFLTYLFTGSVGLALLVFIVLKIVGR |
| Ga0105047_100191662 | 3300009083 | Freshwater | MLDILALTIPLAAAGYALLVWLFGGGLGLALVVFVLMKMLGK* |
| Ga0105047_100617322 | 3300009083 | Freshwater | MLEVIHPTLEAAAAGWAFLVWLFGGGFTLAIIVFVVMKMMGK* |
| Ga0105240_111943742 | 3300009093 | Corn Rhizosphere | MVETVAMIAPVAAAGWAFLTWILSGSFGLAIVVFIFLKVLGR* |
| Ga0105245_123117172 | 3300009098 | Miscanthus Rhizosphere | MLEMLPVAAAGWAFLVWLFGGGLGLALVVFVVLKLLGQ* |
| Ga0105245_129869382 | 3300009098 | Miscanthus Rhizosphere | LPMAAAGWAFLVWLFGGGLGMALVVCVVLKMLGR* |
| Ga0075418_111292232 | 3300009100 | Populus Rhizosphere | MMLEMLPVAAAGWAFLVWLFGGGLGLALVVFVVLKLLGQ* |
| Ga0066709_1003532812 | 3300009137 | Grasslands Soil | MLPLAALGWAFLVWLFGGGLGLAVVVFIVLKLMGK* |
| Ga0066709_1008321282 | 3300009137 | Grasslands Soil | MLELATIAPLAAAGWAFLTYLFTGSVGLALLVFIVLKIVGR* |
| Ga0066709_1023991081 | 3300009137 | Grasslands Soil | MVPVAEVLPLAAAGWAFLVWLFGGGLGLAVVVFIVLKLLGK* |
| Ga0066709_1025098532 | 3300009137 | Grasslands Soil | MTPELMLPVAAAGWAFLAWLFGGGFGLAVVVFIVLKMLGR* |
| Ga0105243_118323531 | 3300009148 | Miscanthus Rhizosphere | MMPLAAAGWAFLVWLCGGGVGLAVVVFIVLKLLGK* |
| Ga0111538_111076042 | 3300009156 | Populus Rhizosphere | MLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK* |
| Ga0111538_112211022 | 3300009156 | Populus Rhizosphere | MIEVMTMVPLAAAGWAFLVWLFGGGLGIAFIVFIVMKMLGH* |
| Ga0105248_120075922 | 3300009177 | Switchgrass Rhizosphere | MFTEMLPMAAAGWAFLVWLFGGGFGLALVVFIVLKALGR* |
| Ga0105248_126912912 | 3300009177 | Switchgrass Rhizosphere | METLALMMPLAAAGWAFLVWLFGGGFGLARVVVIVLKLFGR* |
| Ga0105249_125529562 | 3300009553 | Switchgrass Rhizosphere | VPLAAAGWAFLVWLFGGGFGLAILVFIVLKMLGK* |
| Ga0126313_109132732 | 3300009840 | Serpentine Soil | MMLELLPVAAAGWAFLVWLFGGGLGLALVVFVVMKLIGH* |
| Ga0126313_112060671 | 3300009840 | Serpentine Soil | MMPLAAAGWAFLVWLCGGGVGLAIVVFIVLKLLGK* |
| Ga0126309_107312802 | 3300010039 | Serpentine Soil | MAIPLAAAGWAFLVWLCGGGFGLALVVFIVLKMFGK* |
| Ga0126308_108710971 | 3300010040 | Serpentine Soil | MNIMFVTEMLPLAAAGLAFLVWLFGGGLGFALVVFIVLKMLGK* |
| Ga0126314_111582422 | 3300010042 | Serpentine Soil | MITMLPAAAAGWAFLVWLFGGGFGLALVVFIVLKMLGK* |
| Ga0126310_111866842 | 3300010044 | Serpentine Soil | MILPVAAAGWAFLVWLFGGGFGLALVVFIVLKMLGR* |
| Ga0127503_101033801 | 3300010154 | Soil | ARDNQENAMETLAMILPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR* |
| Ga0127502_108081502 | 3300011333 | Soil | MLEVATLIPLAAAGWAFLVWLFGGGLGLALIVFVALKLMGK* |
| Ga0137325_10502682 | 3300011415 | Soil | MMELATVLPMAAAGWAFLVWLLGGGLGLAIVVFIVLKMLGR* |
| Ga0137436_10991632 | 3300011423 | Soil | MMEIMTMMPLAAAGWAFLVWLFGGGLGLALIVFLGMKMLGK* |
| Ga0136634_104477162 | 3300012046 | Polar Desert Sand | GDRKMELATLLPVAAAGWAFLVWLLGGGLGLALLVFIVLKVIGR* |
| Ga0150985_1007117591 | 3300012212 | Avena Fatua Rhizosphere | MLELATLFPLAAAGWAFLVWLFGGGFGLAVLVFIVLKVLGR* |
| Ga0150985_1019523821 | 3300012212 | Avena Fatua Rhizosphere | RLVYERRSCMETLATILPLAAAGWAFLVWLFGGGFGLALVVFVVLKMLGK* |
| Ga0150985_1051707401 | 3300012212 | Avena Fatua Rhizosphere | MVPMLSEMMILGAAGWAFLVWLCGGGFGLAILVFIVLKVLGK* |
| Ga0150985_1062488192 | 3300012212 | Avena Fatua Rhizosphere | MLPVAEVLPLAAAGWAFLVWLCGGGFGLAVVVFIVLKLMGK* |
| Ga0150985_1096602482 | 3300012212 | Avena Fatua Rhizosphere | MIIEMVPFAAAGWAFLVWLFGGGFGLALVVFLVLKMMGR* |
| Ga0150985_1122547341 | 3300012212 | Avena Fatua Rhizosphere | MVPMVAEMAILGAAGWAFLVWLCGGGFGLAIVVFIVLKLLGK* |
| Ga0150985_1124258171 | 3300012212 | Avena Fatua Rhizosphere | QRSRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR* |
| Ga0150985_1151423991 | 3300012212 | Avena Fatua Rhizosphere | MITTMLPAAAAGWAFLVWLFGGGFGLAVVVFIVLKMLGR* |
| Ga0150985_1152992782 | 3300012212 | Avena Fatua Rhizosphere | RALPQRSRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR* |
| Ga0150985_1176614262 | 3300012212 | Avena Fatua Rhizosphere | MVPMVAEMAILGAAGWAFLVWLCGGGFGLAVVVFIVLKLLGK* |
| Ga0150985_1196036641 | 3300012212 | Avena Fatua Rhizosphere | METLAMIFPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR* |
| Ga0150985_1199742721 | 3300012212 | Avena Fatua Rhizosphere | RHTPERKDHVMMLELLPVAAAGWAFLVWLFGGGLGLALVVFVVLKLIGQ* |
| Ga0150985_1202608002 | 3300012212 | Avena Fatua Rhizosphere | METLAMMIPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR* |
| Ga0150985_1214780692 | 3300012212 | Avena Fatua Rhizosphere | MLELATILPMAAAGWAFLVWLFGGGFGLAILVFIVLKALGR* |
| Ga0150984_1031847362 | 3300012469 | Avena Fatua Rhizosphere | RTQMETLAMIFPMAAAGWAFLVWLCGGGFGLPLLVFIVLKVLGR* |
| Ga0150984_1044317121 | 3300012469 | Avena Fatua Rhizosphere | RALPQRRRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR* |
| Ga0150984_1063561172 | 3300012469 | Avena Fatua Rhizosphere | DVCSSDLNHMLEAAIMIPMAAAGWAFILTWLFGGGIGLFLLLFVVLKMLGK* |
| Ga0150984_1069491422 | 3300012469 | Avena Fatua Rhizosphere | KRALPQRSRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR* |
| Ga0150984_1079649101 | 3300012469 | Avena Fatua Rhizosphere | MQELAMMYPMAAAGWAFLVWLFGGGIGAALVVFVLLKMLGK* |
| Ga0150984_1103387922 | 3300012469 | Avena Fatua Rhizosphere | MLELATMVPMAAAGWAFLVWLFGGGFGLALIVFIVLKMIGR* |
| Ga0150984_1125535532 | 3300012469 | Avena Fatua Rhizosphere | MFPMAAAGWAFLVWLFGGGFGLALLVFIVLKMMGR* |
| Ga0150984_1164168421 | 3300012469 | Avena Fatua Rhizosphere | ALPQRSRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR* |
| Ga0150984_1174899122 | 3300012469 | Avena Fatua Rhizosphere | MLELATILPMAAAGWAFLVWLFGGGFGLAVVVFIVLKMLGR* |
| Ga0150984_1181883292 | 3300012469 | Avena Fatua Rhizosphere | MATEMLPLAAAGWAFLVWLFGGGFGLALVVFVVLKMLGR* |
| Ga0150984_1196185261 | 3300012469 | Avena Fatua Rhizosphere | MVPMLSEMMILGAAGWAFLVWLCGGGVGLAILVFIVLKVLGK* |
| Ga0150984_1228086441 | 3300012469 | Avena Fatua Rhizosphere | MMLELLPVAAAGWAFLVWLFGGGLGLALVVFVVLKLIGQ* |
| Ga0137373_111375991 | 3300012532 | Vadose Zone Soil | MVTTMLPAAAAGWAFLVWLFGGGFGLALVVFIVLKMLGR* |
| Ga0154020_100339704 | 3300012956 | Active Sludge | MMMAELIPLAAAGWAFLAWLLGGGLGLAILVFIVLKLLGK* |
| Ga0157374_119267821 | 3300013296 | Miscanthus Rhizosphere | MLPVAEMLPLAAAGWAFLVWLFGGGLGMALVVFVVLKMLGR* |
| Ga0157372_101446923 | 3300013307 | Corn Rhizosphere | MVETVAMIAPVAAAGWAFLTWILSGSFGLALVVFVFLKMLGR* |
| Ga0157375_123124902 | 3300013308 | Miscanthus Rhizosphere | QQMLITDMLPLAAAGWAFLVWLFGGGFGLAVLVFIVLKMLGR* |
| Ga0182024_100988442 | 3300014501 | Permafrost | MMTLALILPVAAAGWAFLYWLFGGGLGGAFAIFIVLKLLGK* |
| Ga0137411_12183761 | 3300015052 | Vadose Zone Soil | FMLELATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR* |
| Ga0163144_1000486614 | 3300015360 | Freshwater Microbial Mat | MVPMIAEVLPLAAAGWAFLVWLVGGGFGLAIIVFILLKVLGK* |
| Ga0163144_100466676 | 3300015360 | Freshwater Microbial Mat | MLIPLIPVAAAGYAFLVWLFGGGFALALVVFVALKVLGK* |
| Ga0163144_104078902 | 3300015360 | Freshwater Microbial Mat | MIDLLANIYPMAAGGWALLVWLAGGGFGLAILVFIILKVMGK* |
| Ga0132258_105053162 | 3300015371 | Arabidopsis Rhizosphere | MHELAIIFPLAAAGWAFLVWLFGGGFGLALVVFVALKVLGR* |
| Ga0132258_124519522 | 3300015371 | Arabidopsis Rhizosphere | MVPVAEMLPLAAAGWAFLVWLCGGGFGLAVVVFIVLKLMGK* |
| Ga0132258_132365352 | 3300015371 | Arabidopsis Rhizosphere | MVPVAEILPLAAAGWAFLVWLCGGGFGLAVVVFIVLKLMGK* |
| Ga0132258_137982282 | 3300015371 | Arabidopsis Rhizosphere | MLPVAEMLPLAAAGWAFLVWLCGGGVGLALVVFIVLKALGK* |
| Ga0182738_10355322 | 3300017658 | Compost | MPPLELMLPLAAAGWAFLVWLCGGGLGLAILVFIVLKVLGH |
| Ga0184624_102180181 | 3300018073 | Groundwater Sediment | VVPVAEMMPLAAAGWAFLVWLCGGGVGLAVVVFIVLKLLGK |
| Ga0190265_134062472 | 3300018422 | Soil | MLELAAILPMAAAGWAFLVWLLGGGLGLAIVVFIVLKMLGR |
| Ga0190275_117993382 | 3300018432 | Soil | MLPVAEMLPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK |
| Ga0190274_106077091 | 3300018476 | Soil | METLALTMPLAAGGWAFLVWLFGGGLGLALVVFVVLKLFGR |
| Ga0066669_105674852 | 3300018482 | Grasslands Soil | MLEIATIFPLAAAGWAFLVWLFGGGFGLALLVFIVLKVLGR |
| Ga0193595_10000206 | 3300018890 | Soil | MVELAMLFPMAALGWAFLVWLFGGGLGLAVLVFIVMKVLGH |
| Ga0173479_105688492 | 3300019362 | Soil | HSDGLGVGPTKERKPMEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK |
| Ga0193697_10079052 | 3300020005 | Soil | MLPVAEMLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK |
| Ga0163155_103779432 | 3300020180 | Freshwater Microbial Mat | IYPMAAGGWALLVWLAGGGFGLAILVFIILKVMGK |
| Ga0193719_100065595 | 3300021344 | Soil | MLELATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR |
| Ga0222622_103628021 | 3300022756 | Groundwater Sediment | VAEMLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK |
| Ga0222622_112532592 | 3300022756 | Groundwater Sediment | MLPVAEMLPLAAAGWAFLVWLCGGGVGLALLVFIVLKMIGK |
| Ga0247760_11875822 | 3300023272 | Plant Litter | MIETLALTLPVAAAGWAFLVWLFGGGFGLALLVFIVLKVLGK |
| Ga0207682_100626372 | 3300025893 | Miscanthus Rhizosphere | MEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK |
| Ga0207680_104656872 | 3300025903 | Switchgrass Rhizosphere | MLPVAEMLPLAAAGWAFLVWLCGGGVGLALVVFIVLKVLGK |
| Ga0207643_103359341 | 3300025908 | Miscanthus Rhizosphere | MLELATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGH |
| Ga0207695_114314071 | 3300025913 | Corn Rhizosphere | MVETVAMIAPVAAAGWAFLTWILSGSFGLAIVVFIFLKVLGR |
| Ga0207660_105290942 | 3300025917 | Corn Rhizosphere | MLIPMLPAAAAGWAGLVWLLGGGLPLAIIVFIVLKMMGR |
| Ga0207650_107828001 | 3300025925 | Switchgrass Rhizosphere | METLALMMPLAAAGWAALVWLFGGGFGLALVVFIVLKLFGR |
| Ga0207664_103044132 | 3300025929 | Agricultural Soil | MIELATMLPLAAAGWAFLVWLFGGGFGLALVVFIVLKLLGD |
| Ga0207644_118287051 | 3300025931 | Switchgrass Rhizosphere | MLELATLFPLAAAGWAFLVWLFGGGFGLAVLVFIVLKVLGR |
| Ga0207709_106848682 | 3300025935 | Miscanthus Rhizosphere | MLIETALPMAAAGWAFLVWLFGGGLGMALVVFVVLKMLGR |
| Ga0207669_110539902 | 3300025937 | Miscanthus Rhizosphere | MLEAAIMIPMAAAGWAFILTWLFGGGIGLFLLLFVVLKMLGK |
| Ga0207641_108154461 | 3300026088 | Switchgrass Rhizosphere | METLAMMVPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR |
| Ga0207648_119321871 | 3300026089 | Miscanthus Rhizosphere | MLIETALPMAAAGWAFLVWLFGGGLGMALVVFVVLKMLGA |
| Ga0209058_13452472 | 3300026536 | Soil | VVLIADMLPLAALGWAFLVWLFGGGLGLAVVVFIVLKLMGK |
| Ga0209818_10963291 | 3300027637 | Agricultural Soil | MLPVAEILPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK |
| Ga0207428_109822142 | 3300027907 | Populus Rhizosphere | LPVAEMLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK |
| Ga0209382_102025442 | 3300027909 | Populus Rhizosphere | MIEIMTMLPLAAAGWAFLVWLFGGGLGLALIVFIVMKIVGH |
| Ga0268265_106730621 | 3300028380 | Switchgrass Rhizosphere | VTLALGYPLAAAGWAFMVWLFGGGLGLALLVFVVLKIL |
| Ga0138301_13676012 | 3300031022 | Soil | MSLAEILPLAAAGWAFLVWLSGGGLGLALLVFVVLEVLGR |
| Ga0308197_104087542 | 3300031093 | Soil | LEAAIMIPMAAAGWAFILTWLFGGGIGLFLLLFVVLKMLGK |
| Ga0308175_1000088582 | 3300031938 | Soil | MTGLEIIPLAAAGWAFLTWLFTGSIGLALLVFIVLKLIGR |
| Ga0307409_1008443152 | 3300031995 | Rhizosphere | MELFAQSIPLAAAGWAFLVWLFGGGLGLAVAVFVVMKLLGK |
| Ga0307409_1027033242 | 3300031995 | Rhizosphere | MDLLAQSIPLAAAGWAFLVWLFGGGLGLAVAVFVVLKLLGK |
| Ga0307416_1000860883 | 3300032002 | Rhizosphere | MDLLAQSIPLAAAGWAFLVWLFGGGLGLAVAVFVVLKLMGK |
| Ga0315282_100394006 | 3300032069 | Sediment | MLAVLSTIILAAAGWAFLVWLCGGGVGLAILVFIVLKVLGH |
| Ga0308173_103825342 | 3300032074 | Soil | MLIPMLPAAAAGWAGLVWLLGGGLPLAIIVFVVLKMMGR |
| Ga0308173_110834171 | 3300032074 | Soil | TVEAPMVPMLAEMMIVGAAGWAFLVWLCGGGFGLAILVFIVLKVLGK |
| Ga0335397_100392595 | 3300032420 | Freshwater | MLDILALTIPLAAAGYALLVWLFGGGLGLALVVFVLMKMLGK |
| Ga0372946_0287489_428_553 | 3300034384 | Soil | MFLVAEMLPLAAAGWAFLVWLFGGGLGLAALVFIVLKMLGK |
| Ga0372946_0509491_67_174 | 3300034384 | Soil | MIPLAAAGWAFLVWLFGGGLGLAVVVFIVLKLLGK |
| ⦗Top⦘ |