Metagenome Family F044328

Overview

Basic Information

• Family ID: F044328
• Family Type: Metagenome
• Number of Sequences: 154
• Average Sequence Length: 44 residues
• Representative Sequence: VVERVTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLRK
• Number of Associated Samples: 7
• Number of Associated Scaffolds: 154

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 19.12 %
• % of genes near scaffold ends (potentially truncated): 73.38 %
• % of genes from short scaffolds (< 2000 bps): 69.48 %
• Associated GOLD sequencing projects: 5
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (46.753 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont (87.013 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 6.94%
  β-sheet: 0.00%
  Coil/Unstructured: 93.06%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 154 Family Scaffolds
PF00078	RVT_1	4.55
PF01504	PIP5K	1.30
PF00005	ABC_tran	1.30
PF13855	LRR_8	0.65
PF02931	Neur_chan_LBD	0.65
PF00092	VWA	0.65
PF00995	Sec1	0.65
PF00059	Lectin_C	0.65

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	51.95 %
Unclassified	root	N/A	46.75 %
Rhodophyta	phylum	Rhodophyta	1.30 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	50.65 %
Unclassified	root	N/A	46.75 %
Viruses	superkingdom	All Organisms → Viruses	1.30 %
Florideophyceae	class	Rhodophyta → Florideophyceae	1.30 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	37.66 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	12.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %
Rhodymeniophycidae	subclass	Rhodophyta → Florideophyceae → Rhodymeniophycidae	1.30 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	37.66 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	11.69 %
Ceramiales	order	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	37.66 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	5.19 %
Rhodomelaceae	family	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	37.66 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	5.19 %
Polysiphonioideae	subfamily	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	37.66 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	5.19 %
Digenea	genus	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	37.66 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	2.60 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	2.60 %
Digenea	genus	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	37.66 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	2.60 %
Digenea	genus	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %
Echinodermata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata	1.95 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.65 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	37.66 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	2.60 %
Digenea	genus	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %
Eleutherozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa	1.95 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	0.65 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	37.66 %
Asterozoa	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Asterozoa	1.30 %
Digenea	genus	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1.95 %
Platyhelminthes	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Platyhelminthes	0.65 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	0.65 %
Echinozoa	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa	0.65 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	37.66 %
Asteroidea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Asterozoa → Asteroidea	1.30 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	1.30 %
Digenea	genus	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %
Rhabditophora	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Platyhelminthes → Rhabditophora	0.65 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	0.65 %
Clitellata	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata	0.65 %
Echinoidea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea	0.65 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	37.66 %
Forcipulatacea	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Asterozoa → Asteroidea → Forcipulatacea	1.30 %
Polychaeta incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis	1.30 %
Digenea	genus	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %
Seriata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Platyhelminthes → Rhabditophora → Seriata	0.65 %
Euechinoidea	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea	0.65 %
Hirudinea	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea	0.65 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	0.65 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	37.66 %
Dinophilidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae	1.30 %
Forcipulatida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Asterozoa → Asteroidea → Forcipulatacea → Forcipulatida	1.30 %
Digenea	genus	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %
Rhynchobdellida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida	0.65 %
Tricladida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Platyhelminthes → Rhabditophora → Seriata → Tricladida	0.65 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	0.65 %
Echinacea	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea	0.65 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	37.66 %
Dimorphilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus	1.30 %
Asteriidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Asterozoa → Asteroidea → Forcipulatacea → Forcipulatida → Asteriidae	1.30 %
Digenea	genus	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %
Glossiphoniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae	0.65 %
Continenticola	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Platyhelminthes → Rhabditophora → Seriata → Tricladida → Continenticola	0.65 %
Temnopleuroida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida	0.65 %
Actinopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii	0.65 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	37.66 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	1.30 %
Asterias	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Asterozoa → Asteroidea → Forcipulatacea → Forcipulatida → Asteriidae → Asterias	1.30 %
Digenea	genus	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %
Helobdella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella	0.65 %
Cladistia	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia	0.65 %
Geoplanoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Platyhelminthes → Rhabditophora → Seriata → Tricladida → Continenticola → Geoplanoidea	0.65 %
Toxopneustidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae	0.65 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	37.66 %
Asterias rubens	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Asterozoa → Asteroidea → Forcipulatacea → Forcipulatida → Asteriidae → Asterias → Asterias rubens	1.30 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	1.30 %
Digenea	genus	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.65 %
Lytechinus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus	0.65 %
Polypteriformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes	0.65 %
Dugesiidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Platyhelminthes → Rhabditophora → Seriata → Tricladida → Continenticola → Geoplanoidea → Dugesiidae	0.65 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	37.66 %
Asterias rubens	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Asterozoa → Asteroidea → Forcipulatacea → Forcipulatida → Asteriidae → Asterias → Asterias rubens	1.30 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	1.30 %
Digenea	genus	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %
Polypteridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae	0.65 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.65 %
Schmidtea	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Platyhelminthes → Rhabditophora → Seriata → Tricladida → Continenticola → Geoplanoidea → Dugesiidae → Schmidtea	0.65 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.65 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	37.66 %
Asterias rubens	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Asterozoa → Asteroidea → Forcipulatacea → Forcipulatida → Asteriidae → Asterias → Asterias rubens	1.30 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	1.30 %
Digenea	genus	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %
Polypterus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus	0.65 %
Schmidtea mediterranea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Platyhelminthes → Rhabditophora → Seriata → Tricladida → Continenticola → Geoplanoidea → Dugesiidae → Schmidtea → Schmidtea mediterranea	0.65 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.65 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.65 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.75 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	37.66 %
Asterias rubens	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Asterozoa → Asteroidea → Forcipulatacea → Forcipulatida → Asteriidae → Asterias → Asterias rubens	1.30 %
Dimorphilus gyrociliatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	1.30 %
Digenea	genus	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1.30 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.30 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	0.65 %
Schmidtea mediterranea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Platyhelminthes → Rhabditophora → Seriata → Tricladida → Continenticola → Geoplanoidea → Dugesiidae → Schmidtea → Schmidtea mediterranea	0.65 %
Lytechinus variegatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	0.65 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.65 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300004626|Ga0066188_1024831	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1692
3300004626|Ga0066188_1082936	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1105
3300004626|Ga0066188_1093921	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1048
3300004626|Ga0066188_1104914	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	998
3300004626|Ga0066188_1115795	Not Available	952
3300004626|Ga0066188_1135264	Not Available	882
3300004626|Ga0066188_1145778	Not Available	849
3300004626|Ga0066188_1147165	Not Available	845
3300004626|Ga0066188_1162499	Not Available	800
3300004626|Ga0066188_1165491	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	792
3300004626|Ga0066188_1192294	Not Available	726
3300004626|Ga0066188_1239086	Not Available	633
3300004626|Ga0066188_1241534	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	629
3300004626|Ga0066188_1243283	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	626
3300004626|Ga0066188_1271195	Not Available	581
3300004626|Ga0066188_1298341	All Organisms → cellular organisms → Eukaryota → Opisthokonta	542
3300004626|Ga0066188_1305182	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	533
3300005968|Ga0056130_1002711	All Organisms → Viruses → Predicted Viral	4875
3300005968|Ga0056130_1009086	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3566
3300005968|Ga0056130_1016440	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2982
3300005968|Ga0056130_1016635	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2972
3300005968|Ga0056130_1023941	Not Available	2637
3300005968|Ga0056130_1028230	Not Available	2484
3300005968|Ga0056130_1039031	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2191
3300005968|Ga0056130_1069060	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	1695
3300005968|Ga0056130_1072522	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Asterozoa → Asteroidea → Forcipulatacea → Forcipulatida → Asteriidae → Asterias → Asterias rubens	1653
3300005968|Ga0056130_1083759	Not Available	1535
3300005968|Ga0056130_1084506	Not Available	1527
3300005968|Ga0056130_1091251	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1464
3300005968|Ga0056130_1141392	Not Available	1114
3300005968|Ga0056130_1150609	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1066
3300005968|Ga0056130_1156361	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1038
3300005968|Ga0056130_1177938	Not Available	939
3300005968|Ga0056130_1185907	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	907
3300005968|Ga0056130_1193596	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	877
3300005968|Ga0056130_1195714	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	869
3300005968|Ga0056130_1203234	Not Available	842
3300005968|Ga0056130_1207543	Not Available	827
3300005968|Ga0056130_1209899	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	819
3300005968|Ga0056130_1224182	Not Available	772
3300005968|Ga0056130_1229679	Not Available	755
3300005968|Ga0056130_1244855	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	712
3300005968|Ga0056130_1245407	Not Available	710
3300005968|Ga0056130_1257770	Not Available	677
3300005968|Ga0056130_1278925	Not Available	625
3300005968|Ga0056130_1287945	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	605
3300005968|Ga0056130_1289874	Not Available	601
3300005968|Ga0056130_1297849	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	584
3300005968|Ga0056130_1306006	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	568
3300005968|Ga0056130_1318297	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	544
3300005978|Ga0056129_1025047	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3448
3300005978|Ga0056129_1031294	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3144
3300005978|Ga0056129_1045052	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2652
3300005978|Ga0056129_1064392	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Polychaeta incertae sedis → Dinophilidae → Dimorphilus → Dimorphilus gyrociliatus	2193
3300005978|Ga0056129_1071641	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2058
3300005978|Ga0056129_1074211	Not Available	2014
3300005978|Ga0056129_1142237	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1255
3300005978|Ga0056129_1148312	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1210
3300005978|Ga0056129_1151489	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1188
3300005978|Ga0056129_1214400	Not Available	841
3300005978|Ga0056129_1226368	Not Available	792
3300005978|Ga0056129_1233448	Not Available	764
3300005978|Ga0056129_1242218	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	732
3300005978|Ga0056129_1247553	Not Available	713
3300005978|Ga0056129_1270102	Not Available	641
3300005978|Ga0056129_1294761	Not Available	576
3300005978|Ga0056129_1302723	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	557
3300005978|Ga0056129_1310312	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	540
3300005978|Ga0056129_1320970	Not Available	518
3300005978|Ga0056129_1329830	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	501
3300006912|Ga0056114_1010511	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	6147
3300006912|Ga0056114_1022021	Not Available	4607
3300006912|Ga0056114_1026939	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4195
3300006912|Ga0056114_1028728	All Organisms → cellular organisms → Eukaryota	4068
3300006912|Ga0056114_1038140	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3517
3300006912|Ga0056114_1042044	Not Available	3329
3300006912|Ga0056114_1043761	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3257
3300006912|Ga0056114_1056206	Not Available	2795
3300006912|Ga0056114_1061840	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Platyhelminthes → Rhabditophora → Seriata → Tricladida → Continenticola → Geoplanoidea → Dugesiidae → Schmidtea → Schmidtea mediterranea	2621
3300006912|Ga0056114_1062216	All Organisms → cellular organisms → Eukaryota	2610
3300006912|Ga0056114_1078869	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2198
3300006912|Ga0056114_1091187	Not Available	1953
3300006912|Ga0056114_1096517	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1859
3300006912|Ga0056114_1097888	Not Available	1836
3300006912|Ga0056114_1098977	Not Available	1818
3300006912|Ga0056114_1099942	Not Available	1803
3300006912|Ga0056114_1109535	Not Available	1655
3300006912|Ga0056114_1113343	Not Available	1602
3300006912|Ga0056114_1121465	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	1496
3300006912|Ga0056114_1139532	Not Available	1291
3300006912|Ga0056114_1145307	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1234
3300006912|Ga0056114_1173156	Not Available	1000
3300006912|Ga0056114_1176201	Not Available	978
3300006912|Ga0056114_1202838	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Echinoidea → Euechinoidea → Echinacea → Temnopleuroida → Toxopneustidae → Lytechinus → Lytechinus variegatus	813
3300006912|Ga0056114_1209982	Not Available	776
3300006912|Ga0056114_1212222	Not Available	765
3300006912|Ga0056114_1219858	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	729
3300006912|Ga0056114_1235398	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	663
3300006912|Ga0056114_1248742	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	616
3300006912|Ga0056114_1248924	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	615
3300006912|Ga0056114_1261192	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	578
3300006912|Ga0056114_1269576	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	555
3300006912|Ga0056114_1285412	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	517
3300006912|Ga0056114_1291697	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	504
3300008214|Ga0056111_1008102	All Organisms → cellular organisms → Eukaryota → Opisthokonta	830
3300027289|Ga0209787_1001789	All Organisms → Viruses → Predicted Viral	4500
3300027289|Ga0209787_1048324	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1685
3300027289|Ga0209787_1050115	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Asterozoa → Asteroidea → Forcipulatacea → Forcipulatida → Asteriidae → Asterias → Asterias rubens	1659
3300027289|Ga0209787_1070801	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1411
3300027289|Ga0209787_1100800	Not Available	1168
3300027289|Ga0209787_1126262	Not Available	1021
3300027289|Ga0209787_1130546	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1000
3300027289|Ga0209787_1134063	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	983
3300027289|Ga0209787_1154615	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	893
3300027289|Ga0209787_1179661	Not Available	794
3300027289|Ga0209787_1187610	Not Available	766
3300027289|Ga0209787_1188391	Not Available	763
3300027289|Ga0209787_1250706	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	584
3300027289|Ga0209787_1266319	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	546
3300027289|Ga0209787_1275218	Not Available	526
3300027392|Ga0209680_1009806	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4551
3300027392|Ga0209680_1009850	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4545
3300027392|Ga0209680_1040931	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2598
3300027392|Ga0209680_1060798	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2123
3300027392|Ga0209680_1105352	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1492
3300027392|Ga0209680_1109679	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1446
3300027392|Ga0209680_1112730	Not Available	1416
3300027392|Ga0209680_1122779	Rhodophyta → Florideophyceae → Rhodymeniophycidae → Ceramiales → Rhodomelaceae → Polysiphonioideae → Digenea	1321
3300027392|Ga0209680_1144892	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1145
3300027392|Ga0209680_1164644	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1014
3300027392|Ga0209680_1177206	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	942
3300027392|Ga0209680_1182241	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	914
3300027392|Ga0209680_1183436	Not Available	908
3300027392|Ga0209680_1185540	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	897
3300027392|Ga0209680_1199356	Not Available	824
3300027392|Ga0209680_1199727	Not Available	822

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Category

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Type

Habitat	Taxonomy	Distribution
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	87.01%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	12.99%

Subtype

Habitat	Taxonomy	Distribution
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	87.01%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	12.99%

Habitat

Habitat	Taxonomy	Distribution
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	87.01%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	12.99%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300004626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.2	Host-Associated
3300005968	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2	Host-Associated
3300005978	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1	Host-Associated
3300006912	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.1	Host-Associated
3300008214	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius longissimus B BELIZE.2	Host-Associated
3300027289	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2 (SPAdes)	Host-Associated
3300027392	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0066188_10248311	3300004626	Marine Gutless Worms Symbiont	RKIVVERVTVVKFGVDNRGSDGTGRFRIEVRTDTAELPDMRVA*
Ga0066188_10829363	3300004626	Marine Gutless Worms Symbiont	RFRKIVVERVTVVKFRVDNRGSDGTGRFRIEVRTNTAELSDMRVA*
Ga0066188_10939211	3300004626	Marine Gutless Worms Symbiont	IVVERVTVVKFRVDNRGSDGTGCFRIEVMTDTAELSDMRVAGLRK*
Ga0066188_11049142	3300004626	Marine Gutless Worms Symbiont	LRLRKIVVERVTVVKFRVDNRGSDGTGCRIKVRTDTAELSVMRIAGLSKC*
Ga0066188_11157952	3300004626	Marine Gutless Worms Symbiont	RVTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRIAARLRK*
Ga0066188_11352642	3300004626	Marine Gutless Worms Symbiont	VTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLRKR*
Ga0066188_11457781	3300004626	Marine Gutless Worms Symbiont	LRFRKIVVKRVTIVNFRVDNRGSDGTGCFRIEVRTDTAELSDMIIAGLRK*
Ga0066188_11471651	3300004626	Marine Gutless Worms Symbiont	VTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLIESDEI*
Ga0066188_11599492	3300004626	Marine Gutless Worms Symbiont	LRFRKIVVERVTAVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVVGLRK*
Ga0066188_11624991	3300004626	Marine Gutless Worms Symbiont	LRLRKIVAERVTVVKFGVDNRSSDGTGRFRIEVRTDTAELSDMRVA*
Ga0066188_11654911	3300004626	Marine Gutless Worms Symbiont	VVERVTVVKFRVDNRGSNGTGCFRIEVRTDTAELANMRI*
Ga0066188_11922941	3300004626	Marine Gutless Worms Symbiont	VTVVKFRVDNRGSNGTGCFRIKVRTDTAELTNMRIENSRT*
Ga0066188_12217001	3300004626	Marine Gutless Worms Symbiont	MLNLLEAIYVRHHKIVVERVTVFKFGLDNRGSDGTDCFRIEVRTDTTEFTDIRIAGL*
Ga0066188_12390862	3300004626	Marine Gutless Worms Symbiont	VAVVKFRVDNRGSDGTGCFRIEVRTDTAELSAMRVAGLRK*
Ga0066188_12415341	3300004626	Marine Gutless Worms Symbiont	VVERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVEL*
Ga0066188_12432832	3300004626	Marine Gutless Worms Symbiont	LRFRKVVVERVTVVKFRVDNRGSDGTGCFRIEVITDTAELSDMRLAGLR*
Ga0066188_12711951	3300004626	Marine Gutless Worms Symbiont	VTVVKFRVDNRGSDGTGCFRIKVRTDTAELTNMRIAGLRKGRNE*
Ga0066188_12968562	3300004626	Marine Gutless Worms Symbiont	RKIVVVRVTVVKFRVDNRGSDGTGCFRIEVRTDRAELSDMRIA*
Ga0066188_12983411	3300004626	Marine Gutless Worms Symbiont	VERVTVVKFRVDNRGSNGTGCFRIKVRTDTAELTNMRIAGYYFVVS*
Ga0066188_13051821	3300004626	Marine Gutless Worms Symbiont	LRFSKIVVERVTVVKFRVDNRGSDGTGCFRIEVRTDTAELTNMR
Ga0056130_10027114	3300005968	Marine Gutless Worms Symbiont	LQYRVTVVKFGVDNRGSDGIGCFRMKVRAVTAEFMDMRIAGLRK*
Ga0056130_10090861	3300005968	Marine Gutless Worms Symbiont	VVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLRK*
Ga0056130_10164401	3300005968	Marine Gutless Worms Symbiont	VNLRFRKIVVERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVA*
Ga0056130_10166354	3300005968	Marine Gutless Worms Symbiont	KIVVERITVVKFRVDNRGSDGTSCFRIEVRTDTAELSDMRVAGLRK*
Ga0056130_10239417	3300005968	Marine Gutless Worms Symbiont	ERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVA*
Ga0056130_10282301	3300005968	Marine Gutless Worms Symbiont	TVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLRKSSMTHCL*
Ga0056130_10390314	3300005968	Marine Gutless Worms Symbiont	RKIVVERVTVVKFRVDNRGSNGTGCFRIKVRTDSAELTNMRIAGLRK*
Ga0056130_10690601	3300005968	Marine Gutless Worms Symbiont	RVTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLSN*
Ga0056130_10713472	3300005968	Marine Gutless Worms Symbiont	KIVVERVTVVKFRVDSRGSSGTGCFGIEVRTDTVELSDMRIAGLRCL*
Ga0056130_10725224	3300005968	Marine Gutless Worms Symbiont	VVKFRVDNRGSNGTGCFRIKVRTDTAELTNMRIAGLRKC*
Ga0056130_10837592	3300005968	Marine Gutless Worms Symbiont	LRRKIVVQRVTVVKCGLDNRGSDGTGSFRIKVRMDANEFTDMRIAALRK*
Ga0056130_10845061	3300005968	Marine Gutless Worms Symbiont	VKFRVDNRGSNGTGCFRIKVRTDTAELTNMRIAELRE*
Ga0056130_10912511	3300005968	Marine Gutless Worms Symbiont	VKRVTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRIAARLRK*
Ga0056130_11382881	3300005968	Marine Gutless Worms Symbiont	RFRKIVVERVTVIKFRVDNRGSDGTGCFRIEVRTDTVELSDMRVAGLRK*
Ga0056130_11413922	3300005968	Marine Gutless Worms Symbiont	RVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLRK*
Ga0056130_11506091	3300005968	Marine Gutless Worms Symbiont	VKFRVDNRGSNSTGCFRIKVRTDTAELTNMRVAGLRK*
Ga0056130_11563612	3300005968	Marine Gutless Worms Symbiont	LRFRKIVVERVTVVKFRVDNRGSDGSGCFRIEVRTDTAELSDMRVAGLRK
Ga0056130_11779381	3300005968	Marine Gutless Worms Symbiont	VVKFRVDNRGSNGTGCFRIKVRTDTAELTNMRIAGLSKRSSMT*
Ga0056130_11859071	3300005968	Marine Gutless Worms Symbiont	EAVNLRFRKIVVERVTVVKFRVDNRGSDGTGRFRIEVRTDSAELSDMRVA*
Ga0056130_11935961	3300005968	Marine Gutless Worms Symbiont	VKRVTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRIAGLSDEI*
Ga0056130_11957142	3300005968	Marine Gutless Worms Symbiont	VERVTVVKFRVDNRGSNSTGCFRIKVRTDTAELTNMRIAELRK*
Ga0056130_12032341	3300005968	Marine Gutless Worms Symbiont	TVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVA*
Ga0056130_12075431	3300005968	Marine Gutless Worms Symbiont	VKFRVDNRGSNGTGCFRIKVRTDTAELTNMRIAGLRK*
Ga0056130_12098991	3300005968	Marine Gutless Worms Symbiont	VVERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVAGRRK*
Ga0056130_12241821	3300005968	Marine Gutless Worms Symbiont	VKFRVDNRGSNGTGCFRIEVRTDTAELANMRIAGLRK*
Ga0056130_12296791	3300005968	Marine Gutless Worms Symbiont	VERVTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMTVAGLRK*
Ga0056130_12448551	3300005968	Marine Gutless Worms Symbiont	KIVVERVTVVKFRVDNRGSNGTGSFRIKVRTDTAELTNMRIAGLRK*
Ga0056130_12454072	3300005968	Marine Gutless Worms Symbiont	VTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVAGLRK*
Ga0056130_12577701	3300005968	Marine Gutless Worms Symbiont	TVVKFRVDNRGSNGTGCFRIKVRTDTAELTNMRIAGLRKC*
Ga0056130_12772651	3300005968	Marine Gutless Worms Symbiont	NQLEAVNLRFRKIVVERVTVVKFRVDNRGSDGTGRFRIQVRTDTVELSDMRVAGLRK*
Ga0056130_12789251	3300005968	Marine Gutless Worms Symbiont	RVTVVKFRVDNRGSNGTGCFRIKVRTDTAELTNMRIAGLSDEI*
Ga0056130_12879451	3300005968	Marine Gutless Worms Symbiont	LRLRKIVVERVTVVKFRVDNRGSDGTGCFKIEVRTDTAELSDM
Ga0056130_12898741	3300005968	Marine Gutless Worms Symbiont	VVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVEDLESDEI*
Ga0056130_12978491	3300005968	Marine Gutless Worms Symbiont	LRFRKIVIERITVVKFRVDNRGSDGTGRFRIEVRTDTAEL*
Ga0056130_13060062	3300005968	Marine Gutless Worms Symbiont	VYLRFRKIVVERVTVVKFRVDNRGSDGTGWFIIEVRTDTAELSDKRIAGLRK*
Ga0056130_13182973	3300005968	Marine Gutless Worms Symbiont	KIVVERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRIAGLRK*
Ga0056129_10250477	3300005978	Marine Gutless Worms Symbiont	RKIVVERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDKRVAGLRK*
Ga0056129_10312943	3300005978	Marine Gutless Worms Symbiont	VRVTVVKFRVDNEGSNGTGCFRINARTDTAELSDMRIESDEI*
Ga0056129_10450521	3300005978	Marine Gutless Worms Symbiont	LRFRQIVVERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMSSRT*
Ga0056129_10643921	3300005978	Marine Gutless Worms Symbiont	VTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLSN*
Ga0056129_10716411	3300005978	Marine Gutless Worms Symbiont	VERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVAGLRK*
Ga0056129_10742111	3300005978	Marine Gutless Worms Symbiont	RVTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDKRVAGLRK*
Ga0056129_11422371	3300005978	Marine Gutless Worms Symbiont	KFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLRK*
Ga0056129_11483121	3300005978	Marine Gutless Worms Symbiont	VLNKLEAVNLRFRKIVVERVTVVKFRVDNRGSNGTGRFRIEVRTDTAELSDMRVA*
Ga0056129_11514893	3300005978	Marine Gutless Worms Symbiont	LNQLEAVNLRFRKIVVERVTVVKFRVDNRGSDGTGRFRIELRTDTAELSDMTVA*
Ga0056129_12093771	3300005978	Marine Gutless Worms Symbiont	RKIVVERVTVVKFRVDNRGSDGTGHFRIEVRTDTAELSDMRVV*
Ga0056129_12144003	3300005978	Marine Gutless Worms Symbiont	RVDNRGSNGTGCFRIEVRTDTAELANMRIAGLRK*
Ga0056129_12228861	3300005978	Marine Gutless Worms Symbiont	VRHHKIVVERVTVFKFGLDNRGSDGTDCFRIEVITDTTEFTDIRIAGL*
Ga0056129_12263681	3300005978	Marine Gutless Worms Symbiont	FRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLRK*
Ga0056129_12334481	3300005978	Marine Gutless Worms Symbiont	ERVTVVKFRMDNRGSDGTGCFRIEVRTDTAELSDMRIAGLRK*
Ga0056129_12422181	3300005978	Marine Gutless Worms Symbiont	VETVTVVKFRVDNRGSNGTGCFRIKVRTDTAELTNMRIAGIIK*
Ga0056129_12475532	3300005978	Marine Gutless Worms Symbiont	VNLRFRKIVVERVTVVKFRVDNRGSDGTGRFRIQVRTDTAELSDMREAGLRKG*
Ga0056129_12533951	3300005978	Marine Gutless Worms Symbiont	LRLRKIVVERVTVVKFRVDNRGSSGTGCFRIKVRTDTAELTNMRIA*
Ga0056129_12701021	3300005978	Marine Gutless Worms Symbiont	LRFRKIVIERITVVKFKVDNRGSDGTGRFRIEVRTDTAEL*
Ga0056129_12799722	3300005978	Marine Gutless Worms Symbiont	VNLRFRKIVVERVTVVKFRVDNRGSDGTGRFRIQVRTDTVELSDMRVAGLRK*
Ga0056129_12947611	3300005978	Marine Gutless Worms Symbiont	VVKFRVDNRGSNSTGCFRIKVRTDTAELTNMRIAGFRK*
Ga0056129_13027231	3300005978	Marine Gutless Worms Symbiont	LRLRKIVVERVTVVKFRVDNRGSDGTGCFKIEVRTDTAE
Ga0056129_13103121	3300005978	Marine Gutless Worms Symbiont	LRFRKIVVERVTVVKFKVDNRGSDGTGCFRIEVRTD
Ga0056129_13209701	3300005978	Marine Gutless Worms Symbiont	RVTVVKFRVDNRGSDGTGCFKIEVRTDTAELSDMRVAGLSDEI*
Ga0056129_13298302	3300005978	Marine Gutless Worms Symbiont	VERVTVVKFRVDNRGSNGTGCFRIKVRTDTAELTNMRIAGFRK*
Ga0056114_10105119	3300006912	Marine Gutless Worms Symbiont	VTVVKFRVDNRGSDGTGRFRIEVRTDTVELSDMRVAGLRK*
Ga0056114_10220211	3300006912	Marine Gutless Worms Symbiont	VERVTVVKFRVDNRGSDGTGCFKIEVRTDTAELSDMRVAGLRK*
Ga0056114_10269395	3300006912	Marine Gutless Worms Symbiont	NLRFRKIVVERVTVVKFGVDNRFSDGTGRFRIEVRTDTAELSDMRVA*
Ga0056114_10287283	3300006912	Marine Gutless Worms Symbiont	VRVTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRIAELRK*
Ga0056114_10381407	3300006912	Marine Gutless Worms Symbiont	VVKFGVDNRGSDGTGRFRIEVRTDTAELSDMRVA*
Ga0056114_10420448	3300006912	Marine Gutless Worms Symbiont	VTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDIRVAGLRK*
Ga0056114_10437615	3300006912	Marine Gutless Worms Symbiont	VTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVTGLRK*
Ga0056114_10562061	3300006912	Marine Gutless Worms Symbiont	TVVKFRVDNRGSNGTGCFRIEVRTDTAELANMRIAGLRK*
Ga0056114_10618401	3300006912	Marine Gutless Worms Symbiont	VVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVA*
Ga0056114_10622164	3300006912	Marine Gutless Worms Symbiont	VVERVTVVKFRVDNRGSNGTGCFRIKVRTDTAELSDMRIAVLI*
Ga0056114_10788691	3300006912	Marine Gutless Worms Symbiont	TVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLRK*
Ga0056114_10911874	3300006912	Marine Gutless Worms Symbiont	ERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVAGLKK*
Ga0056114_10965175	3300006912	Marine Gutless Worms Symbiont	LRFRKIVVERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVA*
Ga0056114_10978885	3300006912	Marine Gutless Worms Symbiont	LRLRKIVVERVTVVKFRVDNRGSDGTNCFRFKVVSETDE*
Ga0056114_10989771	3300006912	Marine Gutless Worms Symbiont	RVTVVKFRVDNRGSDGTGRFRIEVRTNTAELSDMRVA*
Ga0056114_10999424	3300006912	Marine Gutless Worms Symbiont	ERVTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLIESDEI*
Ga0056114_11095351	3300006912	Marine Gutless Worms Symbiont	TVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLRKR*
Ga0056114_11133431	3300006912	Marine Gutless Worms Symbiont	RVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVA*
Ga0056114_11214655	3300006912	Marine Gutless Worms Symbiont	VVERVTVVKFRVDNKGSDGTGCFRIEVRTDTAELSDMRVAGL*
Ga0056114_11395322	3300006912	Marine Gutless Worms Symbiont	LRFRKIVIDRIIVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVAGLRK*
Ga0056114_11453072	3300006912	Marine Gutless Worms Symbiont	LRFRKIVVERVTVVKYRMDNRGSNGTGCFRIEVRTDTAELSDMRIAGLRK*
Ga0056114_11731563	3300006912	Marine Gutless Worms Symbiont	VVKFRVDNRGSNGTGCFRIEVRTDTAELANMRIAGLRK*
Ga0056114_11762011	3300006912	Marine Gutless Worms Symbiont	VKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLRK*
Ga0056114_11917742	3300006912	Marine Gutless Worms Symbiont	VRHYKIVVESVTVFKFGLDNRGSDGTDCFRIDVRTDTTEFTDIRIAGI*
Ga0056114_12028381	3300006912	Marine Gutless Worms Symbiont	KFRVDNRGSDGTGCFRIEVRTDTAELSDMKISGLRK*
Ga0056114_12060312	3300006912	Marine Gutless Worms Symbiont	RKIVVERVTVVKFRVDNRGSDGTGCFRIEVRTDTVELSDMRIAGLRK*
Ga0056114_12099821	3300006912	Marine Gutless Worms Symbiont	RVTVVKFRMDNRGSDGTGRFRIEVRTDTAELSDMRVA*
Ga0056114_12122224	3300006912	Marine Gutless Worms Symbiont	VERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVA*
Ga0056114_12198582	3300006912	Marine Gutless Worms Symbiont	VVERVTVVKFRVDNRGSDGTGCFRIEVRTDTAELWDMRVARLRKW*
Ga0056114_12353982	3300006912	Marine Gutless Worms Symbiont	LRFRKIVVERVTVVKFRVDNRGRDGTGCFRIEVRTDTAELSDMRVAGLRK*
Ga0056114_12487421	3300006912	Marine Gutless Worms Symbiont	TVLNQLEAVNLRFRKIVVERVTVVKFRVDNRGSDGTGRFRTEVRTDTAELSDMRVA*
Ga0056114_12489241	3300006912	Marine Gutless Worms Symbiont	KIVVERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVEL*
Ga0056114_12611921	3300006912	Marine Gutless Worms Symbiont	NQLEAVNLRFRKIVVERVTVVKFRVDNRGSDGTGRFRIEVRSDTAELSDMKVAGLRK*
Ga0056114_12695761	3300006912	Marine Gutless Worms Symbiont	AVETVTVVKFRVDNRGSNGTGCFRIKVRTDTAELTNMRIAGIIK*
Ga0056114_12854121	3300006912	Marine Gutless Worms Symbiont	VVERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVA*
Ga0056114_12916972	3300006912	Marine Gutless Worms Symbiont	VVERVTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLRK*
Ga0056111_10081021	3300008214	Marine Gutless Worms Symbiont	VVERVTVVKFGVDNRGSDGTGRFRIEVRTDTAELSDMRVA*
Ga0209787_10017897	3300027289	Marine Gutless Worms Symbiont	LQYRVTVVKFGVDNRGSDGIGCFRMKVRAVTAEFMDMRIAGLRK
Ga0209787_10483241	3300027289	Marine Gutless Worms Symbiont	RKIVVERITVVKFRVDNRGSDGTSCFRIEVRTDTAELSDMRVAGLRK
Ga0209787_10501152	3300027289	Marine Gutless Worms Symbiont	VTVVKFRVDNRGSNGTGCFRIKVRTDTAELTNMRIAGLRKC
Ga0209787_10708011	3300027289	Marine Gutless Worms Symbiont	EDCVKRVTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRIAARLRK
Ga0209787_11008001	3300027289	Marine Gutless Worms Symbiont	RVTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLRKSSMTHCL
Ga0209787_11262621	3300027289	Marine Gutless Worms Symbiont	VTVVKFRVDNRGSNGTGCFRIKVRTDTAELTNMRIAGLSKRSSMT
Ga0209787_11305461	3300027289	Marine Gutless Worms Symbiont	LRLRKIVVKRVTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRIAGLSDEI
Ga0209787_11340633	3300027289	Marine Gutless Worms Symbiont	LRFRKIVVERVTVVKFGVDNKGRDGTGSFRIKVRTDTAELSDMRIAVLRK
Ga0209787_11546152	3300027289	Marine Gutless Worms Symbiont	LRFRKIVVEGVTVVKFSVDNRGIDGNGCFRIEVRTDTAELSDMRVAGLRK
Ga0209787_11796611	3300027289	Marine Gutless Worms Symbiont	VVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVAGRRK
Ga0209787_11876101	3300027289	Marine Gutless Worms Symbiont	VKFRVDNRGSNGSGCFRIEVRTDTAELANMRVAGLRK
Ga0209787_11883911	3300027289	Marine Gutless Worms Symbiont	VKFRVDNRGSDGTGCFRIEVRTDTAELSDMRVEDLESDEI
Ga0209787_12507061	3300027289	Marine Gutless Worms Symbiont	IVVERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRIAGLRK
Ga0209787_12663191	3300027289	Marine Gutless Worms Symbiont	LRFRKIVIERITVVKFRVDNRGSDGTGRFRIEVRTDTAEL
Ga0209787_12752181	3300027289	Marine Gutless Worms Symbiont	VVKFRVDNRGSDGTGWFIIEVRTDTAELSDKRIAGLRK
Ga0209680_10098066	3300027392	Marine Gutless Worms Symbiont	EAVNLRFRKIVVERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVA
Ga0209680_10098501	3300027392	Marine Gutless Worms Symbiont	VTVVKFRVDNRGGNGTGCFRIKVRTDTAELTNMRIAGLRK
Ga0209680_10125891	3300027392	Marine Gutless Worms Symbiont	LRFRKIVVERVTVVKFRVDSRGSSGTGCFGIEVRTDTVELSDMRIAGLRCL
Ga0209680_10274083	3300027392	Marine Gutless Worms Symbiont	KTVLNLLEAVNLRFRKIVVERVTVVKFRVDNRGSDGTGCFKIEVRTDTAELSDMRVAGLR
Ga0209680_10409312	3300027392	Marine Gutless Worms Symbiont	LRFRKIVVERVTVVKFTVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLRK
Ga0209680_10607982	3300027392	Marine Gutless Worms Symbiont	VVERVTVGKFRVDNRGSDGTGCFRIKVRTDTVELTNMRTAGLRK
Ga0209680_11053522	3300027392	Marine Gutless Worms Symbiont	MVRVDNRGSDGTGCFRIEVRTDTTELSDMRVAGLRK
Ga0209680_11096791	3300027392	Marine Gutless Worms Symbiont	IVVKRVTVVKFRVDNRGSDGTGCFRIEVRTDTAELSDMRIAARLRK
Ga0209680_11127302	3300027392	Marine Gutless Worms Symbiont	LRRKIVVQRVTVVKCGLDNRGSDGTGSFRIKVRMDANEFTDMRIAALRK
Ga0209680_11227791	3300027392	Marine Gutless Worms Symbiont	TVVKFRVDNRGSNSTGCFRIKVRTDTAELTNMRVAGLRK
Ga0209680_11448922	3300027392	Marine Gutless Worms Symbiont	LRFRKIVVERVTVVKFRVDNRGSDGTGRFRIELRTDTAELSDMTVA
Ga0209680_11470001	3300027392	Marine Gutless Worms Symbiont	VRHHKIVVERVTVFKFGLDNRGSDGTDCFRIEVITDTTEFTDIRIAGL
Ga0209680_11646442	3300027392	Marine Gutless Worms Symbiont	VVERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDMRVA
Ga0209680_11772061	3300027392	Marine Gutless Worms Symbiont	LRFRKIVVERVTVVKFRVDNRGSDGTGRFRIEVRTDSAELSDMRVA
Ga0209680_11798411	3300027392	Marine Gutless Worms Symbiont	KIVVERVTVVKFRVDNRGSSGTGCFKIKVKTDTAELTNMRIAGLRT
Ga0209680_11816891	3300027392	Marine Gutless Worms Symbiont	FRKIVVERVTVVKFRVDNRGSDGTGHFRIEVRTDTAELSDMRVV
Ga0209680_11822412	3300027392	Marine Gutless Worms Symbiont	LRFRKIVVERVTVVKFRVDNRGSDGTGRFRIEVRTDTAELSDKRVAGLRK
Ga0209680_11834361	3300027392	Marine Gutless Worms Symbiont	TVVKFRVDNRGSDGTGCFRIEVRTDTAELSDKRVAGLRK
Ga0209680_11855401	3300027392	Marine Gutless Worms Symbiont	VVVERVTVVEFRVDNRGSDGTGCFRIEVRTDTAELSDMRVAGLRK
Ga0209680_11993561	3300027392	Marine Gutless Worms Symbiont	FRVEHRGSNSTGCFRIEVRTDTAELSDMRIAGLRK
Ga0209680_11997271	3300027392	Marine Gutless Worms Symbiont	VTVVKFRVDNRGSDGTGCFRIEVRTDIAELSDMRVGLAGLRK
Ga0209680_12267241	3300027392	Marine Gutless Worms Symbiont	YLRLRKIVVERVTVVKFRVDNRGSSGTGCFRIKVRTDTAELTNMRIA