Basic Information | |
---|---|
Family ID | F044251 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 154 |
Average Sequence Length | 48 residues |
Representative Sequence | MVATQKVSQGLEEAWNNLYAGYIQGVASTLVLQTLLEDEQRAKCGGVVDGP |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 154 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.96 % |
% of genes near scaffold ends (potentially truncated) | 46.10 % |
% of genes from short scaffolds (< 2000 bps) | 99.35 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (98.701 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (65.584 % of family members) |
Environment Ontology (ENVO) | Unclassified (90.260 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (87.662 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.43% β-sheet: 0.00% Coil/Unstructured: 45.57% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 154 Family Scaffolds |
---|---|---|
PF14372 | DUF4413 | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 98.70 % |
All Organisms | root | All Organisms | 1.30 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 65.58% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 17.53% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 6.49% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.95% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
3300020033 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG | Host-Associated | Open in IMG/M |
3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028144 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028464 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028466 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028471 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033534 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070707_1023052391 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVATQKVSQESEGTWNNLYADFIKGDASTLVLQSLLEDEQRAKCGGVVDGC* |
Ga0068859_1022771201 | 3300005617 | Switchgrass Rhizosphere | LEEAWNNLYAGYVQGVASALVLQTLLEDEQRAKCGGVVDGP* |
Ga0068863_1016327352 | 3300005841 | Switchgrass Rhizosphere | MVATQKDSQGLEEAWNNLYAGYIQGMTSILVLITLLEDEQRAKFGSVVDDP* |
Ga0105128_1076022 | 3300009976 | Switchgrass Associated | MVTTQKISQELEETWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGC* |
Ga0105135_1033982 | 3300009980 | Switchgrass Associated | AQGLEEAWNKKYAGYVQGVASTLVLQTLLEDEQMAKCGGVVDGP* |
Ga0105135_1072522 | 3300009980 | Switchgrass Associated | MVATQKVSQELEETWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGC* |
Ga0105133_1213871 | 3300009981 | Switchgrass Associated | EGTWNNLYAGFIKGDASTLVLQSLLEVEQRAKCGGVVDGY* |
Ga0105132_1029372 | 3300009990 | Switchgrass Associated | MVATQKDSQGLEEAWNNLYAGYIQGMASILVLITLLEDEQRAKFGGVVDDP* |
Ga0105132_1339481 | 3300009990 | Switchgrass Associated | MVATQKDSQGLEEVWNNLYAGYIKGVASTLVLQTLLEDEQRAKCGGVVDGPSVPNPTVNSCK* |
Ga0105120_10186581 | 3300009992 | Switchgrass Associated | MVATQKVSQESEETWNNLYAGYIKGDASNLVVQSLLEDEQRAKCGGVVDGH* |
Ga0105120_10367481 | 3300009992 | Switchgrass Associated | SWNNLYASYIQGVTSTLVLTPLLQDEQSTKCGGVVDGP* |
Ga0105126_10116432 | 3300009994 | Switchgrass Associated | MVATQKDSQGLEEAWNNLYAGYIQGIASILALITLLEDEQRAKFGSVVDDP* |
Ga0105139_10035532 | 3300009995 | Switchgrass Associated | MVATQKDSQGLEEAWNNLYAGYIQGMASILVLITLLEDEQRAKFGSVVDDP* |
Ga0134125_120594581 | 3300010371 | Terrestrial Soil | MVATQKYSHGLEEAWNNLYVGYIKGDASTLVLQSLLEDEQRAKCGGVVDGC* |
Ga0134125_122983043 | 3300010371 | Terrestrial Soil | MVATQKVSQESEGTWNNLYADFIKGDASTLVLQSLLEDEQR |
Ga0134126_114877822 | 3300010396 | Terrestrial Soil | MVATQKVSQGSEEAWNNLYAGYVQGVATTLVLQTLLEDEQRAMCGGVVDGP* |
Ga0134126_119022472 | 3300010396 | Terrestrial Soil | MVATQKVSQELEETWNHLYAGYVQGVASALVLQTLLEDEQRAKCGGVVDGP* |
Ga0134127_117514962 | 3300010399 | Terrestrial Soil | SQKLEEAWNNLYAGYVQGVASALVLQTLLEDKQRAKCGGVVDGP* |
Ga0134127_120505202 | 3300010399 | Terrestrial Soil | MVATQKVSQELEETWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGH* |
Ga0134127_136152581 | 3300010399 | Terrestrial Soil | MVATQKVSQELEGTWNNLYAGFIKGDASTLVLQSLLEDEQRAKCGGVVDGC* |
Ga0163163_126845102 | 3300014325 | Switchgrass Rhizosphere | LFHSSITQKSIVATKKVSQEWEETWNNLYAGYIKGDASTLVLQSLLEDEQIAKCGGVVDGP* |
Ga0157379_125614841 | 3300014968 | Switchgrass Rhizosphere | TQKVSQELEETWNNLYAGYIKGDASTLVLQSILEDEQRTKCGGVVDGC* |
Ga0182099_10644431 | 3300015278 | Switchgrass Phyllosphere | VATQKVSQELEGSWNNLYADFIKGDASTLVLQPLLEDEQRAKCGGVVNGC* |
Ga0182100_10507212 | 3300015280 | Switchgrass Phyllosphere | LEEACNNLYAGYIQGVTSTLVLIPLLEDEQRAKCGGLVDGP* |
Ga0182101_10453741 | 3300015284 | Switchgrass Phyllosphere | KLEEDWNNLYAGYVEGVASTLVLQTLLEDEQRAKCGGVVDGP* |
Ga0182101_10548881 | 3300015284 | Switchgrass Phyllosphere | VATQKVSQKLEETWNNLYAGFIKGDASTLVLQSLLEDERRAKCGGVVDGC* |
Ga0182105_10190771 | 3300015290 | Switchgrass Phyllosphere | AWNNLYAGYVQGVATTLILQTLLEDEQRAKCGGVVDGP* |
Ga0182105_10198553 | 3300015290 | Switchgrass Phyllosphere | MVATQKDSQGLEEVWNNLYAGYIKGVASSLVLQTLLEDEQRAKCGGVVDDF* |
Ga0182105_10313102 | 3300015290 | Switchgrass Phyllosphere | MVATQKVSQGLEETWNNLYVGYVQGVATTLVLQTLLEDEQRAKCGGVVDGP* |
Ga0182105_10893831 | 3300015290 | Switchgrass Phyllosphere | MVATQKVSQELEETWNNLYAGYIKEDASTLVLQSLLEDKQKARCGVVVDGC* |
Ga0182104_10115172 | 3300015297 | Switchgrass Phyllosphere | MVATQKVSQESEGTWNNLYADFIKGDASTLVLQSLLEDEQRAKCGSVVDGC* |
Ga0182104_10655972 | 3300015297 | Switchgrass Phyllosphere | MVATQKVSQGLEEAWNNLYACFFKGVASTLVFATLLEDEQRAKCRGVVDGC* |
Ga0182104_10874041 | 3300015297 | Switchgrass Phyllosphere | NLYAGYIQGVASTLVLQTLLEDKRRAKCGGVVDGP* |
Ga0182180_10338521 | 3300015306 | Switchgrass Phyllosphere | FHSSITQESIVATQKVSQELEEAWNDLYAGYIKGDASTLVRQPLLEDEQKAKCGGVVDGP |
Ga0182098_10107013 | 3300015309 | Switchgrass Phyllosphere | MVATQKDSQGLEEAWNNLYVVYIEGMASILVLITLLEDEQRAKFGGVVDDP* |
Ga0182098_11135221 | 3300015309 | Switchgrass Phyllosphere | ATRKFTRLGETWNNLYAGDVQGVASTLVLHPLLEDEQRAKCGGVVDGP* |
Ga0182098_11264242 | 3300015309 | Switchgrass Phyllosphere | LEEAWNNLYAGYIKGVASTLVLQTLLEDEQRAKCGGVV |
Ga0182162_10987602 | 3300015310 | Switchgrass Phyllosphere | MVDTKKFTSMGKAWNNLYVGFIKGVASTLVLTPLLEDEQRAKCGGVVDGP* |
Ga0182182_10150581 | 3300015311 | Switchgrass Phyllosphere | MVGTQKVSQELEETWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGP* |
Ga0182182_11215771 | 3300015311 | Switchgrass Phyllosphere | MVATQKVSQGLEEAWNNLYAGYVQRVPSALVLQTLLEDEQRAKCGCVVDGL* |
Ga0182168_10254382 | 3300015312 | Switchgrass Phyllosphere | MVATQKDSQGLEEAWNNLYAGYIQGMTSILVLITLLEDEKRAKFGSVVDDP* |
Ga0182168_11298421 | 3300015312 | Switchgrass Phyllosphere | FFNYPRSMVATPKYTGQEKAWNNFYAGYIKGVASTVVLQTLLEDEQRAKCGGVVDGP* |
Ga0182164_10480442 | 3300015313 | Switchgrass Phyllosphere | VTTQKISQELEETWNNLYAGYIKGDASTVVLQSLLEDEQRAKCGGVVDGC* |
Ga0182120_10087222 | 3300015315 | Switchgrass Phyllosphere | MVATKKDSQGLEEAWNNLYAGYIQGMTSILVLITLLEDEQRAKFGSVVDDP* |
Ga0182120_10620232 | 3300015315 | Switchgrass Phyllosphere | MVTTQKISQELEETWNNLYAGYIKGDASTVVLQSLLEDEQRAKCGGVVDGC* |
Ga0182121_11157711 | 3300015316 | Switchgrass Phyllosphere | SSQKLEETWNNLYAVYVQGVASALVLQTLLEDEQRTKCGGVVDGP* |
Ga0182121_11190562 | 3300015316 | Switchgrass Phyllosphere | DKHGRHLKSSQVWEKTWNNLYAGFFKGATSTLVVASLLEDE* |
Ga0182136_10067932 | 3300015317 | Switchgrass Phyllosphere | MVATQKVSQELKETWNNLYAGYIKGDASNLVLQSLLEDEQRAKCGGVVDGC* |
Ga0182181_10689311 | 3300015318 | Switchgrass Phyllosphere | MVATQKDSQGLEEVWNNLYAGYIKGVASTLVLQTLLEDEQRAKCGGVVDGP* |
Ga0182130_10621903 | 3300015319 | Switchgrass Phyllosphere | MIATQKISQELEETWNNLCPGYIKGDASNLVLQSLLEDEQRAKCGGVVNGC* |
Ga0182130_10757291 | 3300015319 | Switchgrass Phyllosphere | KAWNNLYGGYIKGVTSTLVLQPLLEDEQSAKCGGVVDGP* |
Ga0182130_11331531 | 3300015319 | Switchgrass Phyllosphere | PRKHGSHSKVSQGLEEAWNNLYAGYVQGVASALVLQTLLEDEQRAKCGGVVDGP* |
Ga0182134_10854522 | 3300015324 | Switchgrass Phyllosphere | ATQKVSQELEETWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGP* |
Ga0182148_10465691 | 3300015325 | Switchgrass Phyllosphere | MVATQKDSQELEETWNNLYAGYIKGDASTVVLQSLLEDEQRAKCGGVVDGP* |
Ga0182166_10496282 | 3300015326 | Switchgrass Phyllosphere | MVATQKDSQGLEEAWNNLYAGYIQGMASILVLITLLEDEQRAKFVSVVDDP* |
Ga0182166_10501051 | 3300015326 | Switchgrass Phyllosphere | LKLEEAWNNLYAGYVQGVATTLVLQTLLEDKQRAKCGGVVDGP* |
Ga0182166_10648382 | 3300015326 | Switchgrass Phyllosphere | MVATQKVSQGLEEAWNNLYAGYIQGVASTLVLQTLLEDEQRAKCGGVVDGP* |
Ga0182114_10731401 | 3300015327 | Switchgrass Phyllosphere | DLYAGYIKGVASTLVLQPLLEDEQRAKCGGVVDGP* |
Ga0182153_10353461 | 3300015328 | Switchgrass Phyllosphere | MVATQKVSQELEGTWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGC* |
Ga0182153_11164632 | 3300015328 | Switchgrass Phyllosphere | MVATQKFTELEEAWNNLYAGYVQGVATTLVLQTLLEDEQRAKCGGIVDGL* |
Ga0182117_10182201 | 3300015332 | Switchgrass Phyllosphere | LEEAWNNLCAGYVQGVATTSVLQTLLKDEQRAKYGGVVDGP |
Ga0182117_10611471 | 3300015332 | Switchgrass Phyllosphere | MVATQKVSQELEETWNNLYAGYIKGDASTLVLQSILEDEQRAKCGGVVDGC* |
Ga0182117_11004161 | 3300015332 | Switchgrass Phyllosphere | MVATQKDSHGLEEVWNNLYAGYIKGVASTLVLQPLLEDEQRAKCGGI |
Ga0182147_10836921 | 3300015333 | Switchgrass Phyllosphere | TQKDSQGLEEAWNNLYAGYIQGIASILALITLLEDEQRAKFGSVVDDP* |
Ga0182147_10950161 | 3300015333 | Switchgrass Phyllosphere | MVATQKDSQGLEEAWNNLYAGYIQGMASILVLITLLE |
Ga0182147_11000722 | 3300015333 | Switchgrass Phyllosphere | MVATQKVSQELEGTWNNLYADFIKGDASTLVLQSLLEDKQKARCGVVVDGC* |
Ga0182132_10388151 | 3300015334 | Switchgrass Phyllosphere | MVATQKDSQGLEEAWNNLYAGYIQGIASILALITLLKDEQRAKFGSVVDDP* |
Ga0182116_10880141 | 3300015335 | Switchgrass Phyllosphere | MVATQKFTELEEAWNNLYAGYVQGVASTLVLQSLLEDEQRAKCGGVVDGC* |
Ga0182116_11335113 | 3300015335 | Switchgrass Phyllosphere | MVATQKVSQELEGSWNNLYADFIKGDASTLVLQSLLEDEQR |
Ga0182116_11518061 | 3300015335 | Switchgrass Phyllosphere | MVATQKDSQGLEEVWNDLYAGYIKGVASTLVLQPLLEDEQRAKCGGVVDGP* |
Ga0182150_11166181 | 3300015336 | Switchgrass Phyllosphere | AWNNLYAGYIKGVASTLVITPLLEDEQRSKCGGVVDGP* |
Ga0182150_11658172 | 3300015336 | Switchgrass Phyllosphere | MVATQKVSQELEETWNNLYAGYIKGDASTLVLQSILEDEQR |
Ga0182151_10468521 | 3300015337 | Switchgrass Phyllosphere | NNLYVGYIQGVASTLVLTPLLDDKQSTKCGGVVDGP* |
Ga0182151_11188491 | 3300015337 | Switchgrass Phyllosphere | ETWNNLYAGYVQGVASALVLQTLLEDEQRAKCGGVVDGP* |
Ga0182151_11449421 | 3300015337 | Switchgrass Phyllosphere | MVATQKVSQGLEETWNNLYVGYVQGVATTLVLQTLLEDEQRTKSGGVVDGP* |
Ga0182149_10113201 | 3300015339 | Switchgrass Phyllosphere | MVATQKDSQGLEEAWNNLYAGYIQGIASILALITLLEDEQRA |
Ga0182149_11546461 | 3300015339 | Switchgrass Phyllosphere | EEAWNNLYAGYVQGVAFALVLQTFLEDEQRAKCEGIVDGP* |
Ga0182133_10807081 | 3300015340 | Switchgrass Phyllosphere | MVATQKVSQELEETWNNLYAGYIKGDASTLVLQSLLEDKQRAKCGGVVDDP* |
Ga0182133_11113632 | 3300015340 | Switchgrass Phyllosphere | MVATQKVSQELEETWNNLYAGYIKGDASNLVLQSLLEDEQRAKCGGVVDGC* |
Ga0182133_11872971 | 3300015340 | Switchgrass Phyllosphere | NNLYAGYVQGVATTLVLQTLLEDEQRAKCGGVVDGP* |
Ga0182115_12546761 | 3300015348 | Switchgrass Phyllosphere | MEQAWNNLYAGDIHGVASTLVLQTLLKDEERDKCGGVVDGP* |
Ga0182185_11423811 | 3300015349 | Switchgrass Phyllosphere | NNLYASSIQGVASALVLQILLEDEQRAKCGGVIDGP* |
Ga0182185_12225391 | 3300015349 | Switchgrass Phyllosphere | ITQESMVATQKVSQELEGTWNNLYAGFIKGDASTLVLQSLLEDEQRAKCGGVVDGC* |
Ga0182185_12311562 | 3300015349 | Switchgrass Phyllosphere | MVVTPKFTGLEEAWNNFYAGYIKGVASALVLQTLLEDEQRSKCGGVVDSP* |
Ga0182185_12772422 | 3300015349 | Switchgrass Phyllosphere | KLEEAWNNLYAGYVQGVATTLVLQTLLEDEQRAKCGGVVDSP* |
Ga0182163_11772681 | 3300015350 | Switchgrass Phyllosphere | MVATQKVSQGSEEAWNNLYAAYVQGVASTLVLQTLLEDEQRAKCGSVVDGP* |
Ga0182163_12956372 | 3300015350 | Switchgrass Phyllosphere | MVATKKVSQELEETWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGH* |
Ga0182169_11513031 | 3300015352 | Switchgrass Phyllosphere | NLYAGYVQGVATTLVLQTLLEDEQRAKCGGVVDGP* |
Ga0182169_12253322 | 3300015352 | Switchgrass Phyllosphere | MVGTQKVSQELEETWNNLYAGYIKGDASTLVLQSLL |
Ga0182169_12504671 | 3300015352 | Switchgrass Phyllosphere | PKFTRLGEVWNNLYAGSNKGVASTLVLQTLLEDEQRAKCRGVVDGC* |
Ga0182169_12885491 | 3300015352 | Switchgrass Phyllosphere | NLYASYIQGVTSTLVLMPLLEDEQSTKCGGVVDGP* |
Ga0182179_10844951 | 3300015353 | Switchgrass Phyllosphere | ATQKDSQGLEEAWNNLYAGYIQGMTSILVLITLLEDEQRAKFGSVVDDP* |
Ga0182167_10964422 | 3300015354 | Switchgrass Phyllosphere | MVATQKDSQGLEEAWNNLYACYVQGMASTLVLTPLLEDEQRANCGGVVDDPYEL* |
Ga0182167_12801071 | 3300015354 | Switchgrass Phyllosphere | MVSTKSSQKLEEAWNNLYAGYVQGVATTLALQTLLEDEQRAKCGGIVDGP* |
Ga0182167_12877771 | 3300015354 | Switchgrass Phyllosphere | KSSHNLEEAWNNLYAGYIKGVASTLVLQTLLEDEQRAMCGGVVDGP* |
Ga0182167_13087431 | 3300015354 | Switchgrass Phyllosphere | TWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGC* |
Ga0182167_13377732 | 3300015354 | Switchgrass Phyllosphere | MVATQKVSQELEETWNNLYAGFIKGDTSTLVLQSLLEDEQRAKCGGVVDGC* |
Ga0182197_10543502 | 3300017408 | Switchgrass Phyllosphere | MVATQKFTELEEAWNNLYAGYVQGVASTLVLPTLLEDEQRAKCGGFVDGP |
Ga0182199_10277693 | 3300017412 | Switchgrass Phyllosphere | MVATQKDSQGLEEAWNNLYVVYIEGMASILVLITLLEDEQRAKFGSVVDDP |
Ga0182199_10558131 | 3300017412 | Switchgrass Phyllosphere | ETWNNLYAGFIKGDASTLVLQSLLEDEQRAKCGGVVDGC |
Ga0182199_11464771 | 3300017412 | Switchgrass Phyllosphere | LEETWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGP |
Ga0182199_11731342 | 3300017412 | Switchgrass Phyllosphere | WNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGC |
Ga0182195_10389541 | 3300017414 | Switchgrass Phyllosphere | EEAWNNLYAGYIQGMASILVLITLLEDEQRAKFGSVVDDP |
Ga0182195_10461651 | 3300017414 | Switchgrass Phyllosphere | KVSQGLEETWNNLYAGYVQGVATTLVLKTLLEDEQRAKCRGVVDGP |
Ga0182195_10957531 | 3300017414 | Switchgrass Phyllosphere | TQESMVATQKVSQELEETWNNLYAGYIKEDASTLVLQSLLEDKQKARCGVVVDGC |
Ga0182195_11074821 | 3300017414 | Switchgrass Phyllosphere | TWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGC |
Ga0182195_11091741 | 3300017414 | Switchgrass Phyllosphere | NNLYASFIKGDASTLVLQSLLKDEQRAKCGGVVDGY |
Ga0182195_11818421 | 3300017414 | Switchgrass Phyllosphere | MVATQKVSQGLEEAWNNLYAGYVQGVATTLVLQTLLEDEQRAKCGGVVDGP |
Ga0182213_11064802 | 3300017421 | Switchgrass Phyllosphere | MVATQKDSQGLEEAWNNLYAGYIQGIASILALITLLEDEQRAKFGSVVDDP |
Ga0182196_11217482 | 3300017432 | Switchgrass Phyllosphere | MVATRKVAQELEGTWNNLYAGFIKGDASTIVLQSLPEDEQRAKCGGVVDG |
Ga0182194_10668932 | 3300017435 | Switchgrass Phyllosphere | MVATQKVSQELEETWNNLYAGYIKEDASTLVLQSLLEDKQKARCGVVVDGC |
Ga0182200_11100863 | 3300017439 | Switchgrass Phyllosphere | MVATQKVSQELEETWNNLYAGYIKGDASYLVLQSLLEDEQRAKC |
Ga0182200_11536861 | 3300017439 | Switchgrass Phyllosphere | AWNNLYAGYIKEVASTFVLTPLLEDEQRAKCGGVVDGP |
Ga0182215_11383861 | 3300017447 | Switchgrass Phyllosphere | MVATQKVSQELKETWNNLYAGYIKGDASNLVLQSLLEDEQRAKCGGVVDGC |
Ga0182210_11285921 | 3300017692 | Switchgrass Phyllosphere | MVATQKVSQELEETWNNLYACYIKGDASTLVLQSLLEDEQRAKCGGVVGGS |
Ga0182216_10554311 | 3300017693 | Switchgrass Phyllosphere | MVVTPKFTGLEEAWNNFYAGYIKGVASALVLQTLLEDEQRAKCGGVVDSP |
Ga0182216_10953651 | 3300017693 | Switchgrass Phyllosphere | MVATQKDSQGLEEAWNNLYAGYIQGMASILVLITLLEDEQRAKFGSVV |
Ga0182178_10131291 | 3300020023 | Switchgrass Phyllosphere | QGLEEAWNNLYADYIQGMTSILVLITLLEDEQRAKFGSVVDDP |
Ga0182146_1058311 | 3300020033 | Switchgrass Phyllosphere | MVATQKVSQELEETWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGC |
Ga0182118_1097752 | 3300020223 | Switchgrass Phyllosphere | PLKSSQKLEEVWNNLYAGHVQGVASTLVLQTLLEDEQRAKCGGVVDGP |
Ga0207697_104959252 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MVATQKVSQELEGTWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGP |
Ga0207712_115686461 | 3300025961 | Switchgrass Rhizosphere | VLFRSSITQESMVATKKVSQELEETWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGC |
Ga0207668_112868411 | 3300025972 | Switchgrass Rhizosphere | MVATQKDSQGLEEAWNNLYAGYIQGMASILVLITLLEDEQRAKFGSVVDDP |
Ga0207641_115519961 | 3300026088 | Switchgrass Rhizosphere | MVATQKDSQGLEEAWNNLYAGYIQGMTSILVLITLLEDEQRAKFGSVVDDP |
Ga0268322_10381512 | 3300028049 | Phyllosphere | MVATQKDSQGLEEAWNNLYAGYIQGMASILVLITLLEDEQRAKFGGVVDDP |
Ga0268322_10574711 | 3300028049 | Phyllosphere | MVGTQKVSQELEETWNNLYAGYINGDASTLVLQSLLEDEQRAKCGGVVDGC |
Ga0268306_10328861 | 3300028054 | Phyllosphere | MVATQKVSQELEGTWNNLYAGFIKGDASTLVLQSLLEDEQRAKCGGVVDGC |
Ga0268330_10099831 | 3300028056 | Phyllosphere | LEEAWNNLYAGYIKGVASTLVLKTLLEDEQRAKCGGVV |
Ga0268332_10227191 | 3300028058 | Phyllosphere | MVATQKVSQELEETWNNLYAGFIKGDPSTLVLQSLLEDEQRAKCGGVVDGC |
Ga0268332_10641902 | 3300028058 | Phyllosphere | MVATQKVAQGLEEAWNNLYVGYVQGVASTLVLQSLLEDEQRAKCGGVVDGP |
Ga0268340_10376962 | 3300028064 | Phyllosphere | LEEAWNNLYAGYIKGVASTLVLQTLLEDEQRAKCGGVVDGPSVPNPTV |
Ga0268355_10118262 | 3300028139 | Phyllosphere | MVATQKVAQGLEEAWNNLYAGYVEGMASTLVLQTLLEDEQRAKCGGVVDGL |
Ga0268345_10210501 | 3300028144 | Phyllosphere | SFHFSITQESMVATQKVSQGLEEAWNNLYAGYVQGVATTLVRQTLLEDEQRAKCGGVVDG |
Ga0268324_10081014 | 3300028251 | Phyllosphere | MVATQKVSQELEETWNNLYAGYINGDASTLVLQSLLEDEQRAKCGGVVDGC |
Ga0268302_1045931 | 3300028464 | Phyllosphere | MVGTQKVSQELEETWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGGVVDGC |
Ga0268321_1039071 | 3300028466 | Phyllosphere | SMVATQKDSQGLEEAWNNLYAGYIQGMASILVLITLLEDEQRAKFGSVVDDP |
Ga0268321_1081911 | 3300028466 | Phyllosphere | MVATQKVSQGLEEAWNNLYAGYVQGVATTLVLKTLLEDEQRAKCGGVVDGP |
Ga0268333_10136641 | 3300028467 | Phyllosphere | MVATQKDSQGLEEAWNNLYAGYIQGMASILVLITLLEDEQRAKFGGLVDGP |
Ga0268317_10135521 | 3300028468 | Phyllosphere | MVATEKVSQELEGTWNNLYADFIKGDASTLVLQSLLEDEQRAKCGGVVKGC |
Ga0268307_10103191 | 3300028470 | Phyllosphere | MVATQKDSQGLEEAWNNLYAGYIQGMASILVLITLLEDEQRAKFGSVVDD |
Ga0268323_10016912 | 3300028471 | Phyllosphere | MVATQKVAQGLEEAWNNLYAGYVQGVASTLVLQTLLEDEQRAKCGSVVEGP |
Ga0268323_10184711 | 3300028471 | Phyllosphere | SQGLEEAWNNLYAGYIQGMTSILVLITLLEDEQRAKFGSVVDDP |
Ga0268315_10150161 | 3300028472 | Phyllosphere | MVATQKDSQGLEEAWNNLYAGYIQGIASILALITLLEDDQRAKFGSVVDDP |
Ga0268315_10224021 | 3300028472 | Phyllosphere | MVSTQKVSQELEGTWNNLNSGYIKGDASTLVLQSLLEDEQIAKCGGVVDGP |
Ga0268329_10136872 | 3300028476 | Phyllosphere | MVATQKASQELEETWNNLYAGFIKRDASTLVLQSLLEDEKRAKCGGV |
Ga0268309_10102751 | 3300028477 | Phyllosphere | MVATQKVSQELEGTWNNLYADFIKGDASTLVLQSLLEDEQRAKCGG |
Ga0268313_10138111 | 3300028523 | Phyllosphere | MVATQKVSQELEETWNNLYAGFIKGDASTLVLQSLLEDEQRAKCGGVVDGC |
Ga0268339_10166711 | 3300028526 | Phyllosphere | MVATQKVSQESEGTWNNLYADFIKGDASTLVLQSLLEDEQRVKCGGVVDGC |
Ga0268311_10020561 | 3300028529 | Phyllosphere | MVATQKVSQELEETWNNLYAGYIKGDASTLVLQSLLEDKQRAKCGGVVDDP |
Ga0268311_10077592 | 3300028529 | Phyllosphere | MVATQKVAQGLEEAWNNLYVGYVQGVASALVLQTLLEDKQRAKCGGVVDGP |
Ga0268311_10301031 | 3300028529 | Phyllosphere | MVATQKVSQELEETWNNLYAGYIKGDASTLVLQSLLEDEQRAKCGVLLT |
Ga0214493_10914561 | 3300032465 | Switchgrass Phyllosphere | PLQKFTGLEEAWNNLYAGFIKGDASTLVLQSLLEDEQRAKCGGVVDGP |
Ga0214499_11126781 | 3300032697 | Switchgrass Phyllosphere | EETWNNLYAGFIKGDPSTLVLQSLLEDEQRAKCGGIVDGP |
Ga0314757_11691282 | 3300033534 | Switchgrass Phyllosphere | MVATQKVSQGLEEAWNNLYAGYVQGVASILLLQTLLEDEQRAKCGGVVDGP |
⦗Top⦘ |