NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044212

Metagenome / Metatranscriptome Family F044212

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044212
Family Type Metagenome / Metatranscriptome
Number of Sequences 155
Average Sequence Length 139 residues
Representative Sequence KGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGHEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Number of Associated Samples 89
Number of Associated Scaffolds 155

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.65 %
% of genes near scaffold ends (potentially truncated) 77.42 %
% of genes from short scaffolds (< 2000 bps) 81.94 %
Associated GOLD sequencing projects 60
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.935 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(72.903 % of family members)
Environment Ontology (ENVO) Unclassified
(78.710 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(73.548 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.71%    β-sheet: 16.18%    Coil/Unstructured: 44.12%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 155 Family Scaffolds
PF03256ANAPC10 5.81
PF02945Endonuclease_7 5.81
PF00535Glycos_transf_2 4.52
PF02021UPF0102 4.52
PF01041DegT_DnrJ_EryC1 4.52
PF13392HNH_3 3.23
PF02475Met_10 0.65
PF03592Terminase_2 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 155 Family Scaffolds
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 4.52
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 4.52
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 4.52
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 4.52
COG0792Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 familyReplication, recombination and repair [L] 4.52
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 4.52
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 4.52
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 0.65
COG2264Ribosomal protein L11 methylase PrmATranslation, ribosomal structure and biogenesis [J] 0.65
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 0.65
COG2520tRNA G37 N-methylase Trm5Translation, ribosomal structure and biogenesis [J] 0.65
COG3728Phage terminase, small subunitMobilome: prophages, transposons [X] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.87 %
UnclassifiedrootN/A16.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000117|DelMOWin2010_c10115559All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium949Open in IMG/M
3300001419|JGI11705J14877_10179212All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium556Open in IMG/M
3300005346|Ga0074242_11088336All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1183Open in IMG/M
3300005512|Ga0074648_1014535Not Available4832Open in IMG/M
3300005613|Ga0074649_1049684All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1834Open in IMG/M
3300006025|Ga0075474_10234884All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium554Open in IMG/M
3300006025|Ga0075474_10249994All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium533Open in IMG/M
3300006026|Ga0075478_10066638All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1167Open in IMG/M
3300006026|Ga0075478_10085221All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1015Open in IMG/M
3300006026|Ga0075478_10207580All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium597Open in IMG/M
3300006027|Ga0075462_10203032All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium595Open in IMG/M
3300006027|Ga0075462_10228139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium555Open in IMG/M
3300006357|Ga0075502_1567072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium673Open in IMG/M
3300006637|Ga0075461_10208916All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium582Open in IMG/M
3300006802|Ga0070749_10524364All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium644Open in IMG/M
3300006802|Ga0070749_10683220All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium549Open in IMG/M
3300006803|Ga0075467_10553525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium589Open in IMG/M
3300006810|Ga0070754_10046445Not Available2321Open in IMG/M
3300006867|Ga0075476_10201189All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium725Open in IMG/M
3300006867|Ga0075476_10271506All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium600Open in IMG/M
3300006867|Ga0075476_10285033All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium582Open in IMG/M
3300006868|Ga0075481_10347544All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium512Open in IMG/M
3300006869|Ga0075477_10147186All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium985Open in IMG/M
3300006870|Ga0075479_10043048All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1937Open in IMG/M
3300006870|Ga0075479_10345418All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium579Open in IMG/M
3300006874|Ga0075475_10301037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium661Open in IMG/M
3300006874|Ga0075475_10375053All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium575Open in IMG/M
3300006874|Ga0075475_10420000All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium535Open in IMG/M
3300006874|Ga0075475_10458555All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium506Open in IMG/M
3300006916|Ga0070750_10224074All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium824Open in IMG/M
3300006916|Ga0070750_10445294All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium536Open in IMG/M
3300006916|Ga0070750_10493488All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium502Open in IMG/M
3300006919|Ga0070746_10273156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium783Open in IMG/M
3300006919|Ga0070746_10279505All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium772Open in IMG/M
3300007234|Ga0075460_10245889All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium597Open in IMG/M
3300007234|Ga0075460_10276847All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium554Open in IMG/M
3300007236|Ga0075463_10013952All Organisms → cellular organisms → Bacteria2656Open in IMG/M
3300007236|Ga0075463_10262573All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium554Open in IMG/M
3300007276|Ga0070747_1257770All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium605Open in IMG/M
3300007344|Ga0070745_1131212All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium960Open in IMG/M
3300007363|Ga0075458_10239818All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium553Open in IMG/M
3300007538|Ga0099851_1188742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium754Open in IMG/M
3300007538|Ga0099851_1353503All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium513Open in IMG/M
3300007539|Ga0099849_1178487All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium809Open in IMG/M
3300007540|Ga0099847_1136847All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium733Open in IMG/M
3300007540|Ga0099847_1191407All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium598Open in IMG/M
3300007541|Ga0099848_1160924All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium825Open in IMG/M
3300007541|Ga0099848_1162717All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium820Open in IMG/M
3300007542|Ga0099846_1202503All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium700Open in IMG/M
3300007778|Ga0102954_1260524All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium522Open in IMG/M
3300007960|Ga0099850_1199039All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium789Open in IMG/M
3300007960|Ga0099850_1383452All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium522Open in IMG/M
3300008012|Ga0075480_10256498All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium902Open in IMG/M
3300008012|Ga0075480_10453248All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium624Open in IMG/M
3300009000|Ga0102960_1033819All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1898Open in IMG/M
3300009000|Ga0102960_1154542All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium826Open in IMG/M
3300009001|Ga0102963_1347988All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium582Open in IMG/M
3300009027|Ga0102957_1128896All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium891Open in IMG/M
3300009027|Ga0102957_1221951All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium680Open in IMG/M
3300009529|Ga0114919_10348400All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1034Open in IMG/M
3300010299|Ga0129342_1054446Not Available1562Open in IMG/M
3300010299|Ga0129342_1346743All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium506Open in IMG/M
3300010300|Ga0129351_1240662All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium694Open in IMG/M
3300010316|Ga0136655_1027986All Organisms → cellular organisms → Archaea1838Open in IMG/M
3300010318|Ga0136656_1025648All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2142Open in IMG/M
3300010368|Ga0129324_10404229All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium527Open in IMG/M
3300017697|Ga0180120_10383121All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium553Open in IMG/M
3300017963|Ga0180437_10235325All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1421Open in IMG/M
3300017971|Ga0180438_10311655All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1210Open in IMG/M
3300017971|Ga0180438_10780249All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium698Open in IMG/M
3300017971|Ga0180438_11372902All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium505Open in IMG/M
3300017987|Ga0180431_10320345All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1125Open in IMG/M
3300017987|Ga0180431_10478518All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium871Open in IMG/M
3300017989|Ga0180432_10377438All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1059Open in IMG/M
3300017989|Ga0180432_10428741All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium976Open in IMG/M
3300017989|Ga0180432_11076784All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium544Open in IMG/M
3300017991|Ga0180434_10293941All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1276Open in IMG/M
3300017991|Ga0180434_10410801All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1048Open in IMG/M
3300018080|Ga0180433_10989043All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium614Open in IMG/M
3300018416|Ga0181553_10155238All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1358Open in IMG/M
3300019756|Ga0194023_1127720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium519Open in IMG/M
3300021356|Ga0213858_10114411All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1318Open in IMG/M
3300021959|Ga0222716_10465738All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium719Open in IMG/M
3300021960|Ga0222715_10264765All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium993Open in IMG/M
3300022053|Ga0212030_1022223All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium859Open in IMG/M
3300022063|Ga0212029_1014350All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1014Open in IMG/M
3300022068|Ga0212021_1015741All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1360Open in IMG/M
3300022068|Ga0212021_1078471All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium677Open in IMG/M
3300022069|Ga0212026_1075877All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium511Open in IMG/M
3300022158|Ga0196897_1048165All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium505Open in IMG/M
3300022167|Ga0212020_1040054All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium793Open in IMG/M
3300022183|Ga0196891_1047680All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium782Open in IMG/M
3300022187|Ga0196899_1096574All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium881Open in IMG/M
3300022200|Ga0196901_1247819All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium553Open in IMG/M
3300025610|Ga0208149_1050675All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1075Open in IMG/M
3300025610|Ga0208149_1132543All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium579Open in IMG/M
3300025647|Ga0208160_1102646All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium740Open in IMG/M
3300025653|Ga0208428_1027927All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1818Open in IMG/M
3300025653|Ga0208428_1040091All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1458Open in IMG/M
3300025655|Ga0208795_1122153All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium676Open in IMG/M
3300025671|Ga0208898_1011916Not Available4265Open in IMG/M
3300025671|Ga0208898_1046326All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1618Open in IMG/M
3300025671|Ga0208898_1051917All Organisms → Viruses → Predicted Viral1482Open in IMG/M
3300025671|Ga0208898_1090816All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium954Open in IMG/M
3300025671|Ga0208898_1096404All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium910Open in IMG/M
3300025671|Ga0208898_1165128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium579Open in IMG/M
3300025671|Ga0208898_1187421All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium515Open in IMG/M
3300025674|Ga0208162_1099943All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium865Open in IMG/M
3300025751|Ga0208150_1015965All Organisms → cellular organisms → Bacteria2673Open in IMG/M
3300025759|Ga0208899_1213361All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium603Open in IMG/M
3300025769|Ga0208767_1139075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium903Open in IMG/M
3300025803|Ga0208425_1008742Not Available2845Open in IMG/M
3300025810|Ga0208543_1116174All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium634Open in IMG/M
3300025815|Ga0208785_1018277All Organisms → Viruses → Predicted Viral2345Open in IMG/M
3300025815|Ga0208785_1062312All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1006Open in IMG/M
3300025828|Ga0208547_1044292All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1582Open in IMG/M
3300025828|Ga0208547_1092547All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium945Open in IMG/M
3300025828|Ga0208547_1123319All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium768Open in IMG/M
3300025840|Ga0208917_1233783All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium597Open in IMG/M
3300025853|Ga0208645_1134219All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium966Open in IMG/M
3300025889|Ga0208644_1060045Not Available2051Open in IMG/M
3300025889|Ga0208644_1190423All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium901Open in IMG/M
3300025889|Ga0208644_1199143All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium871Open in IMG/M
3300026183|Ga0209932_1138038All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium514Open in IMG/M
3300026187|Ga0209929_1131343All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium625Open in IMG/M
3300026187|Ga0209929_1142100All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium592Open in IMG/M
3300027917|Ga0209536_101164285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium946Open in IMG/M
3300034374|Ga0348335_032965Not Available2243Open in IMG/M
3300034374|Ga0348335_041087All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1891Open in IMG/M
3300034374|Ga0348335_052663All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1556Open in IMG/M
3300034374|Ga0348335_074184All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1175Open in IMG/M
3300034374|Ga0348335_192521All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium504Open in IMG/M
3300034375|Ga0348336_110371All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium906Open in IMG/M
3300034375|Ga0348336_143771All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium721Open in IMG/M
3300034375|Ga0348336_153379All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium681Open in IMG/M
3300034418|Ga0348337_132624All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium739Open in IMG/M
3300034418|Ga0348337_138399All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium711Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous72.90%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment7.74%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient5.16%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water5.16%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment1.94%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.29%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.29%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.65%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.65%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.65%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.65%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.65%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.65%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001419Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m)EnvironmentalOpen in IMG/M
3300005346Saline sediment microbial community from Etoliko Lagoon, GreeceEnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300005613Saline sediment microbial communities from Etoliko Lagoon, Greece - sedimentEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007778Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300017971Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaGEnvironmentalOpen in IMG/M
3300017987Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaGEnvironmentalOpen in IMG/M
3300017989Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaGEnvironmentalOpen in IMG/M
3300017991Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaGEnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022158Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3)EnvironmentalOpen in IMG/M
3300022167Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026183Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOWin2010_1011555923300000117MarineLVLTVTNIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW*
JGI11705J14877_1017921213300001419Saline Water And SedimentIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYGYHRKVGKYLAKKHRNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIXFDSLRINKW*
Ga0074242_1108833613300005346Saline Water And SedimentPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW*
Ga0074648_1014535133300005512Saline Water And SedimentVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDTLRINRW*
Ga0074649_104968423300005613Saline Water And SedimentMVKIWTHIAWDHTGQKDLGKAYNACLSQHDDEDWVAFLDHDGMFTTDDWYLQLQHIIEHNSKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINRW*
Ga0075474_1023488413300006025AqueousLDHDGMFTTDDWYLQLQHIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYGYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW*
Ga0075474_1024999423300006025AqueousNFDYAYHRKVGKLLSTKYKNQSTLIKNAGHMSGVFFALHAGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK*
Ga0075478_1006663833300006026AqueousKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKLLSTKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK*
Ga0075478_1008522113300006026AqueousLQLQSIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW*
Ga0075478_1020758033300006026AqueousTNFDYAYHRKVGKHLANKHKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYIFHWYRHDSPYNHSKVVMSQLSEIHFNSLRLNK*
Ga0075462_1020303233300006027AqueousNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW*
Ga0075462_1022813913300006027AqueousVNRMATPEQMVLGIDPTNFDYAYHRKVGKHLAAKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYPHSKASMEQLEQLHLDSLRINKW*
Ga0075462_1025234213300006027AqueousYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK*
Ga0075502_156707223300006357AqueousVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK*
Ga0075461_1020891633300006637AqueousNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK*
Ga0070749_1052436423300006802AqueousLSQHADEDWVAFLDHDGMFTTDDWYLQLQHIIEHNPKCRGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAAKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDTLRINKW*
Ga0070749_1068322013300006802AqueousDWVAFIDHDGMFTTDDWYLQLQHIIANNPKCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK*
Ga0075467_1055352523300006803AqueousQLQEIIKLNPNCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKNLATKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK*
Ga0070754_1004644513300006810AqueousHRKVGKHLANKHKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYIFHWYRHDSPYNHSKVVMSQLSEIHFNSLRLNK*
Ga0075476_1020118933300006867AqueousCSRVNRMATPEQMVLGIDPDNFDYAYHRKVGKHLATKYKNQSTLIKNVGHMSGVFFALHVGTIKALGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKPAMAQLSEIHFNSLRLNK*
Ga0075476_1027150613300006867AqueousFDYAYHRKVGKHLAAKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYPHSKASMEQLEQLHLDSLRINKW*
Ga0075476_1028503313300006867AqueousGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW*
Ga0075481_1018834333300006868AqueousYHRKVGKLLSTKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK*
Ga0075481_1034754413300006868AqueousNCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKLLSTKYKNQSTLIKNAGHMSGVFFALHVGTIKALGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYVFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK*
Ga0075477_1014718643300006869AqueousIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW*
Ga0075479_1004304813300006870AqueousDGMFTTDDWYLQLQSIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDTPYEHSKPAIEQLEQIHFDSLRINKW*
Ga0075479_1034541823300006870AqueousDGMFTTDDWYLQLQSIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW*
Ga0075475_1030103713300006874AqueousCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAAKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW*
Ga0075475_1037505323300006874AqueousLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW
Ga0075475_1042000013300006874AqueousNPKCKGITARINRMATPEQMVLGIDPTNFDYAYHRKVGKHLASKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYQHSKASMEQLEQIHFDTLRINRW*
Ga0075475_1045855523300006874AqueousKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKLLSTRYKNQSTLIKNAGHMSGVFFALHVGTIKALGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYVFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK*
Ga0070750_1022407413300006916AqueousHDGMFTTDDWYLQLQSIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDTPYEHSKPAIEQLEQIHFDSLRINKW*
Ga0070750_1035951733300006916AqueousGKYLSEKHKNESTLINTPGHMSGVFFALHVGTIKKLGGCVETGMQLQTDHMTMDRVRNAGYEFRIADGIYVFHWYRHDKPYDHSKIAMQQLENIHFNNIRLNK*
Ga0070750_1044529423300006916AqueousKCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKYLAAKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYQHSKPAMEQLEQIHFDTLRINTW*
Ga0070750_1049348813300006916AqueousWYLQLQHIIANNPKCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK*
Ga0070746_1027315613300006919AqueousSQHADEDWVAFLDHDGMFTTDDWYLQLQHIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAAKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW*
Ga0070746_1027950533300006919AqueousQLQEIIKLNPNCKGICSRVNRMATPEQMVLGIDPDNFDYAYHRKVGKHLATKYKNQSTLIKNVGHMSGVFFALHVGTIKALGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKPAMAQLSEIHFNSLRLNK*
Ga0075460_1024588923300007234AqueousMFTTDDWYLQLQEIIKLNPNCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKILSTKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK*
Ga0075460_1027684713300007234AqueousADDDWVAFIDHDGMFTTDDWYLQLQHIIANNPKCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKLLSTRYKNQSTLIKNAGHMSGVFFALHAGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK*
Ga0075463_1001395213300007236AqueousQSIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYGYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW*
Ga0075463_1026257313300007236AqueousMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK*
Ga0075463_1027316623300007236AqueousGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK*
Ga0070747_125777013300007276AqueousMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIH
Ga0070747_132856723300007276AqueousTLIKNAGHMSGVFFALHVGTIKALGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYVFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK*
Ga0070745_113121213300007344AqueousWVAFLDHDGMFTTDDWYLQLQHIIEHNPKCKGITARINRMTTPDQMVLGIDPNNFDYAYHRKVGKYLAAKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW*
Ga0075458_1023981823300007363AqueousATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHFGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIAVGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK*
Ga0099851_118874243300007538AqueousPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW*
Ga0099851_135350313300007538AqueousNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAMEQLEQIHFDTLRINRW*
Ga0099849_117848713300007539AqueousINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW*
Ga0099847_113684733300007540AqueousARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYEHSKPAIEQLEQIHFDTLRINKW*
Ga0099847_119140713300007540AqueousIKHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYQHSKPAMEQLEQIHFDTLRINTW*
Ga0099848_1009089123300007541AqueousLTQPGHMSGVFFALHVGTIKTLGGCVETGGQLQVDHRTMDRVRNAGYEFRIADGIYIFHWYRYDAPYDHSKHVMSQLETVHFNNIQLNK*
Ga0099848_116092423300007541AqueousIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGNEFRIADGIYIFHWYRYDAPYPHSKASMEQLEQLHLDSLRINRW*
Ga0099848_116271723300007541AqueousMATPEQMVLGIDPDNFDYAYHRKVGKHLANKHKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYIFHWYRHDSPYNHSKVVMSQLSEIHFNSLRLNK*
Ga0099846_120250323300007542AqueousMPRIWTHIAWDNTGQKDLGKAYNACLSQHADDDWVAFIDHDGMFTTDDWYLQLQHIIANNPKCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKLLSTKYKNQSTLIKNAGHMSGVFFALHVGTIKALGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNT
Ga0102954_126052413300007778WaterLQHIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW*
Ga0099850_106590213300007960AqueousNRGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYIFHWYRHDSPYNHSKVVMSQLSEIHFNSLRLNK*
Ga0099850_119903913300007960AqueousTKYKNQSTLISNAGHMSGVFFALHVGTIKTLGGCVETGKQLQTDHMTMDRVRNAGHEFGIADGIYVFHWYRHDSPYNHSKLAMAQLSEIHFNSLRLNK*
Ga0099850_138345213300007960AqueousWVAFLDHDGMFTTDDWYLQLQHIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW*
Ga0075480_1025649813300008012AqueousLQEIIKLNSNCKGICSRVNRMATPEQMVLGIDPDNFDYAYHRKVGKHLATKYKNQSTLIKNVGHMSGVFFALHVGTIKALGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKPAMAQLSEIHFNSLRLNK*
Ga0075480_1045324823300008012AqueousEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAAKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW*
Ga0102960_103381913300009000Pond WaterWYLQLQSIIEHNPKCKGICGRVNRMATPEQMVLGIDPTNFDYAYHRKVGKYLAAKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYQHSKASMEQLEQIHFDTLRINRW*
Ga0102960_115454213300009000Pond WaterKNNPNCKGICSRVNRMNTLEQMVVGIDPYNFDYSYHRNLGKFLANKYKNESKIIKNKNHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW*
Ga0102963_134798823300009001Pond WaterDGMFTTDDWYLQLQHIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW*
Ga0102957_112889613300009027Pond WaterKGICGRVNRMATPEQMVLGIDPTNFDYAYHRKVGKHLAAKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYQHSKPAMEQLEQIHFDTLRINRW*
Ga0102957_122195113300009027Pond WaterMVKIWTHIAWDHTGQKDLGKAYNACISQHADEDWVAFLDHDGMFTTPDWYLQLQSIIEHNPKCKGICGRVNRMATPEQMVLGIDPTNFDYAYHRKVGKYLAAKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGHEFRIADGIYISHWYRYDAPYPHSKASMEQLEQLHLDSLRINKW*
Ga0114919_1034840013300009529Deep SubsurfaceKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHRNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW*
Ga0129345_122978113300010297Freshwater To Marine Saline GradientNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK*
Ga0129342_105444613300010299Freshwater To Marine Saline GradientITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW*
Ga0129342_134674313300010299Freshwater To Marine Saline GradientHADEDWVAFLDHDGMFTTDDWYLQLQHIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDTPYQHSKPAMEQLEQIHFDTLR
Ga0129351_124066213300010300Freshwater To Marine Saline GradientHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYEHSKPAIEQLEQIHFDTLRINKW*
Ga0136655_102798613300010316Freshwater To Marine Saline GradientKCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK*
Ga0136656_102564833300010318Freshwater To Marine Saline GradientMPKIWTHIAWDNTGQKDLGKAYNACLSQHNDEDWVAFLDHDGMFTTDDWYLQLQHIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMYGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW*
Ga0129324_1040422913300010368Freshwater To Marine Saline GradientAMFTTPDWYLQLQSIIEHNPKCKGICGRVNRMATPEQMVLGIDPTNFDYAYHRKVGKHLAAKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYQHSKASMEQLEQIHLDTLQINKW*
Ga0180120_1038312133300017697Freshwater To Marine Saline GradientYHRKVGKHLAAKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYPHSKASMEQLEQLHLDSLRINKW
Ga0180437_1023532553300017963Hypersaline Lake SedimentDWYLQLQEIIKLNPNCKGICSRVNRMATPEQMVLGIDPNNFDYSYHRKVGKHLATKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0180438_1031165513300017971Hypersaline Lake SedimentMVKIWTHIAWDNTGQKDLGKAYNACLSQHADEDWVAFLDHDGMFTTDDWYLQLQHIIANNPKCKGICSRVNRMATREQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW
Ga0180438_1078024923300017971Hypersaline Lake SedimentQEIIKLNPNCKGICSRVNRMATPEQMVLGIDPDNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMAQLSEIHFNSLRLNK
Ga0180438_1137290213300017971Hypersaline Lake SedimentTDDWYLQLQEIIKLNPNCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKLLSTKYKNQSTLISNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0180431_1032034533300017987Hypersaline Lake SedimentMPKIWTHIAWDNTGQKDLGKAYNACINQHADDDWVAFIDHDGMFTTDDWYLQLQHIIANNPKCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKLLSTKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0180431_1047851813300017987Hypersaline Lake SedimentKVGKYLAAKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYQHSKASMEQLEQIHFDTLRINRW
Ga0180432_1037743813300017989Hypersaline Lake SedimentKLNPNCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKLLSTKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0180432_1042874113300017989Hypersaline Lake SedimentNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0180432_1107678413300017989Hypersaline Lake SedimentNPKCKGICGRVNRMATPEQMVLGIDPTNFDYAYHRKVGKHLATKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDTPYQHSKALMEQLEQIHFDTLRINRW
Ga0180434_1029394113300017991Hypersaline Lake SedimentKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGHEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0180434_1041080133300017991Hypersaline Lake SedimentWVAFLDHDGMFTTDDWYLQLQHIIKHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDTLRINKW
Ga0180433_1098904333300018080Hypersaline Lake SedimentPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW
Ga0181553_1015523853300018416Salt MarshYGYHRKVGKYLATKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHKTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINRW
Ga0194029_110136433300019751FreshwaterQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0194023_112772023300019756FreshwaterTARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDTPYEHSKPAIEQLEQIHFDSLRINKW
Ga0213858_1011441113300021356SeawaterDYAYHRKVGKLLSTRYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0222716_1046573833300021959Estuarine WaterIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYQHSKPAIEQLEQIHFDSLRINKW
Ga0222715_1026476513300021960Estuarine WaterICGRVNRMATPEQMVLGIDPTNFDYAYHRKVGKHLAAKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYQHSKPAMEQLEQIHFDTLRINRW
Ga0212030_100173513300022053AqueousKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW
Ga0212030_102222333300022053AqueousGMFTTDDWYLQLQHIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW
Ga0212025_107771313300022057AqueousALITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYIFHWYRHDSPYNHSKVVMSQLSEIHFNSLRLNK
Ga0212029_101435013300022063AqueousEYNACLSQHNDEDWVAFLDHDGMFTTDDWYLQLQHIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW
Ga0212021_101574153300022068AqueousNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0212021_107847113300022068AqueousNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0212026_107587713300022069AqueousDDWYLQLQEIIKLNPNCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKLLSTRYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0196897_104816513300022158AqueousAYNACLSQHADDDWVAFLDHDGMFTTDDWYLQLQEIIKLNPNCKGICSRVNRMATPEQMVLGIDPDNFDYAYHRKVGKHLATKYKNQSTLIKNVGHMSGVFFALHVGTIKALGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKPAMAQLS
Ga0212020_104005413300022167AqueousMATPEQMVLGIDPNNFDYAYHRKVGKILSTKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0196891_104768043300022183AqueousAYHRKVGKLLSTRYKNQSTLIKNAGHMSGVFFALHVGTIKALGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYVFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0196899_109657433300022187AqueousFDYAYHRKVGKLLSTRYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0196899_120670713300022187AqueousKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW
Ga0196901_124781913300022200AqueousGKAYNACLSQHADEDWVAFLDHDGMFTTDDWYLQLQHIIKHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYQHSKPAMEQLEQIHFDTLRINTW
Ga0208149_105067513300025610AqueousLQSIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW
Ga0208149_113254323300025610AqueousPNNFDYAYHRKVGKLLSTKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0208004_103844313300025630AqueousIKNVGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0208160_110264613300025647AqueousTTDDWYLQLQEIIKLNPKCKGITARINRMATPEQMVLGIDPDNFDYAYHRKVGKHLANKHKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0208428_102792713300025653AqueousAWDNTGQKDLGKAYNACLSQHADDDWVAFIDHDGMFTTDDWYLQLQEIIKLNPNCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0208428_104009113300025653AqueousPEQMVLGIDPNNFDYAYHRKVGKILSTKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0208795_112215323300025655AqueousLQLQEIIKNNPNCKGICSRVNRMATPEQMVLGVDPNNFDYAYHRKVGKYLGTKHKNESTILTQPGHMSGVFFALHVGTIKTLGGCVETGGQLQVDHRTMDRVRNAGYEFRIADGIYIFHWYRYDAPYDHSKHVMSQLETVHFNNIQLNK
Ga0208898_1011916103300025671AqueousDWYLQLQEIIKLNPKCKGITARINRMATPEQMVLGIDPDNFDYAYHRKVGKHLANKHKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYIFHWYRHDSPYNHSKVVMSQLSEIHFNSLRLNK
Ga0208898_104632633300025671AqueousMPRIWTHIAWDNTGQKDLGKAYNACLSQHSDEDWVAFIDHDGMFTTDDWYLQLQHIIANNPKCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0208898_105191713300025671AqueousNCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKLLSTKYKNQSTLIKNAGHMSGVFFALHVGTIKALGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYVFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0208898_109081613300025671AqueousTPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW
Ga0208898_109640433300025671AqueousDHDGMFTTDDWYLQLQSIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDTPYEHSKPAIEQLEQIHFDSLRINKW
Ga0208898_116512833300025671AqueousYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0208898_118742113300025671AqueousDHDGMFTTDDWYLQLQSIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW
Ga0208162_109994343300025674AqueousRVNRMATPEQMVLGIDPNNFDYAYHRKVGKLLSTKYKNQSTLISNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0208150_101596523300025751AqueousMPRIWTHIAWDNTGQKDLGKAYNACLSQHADDDWVAFIDHDGMFTTDDWYLQLQEIIKLNPNCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0208899_121336113300025759AqueousDLGKAYNACLSQHADDDWVAFIDHDGMFTTDDWYLQLQHIIANNPKCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0208767_113907513300025769AqueousGMFTTDDWYLQLQEIIKLNPNCKGICSRVNRMATPEQMVLGIDPDNFDYAYHRKVGKHLATKYKNQSTLIKNVGHMSGVFFALHVGTIKALGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKPAMAQLSEIHFNSLRLNK
Ga0208767_126116713300025769AqueousVGKLLSTKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0208425_100874273300025803AqueousKAYNACLSQHADDDWVAFIDHDGMFTTDDWYLQLQHIIANNPKCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0208543_111617433300025810AqueousCSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0208785_101827713300025815AqueousQEIIKLNPNCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKLLSTKYKNQSTLIKNAGHMSGVFFALHVGTIKALGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYVFHWYRHDSPYNHSKLAMAQLEEIHFNTLRLNK
Ga0208785_106231223300025815AqueousMPRIWTHIAWDNTGQKDLGKAYNACLSQHADEDWVAFIDHDGMFTTDDWYLQLQHIIANNPKCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGI
Ga0208547_104429223300025828AqueousMPRIWTHIAWDNTGQKDLGKAYNACLSQHADEDWVAFIDHDGMFTTDDWYLQLQHIIANNPKCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRH
Ga0208547_108193713300025828AqueousITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0208547_109254743300025828AqueousQHADDDWVAFLDHDGMFTTDDWYLQLQHIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW
Ga0208547_112331913300025828AqueousDNFDYAYHRKVGKHLATKYKNQSTLIKNVGHMSGVFFALHVGTIKALGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKPAMAQLSEIHFNSLRLNK
Ga0208547_120049213300025828AqueousITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0208917_123378323300025840AqueousYLQLQSIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW
Ga0208645_113421943300025853AqueousIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAAKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW
Ga0208644_106004513300025889AqueousRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0208644_119042313300025889AqueousSQHADDDWVAFLDHDGMFTTDDWYLQLQHIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDTLRINKW
Ga0208644_119914323300025889AqueousMPRIWTHIAWDNTGQKDLGKAYNACLSQHADEDWVAFLDHDGMFTTDDWYLQLQHIIEHNPKCRGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAAKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDTLRINKW
Ga0209932_113803823300026183Pond WaterPEQMVLGIDPTNFDYAYHRKVGKYLAAKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYQHSKASMEQLEQIHFDTLRINRW
Ga0209929_113134323300026187Pond WaterQLQSIIEHNPKCKGICGRVNRMATPEQMVLGIDPTNFDYAYHRKVGKYLAAKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYQHSKASMEQLEQIHFDTLRINRW
Ga0209929_114210013300026187Pond WaterNDEDWVAFLDHDGMFTTDDWYLQLQHIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW
Ga0209536_10116428513300027917Marine SedimentKGICGRVNRMATPEQMVLGVDPTNFDYAYHRKVGKHLAAKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYIFHWDRHDSPYNHSKVVMSQLSEIHFNSLRLNK
Ga0348335_032965_1843_22263300034374AqueousMATPEQMVLGIDPNNFDYVYHRKVGKHLATKYRNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGRQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0348335_041087_1503_18893300034374AqueousMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDTPYEHSKPAIEQLEQIHFDSLRINKW
Ga0348335_052663_180_7793300034374AqueousMPRIWTHIAWDNTGQKDLGKAYNACLSQHADEDWVAFIDHDGMFTTDDWYLQLQHIIANNPKCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLIKNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0348335_074184_782_11683300034374AqueousMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYEHSKPAIEQLEQIHFDTLRINKW
Ga0348335_192521_18_4943300034374AqueousMFTTPDWYLQLQSIIEHNPKCKGICGRVNRMATPEQMVLGIDPTNFDYAYHRKVGKHLAAKHKNQSTLIKNRGHMSGVFFALHVGTIKSLGGCVETGEQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRYDAPYPHSKASMEQLEQLHLDSLRINKW
Ga0348336_033361_2069_23773300034375AqueousKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYIFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0348336_110371_38_4213300034375AqueousMATPEQMVLGIDPDNFDYAYHRKVGKHLATKYKNQSTLIKNVGHMSGVFFALHVGTIKALGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKPAMAQLSEIHFNSLRLNK
Ga0348336_129496_479_7873300034375AqueousKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGHEFRIADGIYVFHWYRHDSPYNHSKLAMVQLEEIHFNTLRLNK
Ga0348336_143771_214_6903300034375AqueousMFTTDDWYLQLQSIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAKKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDTPYEHSKPAIEQLEQIHFDSLRINKW
Ga0348336_153379_49_4353300034375AqueousMATPDQMVLGIDPNNFDYGYHRKVGKYLAKKHRNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLQTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW
Ga0348337_132624_1_5013300034418AqueousMPRIWTHIAWDNTGQKDLGKAYNACLSQHSDEDWVAFIDHDGMFTTDDWYLQLQHIIANNPKCKGICSRVNRMATPEQMVLGIDPNNFDYAYHRKVGKHLATKYKNQSTLITNAGHMSGVFFALHVGTIKSLGGCVETGKQLQTDHMTMDRVRNAGYEFRIADGIYI
Ga0348337_138399_210_6863300034418AqueousMFTTDDWYLQLQHIIEHNPKCKGITARINRMATPDQMVLGIDPNNFDYAYHRKVGKYLAAKHKNQSSIIKNRGHMSGVFFALHVGTIKSLGGCVETGMQLKTDHMTMDRVRDAGHEFRIADGIYIFHWYRHDAPYQHSKPAIEQLEQIHFDSLRINKW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.