| Basic Information | |
|---|---|
| Family ID | F044139 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 155 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGS |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.19 % |
| % of genes near scaffold ends (potentially truncated) | 19.35 % |
| % of genes from short scaffolds (< 2000 bps) | 78.06 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.484 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.839 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.516 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.065 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.06% β-sheet: 0.00% Coil/Unstructured: 52.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF10611 | DUF2469 | 25.81 |
| PF03816 | LytR_cpsA_psr | 19.35 |
| PF13399 | LytR_C | 12.90 |
| PF01351 | RNase_HII | 12.90 |
| PF02021 | UPF0102 | 3.87 |
| PF13530 | SCP2_2 | 2.58 |
| PF10502 | Peptidase_S26 | 1.94 |
| PF01245 | Ribosomal_L19 | 1.94 |
| PF12840 | HTH_20 | 1.29 |
| PF03572 | Peptidase_S41 | 0.65 |
| PF01557 | FAA_hydrolase | 0.65 |
| PF05239 | PRC | 0.65 |
| PF14622 | Ribonucleas_3_3 | 0.65 |
| PF00583 | Acetyltransf_1 | 0.65 |
| PF13738 | Pyr_redox_3 | 0.65 |
| PF07478 | Dala_Dala_lig_C | 0.65 |
| PF01746 | tRNA_m1G_MT | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG1316 | Anionic cell wall polymer biosynthesis enzyme TagV/TagU, LytR-Cps2A-Psr (LCP) family (peptidoglycan teichoic acid transferase) | Cell wall/membrane/envelope biogenesis [M] | 19.35 |
| COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 12.90 |
| COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 12.90 |
| COG0792 | Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family | Replication, recombination and repair [L] | 3.87 |
| COG0335 | Ribosomal protein L19 | Translation, ribosomal structure and biogenesis [J] | 1.94 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.48 % |
| Unclassified | root | N/A | 24.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_100590653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1220 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10054004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300003203|JGI25406J46586_10042147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1600 | Open in IMG/M |
| 3300003203|JGI25406J46586_10104266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
| 3300003373|JGI25407J50210_10006448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2922 | Open in IMG/M |
| 3300003373|JGI25407J50210_10050267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1058 | Open in IMG/M |
| 3300003373|JGI25407J50210_10108169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
| 3300003373|JGI25407J50210_10120766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
| 3300003373|JGI25407J50210_10143966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300003373|JGI25407J50210_10185605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300004016|Ga0058689_10039827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 839 | Open in IMG/M |
| 3300004157|Ga0062590_102531146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300004463|Ga0063356_103026936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300004479|Ga0062595_102411698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300005436|Ga0070713_100223958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1707 | Open in IMG/M |
| 3300005562|Ga0058697_10245752 | Not Available | 831 | Open in IMG/M |
| 3300005562|Ga0058697_10302345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 763 | Open in IMG/M |
| 3300005562|Ga0058697_10789653 | Not Available | 512 | Open in IMG/M |
| 3300005937|Ga0081455_10039058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4198 | Open in IMG/M |
| 3300005981|Ga0081538_10006598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10186 | Open in IMG/M |
| 3300005981|Ga0081538_10013000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6623 | Open in IMG/M |
| 3300005981|Ga0081538_10045989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2699 | Open in IMG/M |
| 3300005981|Ga0081538_10076140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1816 | Open in IMG/M |
| 3300005981|Ga0081538_10209231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
| 3300005981|Ga0081538_10306655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
| 3300005985|Ga0081539_10041512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2688 | Open in IMG/M |
| 3300005985|Ga0081539_10099913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1481 | Open in IMG/M |
| 3300005985|Ga0081539_10145781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1145 | Open in IMG/M |
| 3300005985|Ga0081539_10222773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
| 3300006046|Ga0066652_100251174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1549 | Open in IMG/M |
| 3300006169|Ga0082029_1176679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1806 | Open in IMG/M |
| 3300006791|Ga0066653_10613806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300006844|Ga0075428_100932174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
| 3300006845|Ga0075421_100156685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2844 | Open in IMG/M |
| 3300006845|Ga0075421_101238363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
| 3300006846|Ga0075430_100531795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 970 | Open in IMG/M |
| 3300009094|Ga0111539_11463775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300009100|Ga0075418_10529565 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300009157|Ga0105092_10546591 | Not Available | 666 | Open in IMG/M |
| 3300009789|Ga0126307_10056752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3066 | Open in IMG/M |
| 3300009789|Ga0126307_10245339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1439 | Open in IMG/M |
| 3300009789|Ga0126307_10594830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 893 | Open in IMG/M |
| 3300009801|Ga0105056_1012352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
| 3300009803|Ga0105065_1007690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens | 1072 | Open in IMG/M |
| 3300009806|Ga0105081_1066429 | Not Available | 557 | Open in IMG/M |
| 3300009817|Ga0105062_1051898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300009837|Ga0105058_1017305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1487 | Open in IMG/M |
| 3300009840|Ga0126313_10027591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3860 | Open in IMG/M |
| 3300009840|Ga0126313_10854617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
| 3300010037|Ga0126304_10412679 | Not Available | 902 | Open in IMG/M |
| 3300010038|Ga0126315_10058607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2112 | Open in IMG/M |
| 3300010038|Ga0126315_10535847 | Not Available | 750 | Open in IMG/M |
| 3300010041|Ga0126312_10141299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1667 | Open in IMG/M |
| 3300010145|Ga0126321_1058099 | Not Available | 552 | Open in IMG/M |
| 3300010145|Ga0126321_1299673 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300010166|Ga0126306_10004882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8030 | Open in IMG/M |
| 3300010329|Ga0134111_10155087 | Not Available | 908 | Open in IMG/M |
| 3300010362|Ga0126377_10000148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 38254 | Open in IMG/M |
| 3300010999|Ga0138505_100072127 | Not Available | 512 | Open in IMG/M |
| 3300011000|Ga0138513_100026755 | Not Available | 822 | Open in IMG/M |
| 3300012021|Ga0120192_10033346 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300012201|Ga0137365_10125516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1929 | Open in IMG/M |
| 3300012204|Ga0137374_10001117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 29829 | Open in IMG/M |
| 3300012204|Ga0137374_10012272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9992 | Open in IMG/M |
| 3300012204|Ga0137374_10014529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9110 | Open in IMG/M |
| 3300012204|Ga0137374_10043964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4690 | Open in IMG/M |
| 3300012204|Ga0137374_10054203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4095 | Open in IMG/M |
| 3300012204|Ga0137374_10074916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3311 | Open in IMG/M |
| 3300012204|Ga0137374_10157785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2016 | Open in IMG/M |
| 3300012204|Ga0137374_10178833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1855 | Open in IMG/M |
| 3300012204|Ga0137374_10477975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300012206|Ga0137380_10427304 | Not Available | 1174 | Open in IMG/M |
| 3300012350|Ga0137372_10129023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2086 | Open in IMG/M |
| 3300012350|Ga0137372_10515879 | Not Available | 887 | Open in IMG/M |
| 3300012353|Ga0137367_11154535 | Not Available | 520 | Open in IMG/M |
| 3300012354|Ga0137366_10083845 | All Organisms → cellular organisms → Bacteria | 2424 | Open in IMG/M |
| 3300012354|Ga0137366_10102407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2169 | Open in IMG/M |
| 3300012354|Ga0137366_10379803 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300012354|Ga0137366_11228535 | Not Available | 508 | Open in IMG/M |
| 3300012355|Ga0137369_10134725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1979 | Open in IMG/M |
| 3300012356|Ga0137371_10045414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3393 | Open in IMG/M |
| 3300012360|Ga0137375_10692891 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300012529|Ga0136630_1349460 | Not Available | 527 | Open in IMG/M |
| 3300013772|Ga0120158_10294663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 788 | Open in IMG/M |
| 3300014488|Ga0182001_10135537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
| 3300014965|Ga0120193_10006837 | Not Available | 976 | Open in IMG/M |
| 3300017654|Ga0134069_1221127 | Not Available | 651 | Open in IMG/M |
| 3300017965|Ga0190266_10254873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 883 | Open in IMG/M |
| 3300017997|Ga0184610_1003845 | Not Available | 3486 | Open in IMG/M |
| 3300017997|Ga0184610_1326108 | Not Available | 503 | Open in IMG/M |
| 3300018027|Ga0184605_10114566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens | 1197 | Open in IMG/M |
| 3300018028|Ga0184608_10173930 | Not Available | 937 | Open in IMG/M |
| 3300018028|Ga0184608_10494434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300018052|Ga0184638_1155552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
| 3300018052|Ga0184638_1281090 | Not Available | 566 | Open in IMG/M |
| 3300018056|Ga0184623_10199483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
| 3300018063|Ga0184637_10000020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 100137 | Open in IMG/M |
| 3300018071|Ga0184618_10227957 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300018074|Ga0184640_10150910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1036 | Open in IMG/M |
| 3300018075|Ga0184632_10158633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300018076|Ga0184609_10119585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens | 1196 | Open in IMG/M |
| 3300018078|Ga0184612_10076595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1745 | Open in IMG/M |
| 3300018422|Ga0190265_10357701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1548 | Open in IMG/M |
| 3300018422|Ga0190265_10847616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens | 1037 | Open in IMG/M |
| 3300018432|Ga0190275_10355093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens | 1459 | Open in IMG/M |
| 3300018465|Ga0190269_11957373 | Not Available | 508 | Open in IMG/M |
| 3300019254|Ga0184641_1097850 | Not Available | 970 | Open in IMG/M |
| 3300019377|Ga0190264_10079209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1456 | Open in IMG/M |
| 3300019767|Ga0190267_10179380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 965 | Open in IMG/M |
| 3300019767|Ga0190267_11143031 | Not Available | 564 | Open in IMG/M |
| 3300019867|Ga0193704_1020593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1340 | Open in IMG/M |
| 3300021073|Ga0210378_10013768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3342 | Open in IMG/M |
| 3300021080|Ga0210382_10266056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300021510|Ga0222621_1011597 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
| 3300025928|Ga0207700_10308706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora sagamiensis | 1368 | Open in IMG/M |
| 3300026673|Ga0208847_102321 | Not Available | 547 | Open in IMG/M |
| 3300027056|Ga0209879_1016679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1211 | Open in IMG/M |
| 3300027163|Ga0209878_1025617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
| 3300027379|Ga0209842_1015573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1490 | Open in IMG/M |
| 3300027523|Ga0208890_1087372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300027750|Ga0209461_10047061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
| 3300027750|Ga0209461_10125010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 606 | Open in IMG/M |
| 3300027909|Ga0209382_10401055 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300027909|Ga0209382_11882812 | Not Available | 579 | Open in IMG/M |
| 3300027952|Ga0209889_1004319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3909 | Open in IMG/M |
| 3300028704|Ga0307321_1131714 | Not Available | 523 | Open in IMG/M |
| 3300028711|Ga0307293_10024081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1812 | Open in IMG/M |
| 3300028711|Ga0307293_10102162 | Not Available | 909 | Open in IMG/M |
| 3300028719|Ga0307301_10282345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
| 3300028744|Ga0307318_10039829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1544 | Open in IMG/M |
| 3300028771|Ga0307320_10305923 | Not Available | 631 | Open in IMG/M |
| 3300028799|Ga0307284_10333995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300028824|Ga0307310_10157099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
| 3300028828|Ga0307312_10129394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1588 | Open in IMG/M |
| 3300028878|Ga0307278_10000454 | All Organisms → cellular organisms → Bacteria | 20642 | Open in IMG/M |
| 3300028878|Ga0307278_10001998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10039 | Open in IMG/M |
| 3300028881|Ga0307277_10498045 | Not Available | 546 | Open in IMG/M |
| 3300030336|Ga0247826_10244408 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300030496|Ga0268240_10169944 | Not Available | 546 | Open in IMG/M |
| 3300030499|Ga0268259_10005472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2155 | Open in IMG/M |
| 3300030499|Ga0268259_10183223 | Not Available | 512 | Open in IMG/M |
| 3300030830|Ga0308205_1045101 | Not Available | 575 | Open in IMG/M |
| 3300031229|Ga0299913_10584605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1100 | Open in IMG/M |
| 3300031421|Ga0308194_10053828 | Not Available | 1038 | Open in IMG/M |
| 3300031731|Ga0307405_10039536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2851 | Open in IMG/M |
| 3300031731|Ga0307405_10064331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2331 | Open in IMG/M |
| 3300031824|Ga0307413_10872478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
| 3300031901|Ga0307406_11632494 | Not Available | 570 | Open in IMG/M |
| 3300032002|Ga0307416_100974429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens | 950 | Open in IMG/M |
| 3300032002|Ga0307416_102881900 | Not Available | 575 | Open in IMG/M |
| 3300032002|Ga0307416_103388291 | Not Available | 533 | Open in IMG/M |
| 3300032159|Ga0268251_10008392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2816 | Open in IMG/M |
| 3300032159|Ga0268251_10135571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
| 3300034026|Ga0334946_026142 | Not Available | 964 | Open in IMG/M |
| 3300034172|Ga0334913_008690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2514 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 9.03% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 7.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.45% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 5.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.16% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 4.52% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.52% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 3.23% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.58% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.94% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.29% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.29% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.29% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.65% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.65% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.65% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026673 | Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1116 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300034026 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 42SMS | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1005906532 | 3300000956 | Soil | VGFNATRRYRDKKTIDIAILLAAVVIILGLVGWVLAAGGS* |
| JGIcombinedJ43975_100540042 | 3300002899 | Soil | MGFNATRRYRDKKTVDIALLVAAILIVIALLAWVFAAGGS* |
| JGI25406J46586_100421471 | 3300003203 | Tabebuia Heterophylla Rhizosphere | SIMGFNATRRYRDKKTVDIALLVAAILIVIALLAWVFAAGGT* |
| JGI25406J46586_101042663 | 3300003203 | Tabebuia Heterophylla Rhizosphere | VGFNATRRYRDKKTIDLAILIAAIVIIAGLLGWVFAAGGR* |
| JGI25407J50210_100064485 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MGFNATRRYRDRKTVDIALLIAAVLIVLALLAWVFAAGGS* |
| JGI25407J50210_100502672 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VGFNATRRYRDKKTVDIALLVAAIAIVIGLLAWVFAAGGA* |
| JGI25407J50210_101081692 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGN* |
| JGI25407J50210_101207662 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VGFNATRRYRDRKTVDIALLVAAVAIVIGLLAWVFSAGGS* |
| JGI25407J50210_101439662 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VGFNATRRYRDKKTVDIALLIAAVLIVLALLAWVFAAGGS* |
| JGI25407J50210_101856052 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGS* |
| Ga0058689_100398271 | 3300004016 | Agave | VGFNATRRYRDKKTVDLAILISAIVIVALLVGWVFAAGGR* |
| Ga0062590_1025311462 | 3300004157 | Soil | MGFNATRRYRDKKTVDIALLVAAILIVIALLAWVFAAGGT* |
| Ga0063356_1030269363 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MGFNATRRYRDKKTVDIAILVAALVIIGGLLAWVLAAGGN* |
| Ga0062595_1024116981 | 3300004479 | Soil | GFNATRRYRDKKTVDIALLAAAILIVIGLLAWVFAAGGS* |
| Ga0070713_1002239583 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VGFNATRRYRGKKTVDLAILIAAIVIVAVLVGWVLAAGGR* |
| Ga0058697_102457522 | 3300005562 | Agave | GFNATRRYRDKKTVDLAILISAIVIVALLVGWVFAAGGR* |
| Ga0058697_103023452 | 3300005562 | Agave | MGFNATRRYRDKKTVDIALLVAAIVIIIALLAWVFAAGGS* |
| Ga0058697_107896532 | 3300005562 | Agave | MGFNATRRYRDKKTVDIALLVAAIVIVIALLGWVFAAGGS* |
| Ga0081455_100390582 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VLIEGGPVGFNATRRYRDKKTIDLAILVAAIVIVGLLVGWVLAAGGR* |
| Ga0081538_1000659815 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VGFNATRRYRDKKTVDIALLVAAIAIVIGLLAWVFAAGGS* |
| Ga0081538_100130007 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGS* |
| Ga0081538_100459894 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MGFNATRRYRDKKTVDIALLVAAILIVLALLGWVFAAGGS* |
| Ga0081538_100761402 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VGFNATRRYRDRKTVDIALLVTAILIIVGLLAWVFAAGGS* |
| Ga0081538_102092312 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MGFNATRRYRDKKTVDIALLVAAVLIVLGLLAWVFAAGGN* |
| Ga0081538_103066552 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGS* |
| Ga0081539_100415124 | 3300005985 | Tabebuia Heterophylla Rhizosphere | IMGFNATRRYRDKKTVDIALLVAAILIVIALLAWVFAAGGS* |
| Ga0081539_100999132 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MGFNATRRYRDTKWVDIGLLIAAVVIIAALLAWVLLG* |
| Ga0081539_101457811 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MGFNATRRYRDKKTVDIALLVAAIVIVVALLGWVVAAGGS* |
| Ga0081539_102227731 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VGFNATRRYRDKKTVDLAILIAAIVIVALLVGWVLAAGGR* |
| Ga0066652_1002511742 | 3300006046 | Soil | LGYNVTRRYRGKKSVDVAILVAALLIIGGLLAWVLAAGGH* |
| Ga0082029_11766792 | 3300006169 | Termite Nest | VSVGFNATRRYRDKKTVDIALLIAAVLIVLALLGWVFAAGGS* |
| Ga0066653_106138061 | 3300006791 | Soil | LGYNVTRRYRGKKSVDVAILVAALVIIGGLLAWVLAAGGH* |
| Ga0075428_1009321742 | 3300006844 | Populus Rhizosphere | MGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGS* |
| Ga0075421_1001566853 | 3300006845 | Populus Rhizosphere | VGFNATRRYRDKKTIDLAILVSAIVIIAVLVGWVLAAGGR* |
| Ga0075421_1012383632 | 3300006845 | Populus Rhizosphere | VGFNATRRYRGKKTVDLAILISAIVIVTLLVGWVFAAGGR* |
| Ga0075430_1005317952 | 3300006846 | Populus Rhizosphere | GFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGS* |
| Ga0111539_114637752 | 3300009094 | Populus Rhizosphere | GFNATRRYRDKKTVDIALLVAAIVIVIGLLAGVFSAGGS* |
| Ga0075418_105295653 | 3300009100 | Populus Rhizosphere | MGFNATRRYRDKKTVDIAILISALVIIGGLLAWVLAAGGN* |
| Ga0105092_105465912 | 3300009157 | Freshwater Sediment | GFNATRRYRDRKTVDIALLIAAVLIVLALLAWVFAAGGS* |
| Ga0126307_100567525 | 3300009789 | Serpentine Soil | FNATRRYRDKKTVDIALLVAAILIVIALLAWVFAAGGT* |
| Ga0126307_102453392 | 3300009789 | Serpentine Soil | VGFNATRRYRDKKTVDIALLVAAILIVAALLAWVFAAGGT* |
| Ga0126307_105948302 | 3300009789 | Serpentine Soil | MGFNATRRYRDKKTVDIALLVAAILIVLALLAWVLAAGGN* |
| Ga0105056_10123522 | 3300009801 | Groundwater Sand | VGFNATRRYRDKKTVDIVLLVVAIAIVIGLLAWVFSAGGS* |
| Ga0105065_10076901 | 3300009803 | Groundwater Sand | RRYRDKKTVDIALLVAAIAIVIGLLAWVFSAGGS* |
| Ga0105081_10664291 | 3300009806 | Groundwater Sand | VGFNATRRYRDKKTVDIALLVAAVIIVAGLLAWVFAAGGR* |
| Ga0105062_10518982 | 3300009817 | Groundwater Sand | VGFNATRRYRDRKAVDIALLVAAIAIVIGLLAWVVAAGGS* |
| Ga0105058_10173052 | 3300009837 | Groundwater Sand | FNATRRYRDKKTVDIALLVAAIAIVIGLLAWVFAAGGS* |
| Ga0126313_100275916 | 3300009840 | Serpentine Soil | MGFNATRRYRDKKTVDIALLVAAVLIILALLAWVFAAGGS* |
| Ga0126313_108546172 | 3300009840 | Serpentine Soil | MGFNATRRYRDKKTVDIALLIAAILIVIALLAWVFAAGGT* |
| Ga0126304_104126792 | 3300010037 | Serpentine Soil | MGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGN* |
| Ga0126315_100586072 | 3300010038 | Serpentine Soil | MGFNATRRYRDKKTVDIALLVAAIIIVIALLAWVFAAGGS* |
| Ga0126315_105358471 | 3300010038 | Serpentine Soil | VGFNATRRYRDKKTVDIALLVAAVAIVIGLLAWVFSAGGS* |
| Ga0126312_101412991 | 3300010041 | Serpentine Soil | NATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGN* |
| Ga0126321_10580992 | 3300010145 | Soil | VGFNATRRYRDKKTVDIALLVAAIVIVIALLAWVFSAGGS* |
| Ga0126321_12996732 | 3300010145 | Soil | MGFNATRRYRDRKTVDVAILTAAVVIILCLLAWVFAAGGR* |
| Ga0126306_1000488210 | 3300010166 | Serpentine Soil | MGFNATRRYRDKKTVDIALLIAAVLIVLALLAWVFAAGGS* |
| Ga0134111_101550872 | 3300010329 | Grasslands Soil | VGFNATRRYRDKKTVDIALLVAAILIIIGLLAWVFSAGGS* |
| Ga0126377_100001487 | 3300010362 | Tropical Forest Soil | MGFNATRRYRDRKWVDIGLLIAAVLIVAALLSWVLTGW* |
| Ga0138505_1000721271 | 3300010999 | Soil | MGFNATRRYRDKKTVDIALLVAAIVIVIALLAWVFDAGGS* |
| Ga0138513_1000267552 | 3300011000 | Soil | MGFNATRRYRDKKAVDIALLVAAILIVLGLLAWVFAAGGN* |
| Ga0120192_100333461 | 3300012021 | Terrestrial | MVGFNATRRYRDRKTVDIALLVAAVAIVIGLLAWVFSAGGS* |
| Ga0137365_101255162 | 3300012201 | Vadose Zone Soil | MGFNATRRYRDKKTVDIAILLAAVVVVALLVGWVLAAGGR* |
| Ga0137374_1000111723 | 3300012204 | Vadose Zone Soil | VGFNATRRYRDKKTIDIAILLAAIVIIVGLLGWVFAAGGR* |
| Ga0137374_100122728 | 3300012204 | Vadose Zone Soil | MGFNATRRYRDKKTVDIAILVAALLIIGGLLAWVLAAGGN* |
| Ga0137374_100145292 | 3300012204 | Vadose Zone Soil | VGFNATRRYRDKKTVDIALLVAAIAIVIGLLAWVFSAGGS* |
| Ga0137374_100439645 | 3300012204 | Vadose Zone Soil | VGFNATRRYRDKKTIDVAILLAAVVIIIGLLAWVFAAGGR* |
| Ga0137374_100542033 | 3300012204 | Vadose Zone Soil | VGFNATRRYRDKKTIDIAILLAAIVIIIGLLAWVFAAGGR* |
| Ga0137374_100749162 | 3300012204 | Vadose Zone Soil | VGFNATRRYRDKKTIDLAILIAAIVIVALLVGWVLAAGGR* |
| Ga0137374_101577853 | 3300012204 | Vadose Zone Soil | MGFNATRRYRDKKTVDIAILVAAVVIIGGLLAWVLAAGGH* |
| Ga0137374_101788331 | 3300012204 | Vadose Zone Soil | VGFNATRRYRDKKTVDILILVAAIVIVSGLLVWVFAAGGR* |
| Ga0137374_104779752 | 3300012204 | Vadose Zone Soil | MGFNATRRYRDKKTVDIAILVAAAVIIGGLLAWVLAAGGR* |
| Ga0137380_104273043 | 3300012206 | Vadose Zone Soil | MGFNATRRYRDKKTVDIAILVAALVIVGGLLAWVLAAGGR* |
| Ga0137372_101290232 | 3300012350 | Vadose Zone Soil | VGFNATRRYRDKKTVDIAILLAAVVIIALLVGWVLAAGGR* |
| Ga0137372_105158792 | 3300012350 | Vadose Zone Soil | VGFNATRRYRDKKTVDLAILIAAIVIVAVLVGWVLAAGGR* |
| Ga0137367_111545352 | 3300012353 | Vadose Zone Soil | VGFNATRRYRDKKTTDLVILISAIVIVAVLVGWVL |
| Ga0137366_100838454 | 3300012354 | Vadose Zone Soil | FNATRRYRDKKTVDIAILLAAVVVVALLVGWVLAAGGR* |
| Ga0137366_101024071 | 3300012354 | Vadose Zone Soil | MGFNATRRYRDKKTVDIAILLAAVVVVALLVGWVLAAGG |
| Ga0137366_103798032 | 3300012354 | Vadose Zone Soil | MRFNATRRYRDKKTTDIAILVAALVIVAGLLLWVVAAGGH* |
| Ga0137366_112285352 | 3300012354 | Vadose Zone Soil | VGFNATRRYRDKKTTDLVILISAIVIVAVLVGWVLAAGGR* |
| Ga0137369_101347252 | 3300012355 | Vadose Zone Soil | VGFNATRRYRDRKTVDIALLVAAVIIVAGLLAWVFAAGGR* |
| Ga0137371_100454144 | 3300012356 | Vadose Zone Soil | MGFNATRRYRDKKTTDVAILVAALVIVAGLLGWVLAAGGH* |
| Ga0137375_106928912 | 3300012360 | Vadose Zone Soil | GFNATRRYRDKKTVDIAILVAAVVIIGGLLAWVLAAGGH* |
| Ga0136630_13494602 | 3300012529 | Polar Desert Sand | MGFNATRRYRDSNVLDIVLLFVAEVTIGLLLAWASGVIL* |
| Ga0120158_102946633 | 3300013772 | Permafrost | VGFNATRRYRGPKTGDIALLIAGIIIIGGLLAWALTA* |
| Ga0182001_101355372 | 3300014488 | Soil | MGFNATRRYRDKKTVDIALLVAAILIILGLLAWVFAAGGN* |
| Ga0120193_100068372 | 3300014965 | Terrestrial | VGFNATRRYRDRKTVDIALLVVAVLIVAGLLAWVFAAGGQ* |
| Ga0134069_12211271 | 3300017654 | Grasslands Soil | LGYNVTRRYRGKKSVDVAILVAALLIIGGLLAWVLAAGGH |
| Ga0190266_102548732 | 3300017965 | Soil | MGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGS |
| Ga0184610_10038455 | 3300017997 | Groundwater Sediment | MGFNATRRYRDKKTVDIAILVAAIVIIGGLLAWVLAAGGS |
| Ga0184610_13261082 | 3300017997 | Groundwater Sediment | MGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGS |
| Ga0184605_101145661 | 3300018027 | Groundwater Sediment | TRRYRDKKTVDIALLVAALLIVLGLLAWVFAAGGN |
| Ga0184608_101739303 | 3300018028 | Groundwater Sediment | MGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGK |
| Ga0184608_104944342 | 3300018028 | Groundwater Sediment | MGFNATRRYRDKKAVDIALLVAAILIVLALLAWVFAAGGS |
| Ga0184638_11555522 | 3300018052 | Groundwater Sediment | VGFNATRRYRDKKTVDIALLVAAIAIVIGLLAWVFSAGGS |
| Ga0184638_12810902 | 3300018052 | Groundwater Sediment | VGFNATRRYRDKKIVDLALLVAAIAIVIGLLAWVFAAGGS |
| Ga0184623_101994831 | 3300018056 | Groundwater Sediment | VGFNATRRYRDKKVVDIALLVAAILIILGLLTWVFAAGGS |
| Ga0184637_1000002040 | 3300018063 | Groundwater Sediment | MGFNATRRYRDKKTVDIAILVAAVVIIGGLLAWVLAAGGH |
| Ga0184618_102279571 | 3300018071 | Groundwater Sediment | LGFNATRRYRGKKTVDLAILISAIVIVAVLVGWVLAAGGR |
| Ga0184640_101509102 | 3300018074 | Groundwater Sediment | MGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGN |
| Ga0184632_101586332 | 3300018075 | Groundwater Sediment | MGFNATRRYRDKKVVDIALLVAAILIILGLLAWVFAAGGS |
| Ga0184609_101195851 | 3300018076 | Groundwater Sediment | VGFNATRRYRDRKTVDIALLVAAIAIVIGLLAWVVSAGGS |
| Ga0184612_100765952 | 3300018078 | Groundwater Sediment | MGFNATRRYRDKKTVDISLLVAAILIVLGLLAWVFAAGGS |
| Ga0190265_103577012 | 3300018422 | Soil | MGFNATRRYRDKKVVDIALLVAAVLIVLGLLAWVFAAGGS |
| Ga0190265_108476162 | 3300018422 | Soil | NATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGS |
| Ga0190275_103550932 | 3300018432 | Soil | MGFNATRRYRDKKTVDIALLIAAVLIVLALLAWVFAAGGS |
| Ga0190269_119573732 | 3300018465 | Soil | ASMGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGN |
| Ga0184641_10978503 | 3300019254 | Groundwater Sediment | MGFNATRRYRDKKAVDIALLVAAILIVLGLLAWVFAAGGN |
| Ga0190264_100792092 | 3300019377 | Soil | VGFNATRRYRDKKVVDIALLVAAILIIVGLLTWVFAAGGS |
| Ga0190267_101793803 | 3300019767 | Soil | MGFNATRRYRDRKAVDIALLVAAILIVLALLAWVFAAGGS |
| Ga0190267_111430312 | 3300019767 | Soil | MGFNATRRYRDKKTVDIALLVAAVLIVLGLLAWVFAAGGS |
| Ga0193704_10205932 | 3300019867 | Soil | MGFNATRRYRDKKVVDIALLVAAILIVLALLAWVFAAGGS |
| Ga0210378_100137684 | 3300021073 | Groundwater Sediment | VGFNATRRYRDRKAVDIALLVAAIAIVIGLLAWVVSAGGS |
| Ga0210382_102660562 | 3300021080 | Groundwater Sediment | MGFNATRRYRDKKAVDIALLVAAILIVLGLLAWVFAAGGS |
| Ga0222621_10115974 | 3300021510 | Groundwater Sediment | MGFNATRRYRDKKTVDIALLVAAILIVLGLLAWVFAAGGN |
| Ga0207700_103087063 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VGFNATRRYRGKKTVDLAILIAAIVIVAVLVGWVLAAGGR |
| Ga0208847_1023212 | 3300026673 | Soil | VGFNATRRYRDKKTVDIALLVAAIVIVLALLAWVFAAGGN |
| Ga0209879_10166792 | 3300027056 | Groundwater Sand | VGFNATRRYRDRKTVDIALLVAAVIIVAGLLAWVFAAGGR |
| Ga0209878_10256172 | 3300027163 | Groundwater Sand | VGFNATRRYRDKKTVDIALLVAAIAIVIGLLAWVVSAGGS |
| Ga0209842_10155732 | 3300027379 | Groundwater Sand | VGFNATRRYRDRKAVDIALLVAAIAIVIGLLAWVVAAGGS |
| Ga0208890_10873722 | 3300027523 | Soil | MGFNATRRYRDAKWVDIGILIAALVIIAGLLGWVLFG |
| Ga0209461_100470611 | 3300027750 | Agave | VGFNATRRYRDKKTVDLAILISAIVIVALLVGWVFAAGGR |
| Ga0209461_101250102 | 3300027750 | Agave | GTSMGFNATRRYRDKKTVDIALLAAAILIVLALLAWVFAAGGN |
| Ga0209382_104010554 | 3300027909 | Populus Rhizosphere | VGFNATRRYRDKKTIDLAILVSAIVIIAVLVGWVLAAGGR |
| Ga0209382_118828123 | 3300027909 | Populus Rhizosphere | MGFNATRRYRDKKTVDIAILISALVIIGGLLAWVLA |
| Ga0209889_10043192 | 3300027952 | Groundwater Sand | VGFNATRRYRDKKTVDIALLVAAIAIVIGLLAWVFAAGGS |
| Ga0307321_11317142 | 3300028704 | Soil | ATRRYRDKKTVDIALLVAAIVIVIALLAWVFAAGGS |
| Ga0307293_100240812 | 3300028711 | Soil | ATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGS |
| Ga0307293_101021622 | 3300028711 | Soil | MGFNATRRYRDKKTVDIALLVAAILIVLALLAWVFA |
| Ga0307301_102823452 | 3300028719 | Soil | MGFNATRRYRDKKTVDIAILISALVIIGGLLAWVLAAGGN |
| Ga0307318_100398291 | 3300028744 | Soil | RNGACMGFNATRRYRDKKAVDIALLVAAILIVLGLLAWVFAAGGN |
| Ga0307320_103059231 | 3300028771 | Soil | GFNATRRYRDKKTVDIALLVAAILIVLALLAWVFAAGGS |
| Ga0307284_103339952 | 3300028799 | Soil | MGYNVTRRYRDKKSVDVAILIAALLIIGGLLAWVLAAGGH |
| Ga0307310_101570991 | 3300028824 | Soil | GELTPMGFNATRRYRDKKTVDIAILLAAVVIIGALLTWVLAAGGR |
| Ga0307312_101293944 | 3300028828 | Soil | MGFNATRRYRGTKWVDIGLLVAALVIIAALLAWVLLG |
| Ga0307278_1000045421 | 3300028878 | Soil | MGFNATRRYRDKKTVDIAILVAALVIIGGLLAWVLAAGGN |
| Ga0307278_1000199813 | 3300028878 | Soil | MGFNATRRYRDKKPVDIAILVAAIVIIGGLVAWVLAAGGN |
| Ga0307277_104980452 | 3300028881 | Soil | MGFNATRRYRDKKTVDIALLVAAILIVIALLAWVFAAGGT |
| Ga0247826_102444083 | 3300030336 | Soil | MGFNATRRYRDTKWVDIGILVAALVIIAGLLAWVLFG |
| Ga0268240_101699441 | 3300030496 | Soil | NATRRYRDKKTVDIALLVAAIVIVIALLAWVFAAGGS |
| Ga0268259_100054721 | 3300030499 | Agave | MGFNATRRYRDKKTVDIALLAAAIVIIVALLAWVFAAGGS |
| Ga0268259_101832232 | 3300030499 | Agave | MGFNATRRYRDKKTVDIALLVAAIVIIIALLAWVFAAGGS |
| Ga0308205_10451011 | 3300030830 | Soil | MGFNATRRYRDKKAVDIALLVAAILIVLGLLAWVFAAG |
| Ga0299913_105846051 | 3300031229 | Soil | VGFNATRRYRGPRTVDIAILVAGIVIIGGLLAWAFAG |
| Ga0308194_100538281 | 3300031421 | Soil | VGFNATRRYRGKKTVDLAILISAIVIVTVLVGWVFAAGGR |
| Ga0307405_100395365 | 3300031731 | Rhizosphere | MGFNATRRYRDKKTVDIALLVAAVLIILALLAWVFAAGGS |
| Ga0307405_100643313 | 3300031731 | Rhizosphere | VGFNATRRYRDKKTVDIALLVAAVAIVIGLLAWVFSAGGS |
| Ga0307413_108724782 | 3300031824 | Rhizosphere | VGFNATRRYRDKKTVDIALLIAAVLIVLALLAWVFAAGGS |
| Ga0307406_116324942 | 3300031901 | Rhizosphere | MGFNATRRYRDKKTVDIALLIAAILIVIALLAWVFAAGGT |
| Ga0307416_1009744292 | 3300032002 | Rhizosphere | NATRRYRDKKTVDIALLVAAILIVVALLAWVFAAGGT |
| Ga0307416_1028819002 | 3300032002 | Rhizosphere | TRRYRDKKTVDIALLVAAIVIVIALLAWVFAAGGT |
| Ga0307416_1033882912 | 3300032002 | Rhizosphere | MGFNATRRYRDKKTVDIALLVAAILIVIALLTWVFAAGGN |
| Ga0268251_100083924 | 3300032159 | Agave | MGFNATRRYRDKKTVDLAILISAIVIVALLVGWVFAAGGR |
| Ga0268251_101355712 | 3300032159 | Agave | MGFNATRRYRDKKTVDIALLVAAIVIVIALLGWVFAAGGS |
| Ga0334946_026142_277_399 | 3300034026 | Sub-Biocrust Soil | MGFNATRRYRDKKTADIALLVAAILIVLALLGWVFAAGGS |
| Ga0334913_008690_2028_2150 | 3300034172 | Sub-Biocrust Soil | VGFNATRRYRDKKTVDIALLVAAIVIVLGLLAWVFAAGGS |
| ⦗Top⦘ |