| Basic Information | |
|---|---|
| Family ID | F044127 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 155 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MEPLISVNCSAIECTSLSPSAPIWQDILAQAMTGELLAAMNYTSLS |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.48 % |
| % of genes from short scaffolds (< 2000 bps) | 87.74 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.968 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.645 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.645 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.677 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.24% β-sheet: 0.00% Coil/Unstructured: 56.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF14329 | DUF4386 | 20.65 |
| PF00005 | ABC_tran | 5.16 |
| PF03551 | PadR | 1.94 |
| PF07719 | TPR_2 | 1.94 |
| PF06441 | EHN | 1.29 |
| PF00392 | GntR | 1.29 |
| PF13437 | HlyD_3 | 0.65 |
| PF00781 | DAGK_cat | 0.65 |
| PF02687 | FtsX | 0.65 |
| PF05345 | He_PIG | 0.65 |
| PF01916 | DS | 0.65 |
| PF00701 | DHDPS | 0.65 |
| PF13855 | LRR_8 | 0.65 |
| PF10067 | DUF2306 | 0.65 |
| PF13372 | Alginate_exp | 0.65 |
| PF02954 | HTH_8 | 0.65 |
| PF05199 | GMC_oxred_C | 0.65 |
| PF02631 | RecX | 0.65 |
| PF12680 | SnoaL_2 | 0.65 |
| PF00583 | Acetyltransf_1 | 0.65 |
| PF00582 | Usp | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.94 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.94 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.94 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.29 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 1.29 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.29 |
| COG1899 | Deoxyhypusine synthase | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG2137 | SOS response regulatory protein OraA/RecX, interacts with RecA | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.97 % |
| Unclassified | root | N/A | 9.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004082|Ga0062384_100599661 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300004092|Ga0062389_101785137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 795 | Open in IMG/M |
| 3300004152|Ga0062386_100719470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300005437|Ga0070710_10804906 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300005445|Ga0070708_100679293 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300005451|Ga0066681_10012338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 4197 | Open in IMG/M |
| 3300005518|Ga0070699_102113964 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005536|Ga0070697_100737470 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300005536|Ga0070697_101281084 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300005536|Ga0070697_101690200 | Not Available | 566 | Open in IMG/M |
| 3300005542|Ga0070732_10298408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300005553|Ga0066695_10373662 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300005554|Ga0066661_10139924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1475 | Open in IMG/M |
| 3300005555|Ga0066692_10308049 | Not Available | 1004 | Open in IMG/M |
| 3300005557|Ga0066704_10543786 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005568|Ga0066703_10773435 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005610|Ga0070763_10140414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1254 | Open in IMG/M |
| 3300005921|Ga0070766_11027535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300006028|Ga0070717_10440424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1173 | Open in IMG/M |
| 3300006050|Ga0075028_100553608 | Not Available | 678 | Open in IMG/M |
| 3300006059|Ga0075017_100211430 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300006102|Ga0075015_100000839 | All Organisms → cellular organisms → Bacteria | 11094 | Open in IMG/M |
| 3300006102|Ga0075015_100817063 | Not Available | 560 | Open in IMG/M |
| 3300006172|Ga0075018_10451962 | Not Available | 662 | Open in IMG/M |
| 3300006176|Ga0070765_100414680 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1259 | Open in IMG/M |
| 3300006794|Ga0066658_10056914 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300006796|Ga0066665_10506281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → unclassified Terriglobus → Terriglobus sp. TAA 43 | 988 | Open in IMG/M |
| 3300006796|Ga0066665_10855012 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300006893|Ga0073928_10002535 | All Organisms → cellular organisms → Bacteria | 31104 | Open in IMG/M |
| 3300007258|Ga0099793_10442528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300007258|Ga0099793_10463223 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300009089|Ga0099828_11147778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300009143|Ga0099792_10074908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1717 | Open in IMG/M |
| 3300009635|Ga0116117_1098593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300009683|Ga0116224_10471623 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300009792|Ga0126374_10540186 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300010323|Ga0134086_10394164 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010341|Ga0074045_10396567 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300010358|Ga0126370_10154392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1678 | Open in IMG/M |
| 3300010358|Ga0126370_10580971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
| 3300010360|Ga0126372_12419667 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010361|Ga0126378_12728130 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300010876|Ga0126361_11087479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 555 | Open in IMG/M |
| 3300010880|Ga0126350_11964605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 649 | Open in IMG/M |
| 3300012199|Ga0137383_11182298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300012199|Ga0137383_11272005 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012200|Ga0137382_10957815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300012205|Ga0137362_10300121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1390 | Open in IMG/M |
| 3300012205|Ga0137362_11112346 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300012285|Ga0137370_10893354 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300012350|Ga0137372_10461019 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 952 | Open in IMG/M |
| 3300012357|Ga0137384_11368339 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012361|Ga0137360_10603140 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300012362|Ga0137361_11469086 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012363|Ga0137390_10104098 | All Organisms → cellular organisms → Bacteria | 2807 | Open in IMG/M |
| 3300012532|Ga0137373_10200458 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300012582|Ga0137358_11031674 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012685|Ga0137397_10459581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → unclassified Terriglobus → Terriglobus sp. TAA 43 | 948 | Open in IMG/M |
| 3300012922|Ga0137394_10883588 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300014495|Ga0182015_10743173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 617 | Open in IMG/M |
| 3300015051|Ga0137414_1254235 | All Organisms → cellular organisms → Bacteria | 3298 | Open in IMG/M |
| 3300015054|Ga0137420_1103910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → unclassified Terriglobus → Terriglobus sp. TAA 43 | 1150 | Open in IMG/M |
| 3300015054|Ga0137420_1111905 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300015245|Ga0137409_11192045 | Not Available | 602 | Open in IMG/M |
| 3300017656|Ga0134112_10039485 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300018035|Ga0187875_10321570 | Not Available | 835 | Open in IMG/M |
| 3300018037|Ga0187883_10215528 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300018433|Ga0066667_10068142 | All Organisms → cellular organisms → Bacteria | 2236 | Open in IMG/M |
| 3300019879|Ga0193723_1187498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300019882|Ga0193713_1026783 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
| 3300020581|Ga0210399_10078585 | All Organisms → cellular organisms → Bacteria | 2678 | Open in IMG/M |
| 3300020582|Ga0210395_10978341 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300021088|Ga0210404_10845927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300021171|Ga0210405_10098853 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300021180|Ga0210396_10044506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4078 | Open in IMG/M |
| 3300021180|Ga0210396_10219903 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| 3300021401|Ga0210393_10530928 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 961 | Open in IMG/M |
| 3300021403|Ga0210397_10506521 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300021404|Ga0210389_11298410 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300021405|Ga0210387_10590533 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300021420|Ga0210394_10735332 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300021420|Ga0210394_11417081 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300021432|Ga0210384_11307395 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300021432|Ga0210384_11482891 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300021433|Ga0210391_10334566 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1188 | Open in IMG/M |
| 3300021474|Ga0210390_11185435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter bradus | 617 | Open in IMG/M |
| 3300021475|Ga0210392_10004134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 7506 | Open in IMG/M |
| 3300021559|Ga0210409_11632241 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 521 | Open in IMG/M |
| 3300021560|Ga0126371_12678818 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300022557|Ga0212123_10003724 | All Organisms → cellular organisms → Bacteria | 31114 | Open in IMG/M |
| 3300022557|Ga0212123_10029099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 5763 | Open in IMG/M |
| 3300024178|Ga0247694_1036946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300024182|Ga0247669_1027699 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300024219|Ga0247665_1017730 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300024224|Ga0247673_1060894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300024288|Ga0179589_10294207 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300024330|Ga0137417_1253004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → unclassified Terriglobus → Terriglobus sp. TAA 43 | 1098 | Open in IMG/M |
| 3300024330|Ga0137417_1459786 | All Organisms → cellular organisms → Bacteria | 2548 | Open in IMG/M |
| 3300026295|Ga0209234_1202460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300026298|Ga0209236_1139495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → unclassified Terriglobus → Terriglobus sp. TAA 43 | 1044 | Open in IMG/M |
| 3300026323|Ga0209472_1214947 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300026333|Ga0209158_1176840 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300026515|Ga0257158_1020537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1106 | Open in IMG/M |
| 3300026523|Ga0209808_1289542 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300026542|Ga0209805_1313659 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300026555|Ga0179593_1243943 | All Organisms → cellular organisms → Bacteria | 2129 | Open in IMG/M |
| 3300027590|Ga0209116_1078674 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300027591|Ga0209733_1094222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 759 | Open in IMG/M |
| 3300027604|Ga0208324_1168541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300027671|Ga0209588_1050341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1348 | Open in IMG/M |
| 3300027696|Ga0208696_1036376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1769 | Open in IMG/M |
| 3300027795|Ga0209139_10286112 | Not Available | 581 | Open in IMG/M |
| 3300027846|Ga0209180_10450401 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300027862|Ga0209701_10502214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300027867|Ga0209167_10459740 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300027882|Ga0209590_10318608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1000 | Open in IMG/M |
| 3300027884|Ga0209275_10723002 | Not Available | 574 | Open in IMG/M |
| 3300027915|Ga0209069_10198757 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300027986|Ga0209168_10598236 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300028882|Ga0302154_10003614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 11227 | Open in IMG/M |
| 3300029914|Ga0311359_10656659 | Not Available | 761 | Open in IMG/M |
| 3300029943|Ga0311340_11228655 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300030054|Ga0302182_10112272 | Not Available | 1193 | Open in IMG/M |
| 3300030503|Ga0311370_11156594 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 844 | Open in IMG/M |
| 3300030524|Ga0311357_10859235 | Not Available | 810 | Open in IMG/M |
| 3300030580|Ga0311355_11466024 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300030617|Ga0311356_11078153 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300031090|Ga0265760_10247489 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 616 | Open in IMG/M |
| 3300031234|Ga0302325_10374781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 2239 | Open in IMG/M |
| 3300031236|Ga0302324_102378582 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 651 | Open in IMG/M |
| 3300031474|Ga0170818_115584338 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031525|Ga0302326_10804218 | Not Available | 1354 | Open in IMG/M |
| 3300031525|Ga0302326_11082426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1116 | Open in IMG/M |
| 3300031668|Ga0318542_10504047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 629 | Open in IMG/M |
| 3300031708|Ga0310686_103650496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300031708|Ga0310686_104810463 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031719|Ga0306917_10188970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1553 | Open in IMG/M |
| 3300031720|Ga0307469_11254994 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300031720|Ga0307469_12205247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300031747|Ga0318502_10901665 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031771|Ga0318546_10077722 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
| 3300031771|Ga0318546_10349231 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300031782|Ga0318552_10404019 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300031788|Ga0302319_11906621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300031792|Ga0318529_10363736 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031795|Ga0318557_10309162 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300031823|Ga0307478_10169771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1741 | Open in IMG/M |
| 3300031823|Ga0307478_10555408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300031823|Ga0307478_11217194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300031880|Ga0318544_10381588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 548 | Open in IMG/M |
| 3300031890|Ga0306925_11142098 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300031910|Ga0306923_10158167 | All Organisms → cellular organisms → Bacteria | 2587 | Open in IMG/M |
| 3300031962|Ga0307479_10950006 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300032060|Ga0318505_10505375 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.39% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.10% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.23% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.87% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.58% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.94% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.29% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.29% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.65% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062384_1005996611 | 3300004082 | Bog Forest Soil | MEPVIQVKDSLSNGCASSLLSAPIWQDVLAQAMTGELIAAMN |
| Ga0062389_1017851372 | 3300004092 | Bog Forest Soil | MESVISLNSATVCTSLSPSAAIWQDVLAQAMTGELIAAMNYTSLAEICD |
| Ga0062386_1007194702 | 3300004152 | Bog Forest Soil | METVIGIDCSTNECTSFSKSAPIWQDVLAQAVTGELLAAMNYAS |
| Ga0070710_108049061 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPLVGVNCSSIECTSLSTTAPIWQDILAQAMTGELLAAMNYASLSEICDDP |
| Ga0070708_1006792931 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPIICLDPSPTECTSPPSSAPIWQDVLAHAMTGELLAAMNYASLSEIC |
| Ga0066681_100123386 | 3300005451 | Soil | MEPLVSVNDSPMECTSLSASAPIWQDILAQAMTGELLAAM |
| Ga0070699_1021139642 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPLIDVNASPMQCTSFSPNAPIWQDILAQAMTGELLAAMNYASLSE |
| Ga0070697_1007374702 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MERVVCLDPPPTECTSPSSSAPIWQDVLAHAMTGELLAAMNYASLSEICADP |
| Ga0070697_1012810841 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSLVALDCSAIECTSLSPTATIWQDILAQAMTGERLAAMNYTS |
| Ga0070697_1016902002 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPVIGVNCSSIECTSLSTTAPIWQDILAQAMTGELLAAMNYASLS |
| Ga0070732_102984081 | 3300005542 | Surface Soil | MESLVGLNCSATECTSLSPSAPIWQDVLAQALTGELVAA |
| Ga0066695_103736622 | 3300005553 | Soil | MERVACLDPSPTECTSPSSSAPIWQDVLAHAMTGELLAAMNY |
| Ga0066661_101399241 | 3300005554 | Soil | MEPLIRVNCTAIECTSLSTSAPIWQDILAQAMTGELLAAMNYTSLSE |
| Ga0066692_103080491 | 3300005555 | Soil | MEPVIGLDCSPMECSALSASAPIWQDVLAQAMTGELL |
| Ga0066704_105437861 | 3300005557 | Soil | MESVVCLDPSPTECTSPSSSAPIWQDVLAHAMTGEFLAAMNYASLSEIC |
| Ga0066703_107734352 | 3300005568 | Soil | MEPLTSVNCSAIECTSLSTSAPIWQDILAQAMTGELLAAMN |
| Ga0070763_101404141 | 3300005610 | Soil | MEPLIDVKASPMECTSLSTSAPIWQDILAQAMTGELLAAMNYA |
| Ga0070766_110275352 | 3300005921 | Soil | MEPVIELNCSLPIQCTSLSPNASIWQDVLAQAMTGELIAAMNYTS |
| Ga0070717_104404241 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPVMGINCSPAIGCISSSAPIWQDVLAQAVTGELLAAMNY |
| Ga0075028_1005536082 | 3300006050 | Watersheds | MEPLIDVNASQMECTSLSTSAPIWQDILAQAMTGE |
| Ga0075017_1002114305 | 3300006059 | Watersheds | VGPHIGLNCSTIECTSLSPSAPIWQDVLAQAMTGELIAAMNYKSLSEI |
| Ga0075015_1000008391 | 3300006102 | Watersheds | VGPHIGLNCSTIECTSLSPSAPIWQDVLAQAMTGELIAAMNYK |
| Ga0075015_1008170631 | 3300006102 | Watersheds | VGPLIGLNCSTIECTSLSPSAPIWQDVLAQAMTGELIAAMNYK |
| Ga0075018_104519622 | 3300006172 | Watersheds | MEPLIDVNCSLKECTSLSPTAPIWQDILAQAVTGELIAA |
| Ga0070765_1004146802 | 3300006176 | Soil | MEPLIDVKASPMECTSLSTSAPIWQDILAQAMTGELLAAMNYASLSEICDDP |
| Ga0066658_100569141 | 3300006794 | Soil | MEPLIDVNCSPMECTSLSRSAPIWQDILAQAMTGELLAAMNYTS |
| Ga0066665_105062812 | 3300006796 | Soil | MEPLIDVNCSPMDCPSLSPSAPIWQDILAQAMTGELLAAMNYTSLSEICDDP |
| Ga0066665_108550121 | 3300006796 | Soil | MEPLVALDCSAIECPSLSPTAPIWQDILAQAMTGELLAA |
| Ga0073928_1000253534 | 3300006893 | Iron-Sulfur Acid Spring | MEPVASPNCFAHECLSLLPSAPIWQDVLAQAVTGELLAAMNYTALAEMDCFAT* |
| Ga0099793_104425282 | 3300007258 | Vadose Zone Soil | MEPLTSVNCSAIECTSLSTSAPIWQDILAQAMTGELLAAMNYTSLSE |
| Ga0099793_104632232 | 3300007258 | Vadose Zone Soil | MEPLIDVNASPIECTSLSPNAPIWQDILAQAVTGELLAAMNYASLSEI |
| Ga0099828_111477781 | 3300009089 | Vadose Zone Soil | MEPLISVNCSAIECTSLSPSAPIWQDILAQAMTGELLAAMNYTSLS |
| Ga0099792_100749081 | 3300009143 | Vadose Zone Soil | MEPLIGVNRSAIECISLSTSAPIWQDILAQAMTGELLAAMNYTS |
| Ga0116117_10985932 | 3300009635 | Peatland | MESLIGINSSTIECTSVSPHAPIWQDILAQAVTGELLAAMNYASLAEICD |
| Ga0116224_104716231 | 3300009683 | Peatlands Soil | METLIGLNCSAVECTALSPSAPIWQDVLAQAMTGELIAAMNY |
| Ga0126374_105401861 | 3300009792 | Tropical Forest Soil | MEPVIGISSQGIECTSLSCSAPIWQDILAQAVTGELLAAM |
| Ga0134086_103941642 | 3300010323 | Grasslands Soil | MEHVACLDPSPTECTSPSSSAPIWQDVLAHAMTGELLAAMNY |
| Ga0074045_103965671 | 3300010341 | Bog Forest Soil | MEPVITLDRSPATECTSHSPTAPIWQDVLSQAMTGELIAAM |
| Ga0126370_101543921 | 3300010358 | Tropical Forest Soil | MEPVIALNSTAIECTSPSPSAPIWQDVLAQAMTGELIAAMNYASLSEICE |
| Ga0126370_105809712 | 3300010358 | Tropical Forest Soil | MEPVIALNSIAIECTSSLPSAPIWQDVLAQAMTGELIAAMNYASL |
| Ga0126372_124196671 | 3300010360 | Tropical Forest Soil | MEPLIGLTSLAAECTSLSCSAPIWQDILAQAVTGELLAAMNYTS |
| Ga0126378_127281302 | 3300010361 | Tropical Forest Soil | MEPVIGISSQGIECTSLSCSAPIWQDILAQAVTGELLAAMNY |
| Ga0126361_110874791 | 3300010876 | Boreal Forest Soil | MESVTVLNSAIERTTLSPTALIWQDVLAQAMTGELMAAMNYTSLSEIC |
| Ga0126350_119646052 | 3300010880 | Boreal Forest Soil | MESVTVLNSAIERTTLSPTALIWQDVLAQAMTGELMAAMNYT |
| Ga0137383_111822981 | 3300012199 | Vadose Zone Soil | MEPLIDVNCSPMECPSLSPSAPIWQDILAQAMTGELLAAMNYTSLSEI |
| Ga0137383_112720052 | 3300012199 | Vadose Zone Soil | MEPLIDVNCSPMECTSLPPRAPIWQDILAQAMTGELLAAMNYTSLSEIC |
| Ga0137382_109578151 | 3300012200 | Vadose Zone Soil | MEPLTSVNCSAIECTSLSTSAPIWQDILAQAMTGELLAAMNYTSLSEM |
| Ga0137362_103001211 | 3300012205 | Vadose Zone Soil | MEPLIDVNRSPMECTSLLPSAPIWQDILAQAMTGELLAAMNYTSLSEICD |
| Ga0137362_111123461 | 3300012205 | Vadose Zone Soil | MEPLIDVNASPLQCTSLSPNAPIWQDILAQAMTGEIL |
| Ga0137370_108933542 | 3300012285 | Vadose Zone Soil | MEPLIGVNCSAIECSSTGAPIWRDILAQAMTGELLAAMNYTSLSEMCEDP |
| Ga0137372_104610191 | 3300012350 | Vadose Zone Soil | MKPLVALDCSAIECTSLSPTAPIWQDILAQAMTGELLAA |
| Ga0137384_113683391 | 3300012357 | Vadose Zone Soil | MEPVISLNSSAIQCTSLSSSAPIWQDVLAQAITGELL |
| Ga0137360_106031402 | 3300012361 | Vadose Zone Soil | METLIGLNCSTIECTSLSPSAPIWQDVLAQAMTGELVAAMNYASLSEICDD |
| Ga0137361_114690861 | 3300012362 | Vadose Zone Soil | MEPLIDVNCSTMECTSLSSRAPIWQDILAQAMTGELLAAMNYA |
| Ga0137390_101040985 | 3300012363 | Vadose Zone Soil | MKSLVALDCPAIECASLSPTAPIWQDILAQAMTGEVLAAMN |
| Ga0137373_102004581 | 3300012532 | Vadose Zone Soil | MERVVCLDPSPAECTSVSPTASIWQDVLAHAVTGELRAAMNYTSL |
| Ga0137358_110316741 | 3300012582 | Vadose Zone Soil | MEPLIGVNCSAIECTSLSTSAPIWQDILAQAMTGELLAAMNYTSLSEMCEDPAE |
| Ga0137397_104595811 | 3300012685 | Vadose Zone Soil | MEPLTSVNCSASECTSLSTSAPIWQDILAQAMTGELLAAMNYTSLSEMCEDP |
| Ga0137394_108835882 | 3300012922 | Vadose Zone Soil | MEPLIDVNASPLQCTSPALNAPIWQDILAQAMTGEILAA |
| Ga0182015_107431732 | 3300014495 | Palsa | MESVTVLNSAIERTTLSPTALIWQDVLAQAMTGELMAAMNY |
| Ga0137414_12542356 | 3300015051 | Vadose Zone Soil | MEPLTDVNCSPMECTSLSPSAPIWQDILAQAITGDSSPR* |
| Ga0137420_11039101 | 3300015054 | Vadose Zone Soil | MEPLTSVNCSAIECTSLSTSAPIWQDILAQAMTGELLAASRR* |
| Ga0137420_11119052 | 3300015054 | Vadose Zone Soil | MEPLTSVNCSAIECTSLSTSAPIWQDILAQAMTGELLA |
| Ga0137409_111920452 | 3300015245 | Vadose Zone Soil | METLIAVNCSTTECTSLSPNAPIWQDVLAQAITGELLAAMN |
| Ga0134112_100394851 | 3300017656 | Grasslands Soil | MEPVIGLDCSPMECSALSASAPIWQDVLAQAMTGELLAAMNYASLSEICD |
| Ga0187875_103215701 | 3300018035 | Peatland | MGPLVSVHCSPATACALNSSDAAIWQDVLSQAMTGELIAAMNYTSLAEIWDDPEEVA |
| Ga0187883_102155282 | 3300018037 | Peatland | MGPLVSVHCSPATACALNSSDAAIWQDVLSQAMTGELIAAMNYTSLAEIW |
| Ga0066667_100681421 | 3300018433 | Grasslands Soil | MEPLIDVNYSPMECPSLSPSAPIWQDILAQAMTGELLAAMNYTSLS |
| Ga0193723_11874981 | 3300019879 | Soil | MEPLIDVNCSPIECTSLSPSDPIWQDILAQAITGELLAAMNY |
| Ga0193713_10267833 | 3300019882 | Soil | MEPLIGVNASPMECTSHLSSAPIWQDILAQAMTGEELAAMN |
| Ga0210399_100785855 | 3300020581 | Soil | MEPMISVNSSPTQCTSLSPNAPIWQDILAQAMTGEI |
| Ga0210395_109783411 | 3300020582 | Soil | METLIGLNCSTVECTSPTAPIWQDILAQAVTGELTAA |
| Ga0210404_108459271 | 3300021088 | Soil | MEPVMGISRSPAIGCISSSAPIWQDVLAQAITGELLAAMNYTSLSEI |
| Ga0210405_100988534 | 3300021171 | Soil | MEPMISVNSSPMECSSSFSATAPIWQDILAQAMTGELLAA |
| Ga0210396_100445066 | 3300021180 | Soil | MEPLIDIGYSTMECTPTSPNAPIWQDILAQAITGELLAAMNYASLS |
| Ga0210396_102199031 | 3300021180 | Soil | METLIGLNCSTVECTSPTAPIWQDILAQAVTGELTAAMNY |
| Ga0210393_105309281 | 3300021401 | Soil | METVNVLSCPTTIECTSLSPSALIWQDVLAQAMTGELI |
| Ga0210397_105065211 | 3300021403 | Soil | METLIGLNCSTVECTSPTAPIWQDILAQAVTGELM |
| Ga0210389_112984101 | 3300021404 | Soil | MEPLIDVKASPTECTSRSASAPIWQDILAQAMTGEVLAAMNYTSLSQICD |
| Ga0210387_105905333 | 3300021405 | Soil | METLIGLNCSTVECTSPTAPIWQDILAQAVTGELTAAMNYASLS |
| Ga0210394_107353321 | 3300021420 | Soil | METVIVLNSATACTSLSPSAAIWQDVLAQAMTGELIAAMNYTSLAE |
| Ga0210394_114170812 | 3300021420 | Soil | METVIALNSASACTSLSPSAAIWQDVLAQAMTGELIAAMNYTSLAEICE |
| Ga0210384_113073952 | 3300021432 | Soil | MEPLIGVNCSAIECSSLSTSAPIWQDILAQAMTGELLAAMN |
| Ga0210384_114828912 | 3300021432 | Soil | MESLVNVNCSTIECTSLSPNAPIWQDVLAQAMTGELIAAMNYASLSE |
| Ga0210391_103345661 | 3300021433 | Soil | MEPVIRVNESLSNECTSSVLSAPIWQDVLAQAMTGELIAAMNYT |
| Ga0210390_111854351 | 3300021474 | Soil | METLIGLNCSSTECNSLSPSAPIWQDVLAQAMTGELI |
| Ga0210392_100041343 | 3300021475 | Soil | MEPVIGLNCPQMIEYTSPSPNAPIWQDILAQAMTGPER |
| Ga0210409_116322412 | 3300021559 | Soil | MGTLIDVNCSTTECTSLSSTSLSPNTPIWQDVLAQAITGELLAAMNYTS |
| Ga0126371_126788181 | 3300021560 | Tropical Forest Soil | MEPVIGVSSQGMECTSLSCSAPIWQDILAQAVTGELLAAMNYTSLSEI |
| Ga0212123_1000372436 | 3300022557 | Iron-Sulfur Acid Spring | MEPVASPNCFAHECLSLLPSAPIWQDVLAQAVTGELLAAMNYTALAEMDCFAT |
| Ga0212123_100290991 | 3300022557 | Iron-Sulfur Acid Spring | MEPMISVNSSPTECTSLPTTAPIWQDILAQAMTGELLAAMNYASL |
| Ga0247694_10369462 | 3300024178 | Soil | MEPLIDVNCSPMECTSLSPSAPIWQDILAQAMTGELLAA |
| Ga0247669_10276993 | 3300024182 | Soil | MEPLIDVNCSPMECTSLSPSAPIWQDILAQAMTGELLAAM |
| Ga0247665_10177301 | 3300024219 | Soil | MEPLIDVNCSPMECTSLSPSAPIWQDILAQAMTGELLAAMNYTSLSEMCED |
| Ga0247673_10608942 | 3300024224 | Soil | MDAAVDFAPSPIECTSISLSAPIWQDVLAQAITGELLAAMNYT |
| Ga0179589_102942072 | 3300024288 | Vadose Zone Soil | MEPLIDVNASPIECTSLSLNAPIWQDILAQAMTGELLAAMNYASLSEI |
| Ga0137417_12530042 | 3300024330 | Vadose Zone Soil | MEPLTSVNCSAIECTSLSTSAPIWQDILAQAMTGELLAAMNYTSLSEMCE |
| Ga0137417_14597864 | 3300024330 | Vadose Zone Soil | MEPVIGVNCSAIECTSLRLVLRIWQDILAQAMTGELLAR |
| Ga0209234_12024601 | 3300026295 | Grasslands Soil | MEPLTSVNCSAIECTSLSTSAPIWQDILAQAMTGELLAAMNY |
| Ga0209236_11394952 | 3300026298 | Grasslands Soil | MEPLTSVNCSAIECTSLSTSAPIWQDILAQAMTGELLAAMNYTSLSKMCED |
| Ga0209472_12149471 | 3300026323 | Soil | MEPVISLNSSAIQCTSLSSSAPIWQDVLAQAITGELLAAMNYTSLSEICD |
| Ga0209158_11768401 | 3300026333 | Soil | MEPLIDVNCSAMECTSLLASAPIWQDILAQAMTGEVLA |
| Ga0257158_10205371 | 3300026515 | Soil | MEPLIDVSCSKMECTSLSPSAPIWQDILAQAMTGELLAAMNYASLSEICDD |
| Ga0209808_12895421 | 3300026523 | Soil | MEPVISLNSSAIQCTSLSSSAPIWQDVLAQAITGELLAAMNYT |
| Ga0209805_13136591 | 3300026542 | Soil | MERVACLDPSPMECTPLSSSAPIWQDVLAHAMTGEFLAAMNYASLSEI |
| Ga0179593_12439431 | 3300026555 | Vadose Zone Soil | MEPLFDVNCSPMECTSLSGSAPIWQDILAQAMTGEVLAAMNYTSLS |
| Ga0209116_10786742 | 3300027590 | Forest Soil | METMIALNSATPCTSLSPSAAIWQDVLAQAMTGELIAAMNYTSLAEICD |
| Ga0209733_10942221 | 3300027591 | Forest Soil | MEPLIDVNCSPMECTSLSASAPIWQDILAQAMTGEV |
| Ga0208324_11685411 | 3300027604 | Peatlands Soil | METLIGLNCSTIECTSLSPSAPIWQDVLAQAITGELIAAINYKSLSEICHD |
| Ga0209588_10503413 | 3300027671 | Vadose Zone Soil | MEPLIDVNRSPMECTSLLPSAPIWQDILAQAMTGELLAAMN |
| Ga0208696_10363761 | 3300027696 | Peatlands Soil | METLVGLNCSTVECTSPNAPIWQDILAQAVTGELMAAMNYASLSEICDN |
| Ga0209139_102861123 | 3300027795 | Bog Forest Soil | MEPLVAVNCSPAIECTSLSSSAEIWQDVLSQAMTGELIAALNYTSLAEICDD |
| Ga0209180_104504012 | 3300027846 | Vadose Zone Soil | MEPLIDVNCSPIECTSLSPSAPIWQDILAQAITGELLA |
| Ga0209701_105022141 | 3300027862 | Vadose Zone Soil | MEPLIGVNCSAIECTSLSTSAPIWQDILAQAMTGELLAAMNYTSLSEMCEDP |
| Ga0209167_104597401 | 3300027867 | Surface Soil | MEPVIQMNGSLSNGCASSLLSAPIWQDVLAQAMTGELIAAMNYTSLAEICD |
| Ga0209590_103186084 | 3300027882 | Vadose Zone Soil | MEPLIDVNCSPMECTSLSSSAPIWQDILAQAMTGELLAAMNYTSL |
| Ga0209275_107230021 | 3300027884 | Soil | MEPLTRVTSSAMECTSLSSAPIWQDILAQAMTGELLAAMNYTS |
| Ga0209069_101987571 | 3300027915 | Watersheds | METLIGLNCSTVECNSLSPSAPIWQDVLAQAMTGELIAAMNYT |
| Ga0209168_105982361 | 3300027986 | Surface Soil | MESLVNVNCSTIECTSLSPNAPIWQDVLAQAMTGELIAAMNYAS |
| Ga0302154_100036141 | 3300028882 | Bog | MESVMSSSPAAQPAHLSPTAAIWQDVLAQAMTGELIAAMNYTSLAEICNDPEEVAD |
| Ga0311359_106566593 | 3300029914 | Bog | MESVMSSSPAAQPAHLSPTAAIWQDVLAQAMTGELIAAMNYTSLAEICN |
| Ga0311340_112286552 | 3300029943 | Palsa | METMIALNSATACTSLSPSAAIWQDVLAQAMTGELI |
| Ga0302182_101122721 | 3300030054 | Palsa | MGLAIGLNRSATMECISLSESAPIWQDILAQAMTG |
| Ga0311370_111565942 | 3300030503 | Palsa | METVIAINSAMEGTSLSPSAAIWQDVLAQAITGELLAAMNYTSLAEI |
| Ga0311357_108592352 | 3300030524 | Palsa | MEQVITLNPTIEAPSLSPSAAIWQDVLAQAMTGELI |
| Ga0311355_114660242 | 3300030580 | Palsa | MQAVIALNPAMKSTPLSPSAAIWQDVLSQAMTGELVAALNYTALAGICDDPEEIAD |
| Ga0311356_110781531 | 3300030617 | Palsa | METMIALNSATACTSLSPSAAIWQDVLAQAMTGELIAAMNYTSLAEI |
| Ga0265760_102474891 | 3300031090 | Soil | MEPLITVNCSTIECASLSLGAPIWQDVLAQAMTGELIAAMNYTSLSE |
| Ga0302325_103747814 | 3300031234 | Palsa | MQTVISLNSVIECTSLSPSAAIWQDILAQAMTGELIAAMNYTSLAEMCD |
| Ga0302324_1016430833 | 3300031236 | Palsa | MQTLTNCLTIECTSPTAPIWQDILAQAVTGELMAAMNYASLSEICD |
| Ga0302324_1023785821 | 3300031236 | Palsa | MEPLIGFDCSTIECSSLSPSAPIWQDILAQAMTGELVAAMNYTS |
| Ga0170818_1155843381 | 3300031474 | Forest Soil | MEPATRFKATTIECTALSSSAAIWQDILAQAMTGELLAAMNYTSLSAICDDP |
| Ga0302326_108042182 | 3300031525 | Palsa | MEPVIALNRPEAIGCTSLSPNASIWQDVLAQAMTGELVAAM |
| Ga0302326_110824261 | 3300031525 | Palsa | MEAVTNRSAAEATFLSPATAIWQDVLAQAMTGELIAVLNYTSLAEICDDPEEVA |
| Ga0318542_105040472 | 3300031668 | Soil | MEPLGDLNRSVSECTSLSPSASIWQDVLAQAMTGELVAVMNYTA |
| Ga0310686_1036504962 | 3300031708 | Soil | MEPVIVECARGIENNSLSPSAPIWRDVLAQAITGELLAAMNYESLS |
| Ga0310686_1048104632 | 3300031708 | Soil | MESVITLNSATACTSLSPSAAIWQDVLAQAMTGELIAAMNYTSLA |
| Ga0306917_101889703 | 3300031719 | Soil | MEPVIGVSSQGIECTSLSCSAPIWQDILAQAVTGELLAAMNY |
| Ga0307469_112549942 | 3300031720 | Hardwood Forest Soil | MEPLIDVNCSAIECTSLSTSAPIWQDILAQAMTGE |
| Ga0307469_122052472 | 3300031720 | Hardwood Forest Soil | MEPLIDVNCSPMECTSLSPSAPIWQDILAQAMTGELL |
| Ga0318502_109016651 | 3300031747 | Soil | MEPLIGLTSPAVECTSLSCCAPIWLDILAQAVTGELLAAMNYTSLSEICD |
| Ga0318546_100777223 | 3300031771 | Soil | MEPIILPSCSASEGTSLGSSAPIWQDVLAQAVTGELLAAMNY |
| Ga0318546_103492312 | 3300031771 | Soil | MEPLIGLTSPAVECTSLSCCAPIWRDILAQAVTGEL |
| Ga0318552_104040192 | 3300031782 | Soil | MEPVIGVSSQGIECTSLSCSAPIWQDILAQAVTGELLAAMNYTSLSEICDD |
| Ga0302319_119066211 | 3300031788 | Bog | MESVMSSSPAAQPAHLSPTAAIWQDVLAQAMTGELIAAMNYTSLAEICNDPEEVADA |
| Ga0318529_103637361 | 3300031792 | Soil | MEPVIGVSSQGIECTSLSCSAPIWQDILAQAVTGELLAAMNYTS |
| Ga0318557_103091622 | 3300031795 | Soil | MEPVIGVSSQGIECTSLSCSAPIWQDILAQAVTGEL |
| Ga0307478_101697711 | 3300031823 | Hardwood Forest Soil | METLVGINCSTVECTSLSPTAPIWQDVLAQAMTGELIAAMNY |
| Ga0307478_105554081 | 3300031823 | Hardwood Forest Soil | MESAIGVDRSLAMERPSLSLSAPIWQDVLAQAMTGELIAAMNYTSLSQICD |
| Ga0307478_112171942 | 3300031823 | Hardwood Forest Soil | MEPAIVECARGIENNSLSPSAPIWQDVLAQAITGELLAAMNYE |
| Ga0318544_103815881 | 3300031880 | Soil | MEPLGDLNRSVSECTSLSPSASIWQDVLAQAMTGELVAVMNYT |
| Ga0306925_111420981 | 3300031890 | Soil | MEPVIGVSSQGIECTSLSCSAPIWQDILAQAVTGELLA |
| Ga0306923_101581671 | 3300031910 | Soil | MEPIILPSCSASEGTSLGSSAPIWQDVLAQAVTGEL |
| Ga0307479_109500062 | 3300031962 | Hardwood Forest Soil | MKTEGQIEPVMPINGSPIDRSSLSCHAPIWQDILAQAVTGEQLAAMNYTSLSGI |
| Ga0318505_105053752 | 3300032060 | Soil | MEPIILPSCSASEGTSLGSSAPIWQDVLAQAVTGELLAA |
| ⦗Top⦘ |