NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044118

Metagenome / Metatranscriptome Family F044118

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044118
Family Type Metagenome / Metatranscriptome
Number of Sequences 155
Average Sequence Length 42 residues
Representative Sequence TVDLLLIEVKYYPALRNFFQVVRTGDEEQIVLQPGAASASN
Number of Associated Samples 144
Number of Associated Scaffolds 155

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.74 %
% of genes near scaffold ends (potentially truncated) 86.45 %
% of genes from short scaffolds (< 2000 bps) 72.26 %
Associated GOLD sequencing projects 137
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.742 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(18.064 % of family members)
Environment Ontology (ENVO) Unclassified
(19.355 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.323 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.43%    β-sheet: 0.00%    Coil/Unstructured: 69.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 155 Family Scaffolds
PF12969DUF3857 80.00
PF02416TatA_B_E 1.29
PF00501AMP-binding 0.65
PF13620CarboxypepD_reg 0.65
PF03721UDPG_MGDP_dh_N 0.65
PF028262-Hacid_dh_C 0.65
PF01740STAS 0.65
PF00902TatC 0.65
PF10282Lactonase 0.65
PF09424YqeY 0.65
PF07681DoxX 0.65
PF16881LIAS_N 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 155 Family Scaffolds
COG1826Twin-arginine protein secretion pathway components TatA and TatBIntracellular trafficking, secretion, and vesicular transport [U] 1.29
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.65
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.65
COG0805Twin-arginine protein secretion pathway component TatCIntracellular trafficking, secretion, and vesicular transport [U] 0.65
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.65
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.65
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.65
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.65
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.74 %
UnclassifiedrootN/A12.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886011|MRS1b_contig_4396258All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300001166|JGI12694J13545_1021173All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300001471|JGI12712J15308_10062127All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300001990|JGI24737J22298_10207674All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300002907|JGI25613J43889_10011642All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2443Open in IMG/M
3300004152|Ga0062386_100405209All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1098Open in IMG/M
3300005171|Ga0066677_10062766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1890Open in IMG/M
3300005176|Ga0066679_10298311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1047Open in IMG/M
3300005178|Ga0066688_10624089All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300005181|Ga0066678_10531310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae781Open in IMG/M
3300005340|Ga0070689_100052778All Organisms → cellular organisms → Bacteria3145Open in IMG/M
3300005435|Ga0070714_102398583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae512Open in IMG/M
3300005459|Ga0068867_101036953All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae746Open in IMG/M
3300005538|Ga0070731_10376392All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae943Open in IMG/M
3300005557|Ga0066704_10313390All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300005559|Ga0066700_11101084All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter519Open in IMG/M
3300005568|Ga0066703_10038212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_62631Open in IMG/M
3300005591|Ga0070761_10013353All Organisms → cellular organisms → Bacteria4596Open in IMG/M
3300005602|Ga0070762_10836403All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300006173|Ga0070716_100082582All Organisms → cellular organisms → Bacteria1922Open in IMG/M
3300006804|Ga0079221_11724297All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300006854|Ga0075425_103158921All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300007258|Ga0099793_10038395All Organisms → cellular organisms → Bacteria2070Open in IMG/M
3300007265|Ga0099794_10196725All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300009088|Ga0099830_10606685All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300009523|Ga0116221_1019601All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3582Open in IMG/M
3300009636|Ga0116112_1084931All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300009643|Ga0116110_1044449All Organisms → cellular organisms → Bacteria1613Open in IMG/M
3300010048|Ga0126373_11099473All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300010343|Ga0074044_10871383All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300010359|Ga0126376_12830672All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300010398|Ga0126383_11058443All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300010400|Ga0134122_10053886All Organisms → cellular organisms → Bacteria → Acidobacteria3094Open in IMG/M
3300011120|Ga0150983_13335524All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300011269|Ga0137392_10700279All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300011271|Ga0137393_10037143All Organisms → cellular organisms → Bacteria3732Open in IMG/M
3300011271|Ga0137393_10382757All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300012200|Ga0137382_10316096All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300012202|Ga0137363_10081763All Organisms → cellular organisms → Bacteria2408Open in IMG/M
3300012207|Ga0137381_11609963All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300012210|Ga0137378_10940322All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300012685|Ga0137397_10011557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6159Open in IMG/M
3300012929|Ga0137404_11662239All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300013100|Ga0157373_10223823All Organisms → cellular organisms → Bacteria1328Open in IMG/M
3300014325|Ga0163163_10512116All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300014658|Ga0181519_10094127All Organisms → cellular organisms → Bacteria1943Open in IMG/M
3300015054|Ga0137420_1225548All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300015241|Ga0137418_10375841All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300017823|Ga0187818_10289396All Organisms → cellular organisms → Bacteria → Acidobacteria719Open in IMG/M
3300017933|Ga0187801_10263660All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300017943|Ga0187819_10748236All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300017955|Ga0187817_10179470All Organisms → cellular organisms → Bacteria1348Open in IMG/M
3300017970|Ga0187783_10058383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2845Open in IMG/M
3300017973|Ga0187780_10482176All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300017975|Ga0187782_11264129All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300018016|Ga0187880_1056808All Organisms → cellular organisms → Bacteria2064Open in IMG/M
3300018018|Ga0187886_1084695All Organisms → cellular organisms → Bacteria1356Open in IMG/M
3300018035|Ga0187875_10171329All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300018035|Ga0187875_10651507All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300018057|Ga0187858_10188432All Organisms → cellular organisms → Bacteria1353Open in IMG/M
3300018085|Ga0187772_10718513All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300018088|Ga0187771_11000633All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300018090|Ga0187770_11310489All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300019256|Ga0181508_1627487All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300020140|Ga0179590_1090020All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300020580|Ga0210403_10130497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2049Open in IMG/M
3300020581|Ga0210399_10899063All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300021171|Ga0210405_10188387All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_61636Open in IMG/M
3300021171|Ga0210405_10861132All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300021178|Ga0210408_10178967All Organisms → cellular organisms → Bacteria1684Open in IMG/M
3300021178|Ga0210408_10333415All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300021180|Ga0210396_10062556All Organisms → cellular organisms → Bacteria3394Open in IMG/M
3300021181|Ga0210388_10400915All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300021181|Ga0210388_10451850All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300021344|Ga0193719_10285410All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300021432|Ga0210384_10912882All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300021474|Ga0210390_10061820All Organisms → cellular organisms → Bacteria3087Open in IMG/M
3300021474|Ga0210390_10387795All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300021478|Ga0210402_10487161All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300021478|Ga0210402_10741932All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300021478|Ga0210402_11307768All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300021479|Ga0210410_10083455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2810Open in IMG/M
3300021559|Ga0210409_10279956All Organisms → cellular organisms → Bacteria1506Open in IMG/M
3300021560|Ga0126371_11531037All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300022507|Ga0222729_1049399All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300022522|Ga0242659_1046321All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300022532|Ga0242655_10075333All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300022726|Ga0242654_10269882All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300024225|Ga0224572_1001318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3602Open in IMG/M
3300025315|Ga0207697_10385576All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300025460|Ga0208562_1006495All Organisms → cellular organisms → Bacteria3130Open in IMG/M
3300025915|Ga0207693_11331948All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300025916|Ga0207663_10387849All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300026326|Ga0209801_1082750All Organisms → cellular organisms → Bacteria1406Open in IMG/M
3300026529|Ga0209806_1056858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_61813Open in IMG/M
3300026538|Ga0209056_10256473All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300026540|Ga0209376_1280403All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300026548|Ga0209161_10272832All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300026557|Ga0179587_10537786All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300027590|Ga0209116_1084357All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300027641|Ga0208827_1053780All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_61334Open in IMG/M
3300027681|Ga0208991_1182140All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300027768|Ga0209772_10178946All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300027853|Ga0209274_10003349All Organisms → cellular organisms → Bacteria → Acidobacteria7698Open in IMG/M
3300028774|Ga0302208_10026675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_61595Open in IMG/M
3300028858|Ga0302216_1011510All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_62321Open in IMG/M
3300029990|Ga0311336_11365342All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300029998|Ga0302271_10009984All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6314Open in IMG/M
3300029999|Ga0311339_11329506All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300030007|Ga0311338_10199245All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_62311Open in IMG/M
3300030057|Ga0302176_10143420All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300030503|Ga0311370_11312694All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300030738|Ga0265462_10459940All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300030740|Ga0265460_10198581All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300030743|Ga0265461_12298054All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300030815|Ga0265746_1035772All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300030836|Ga0265767_103270All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300030991|Ga0073994_10067140All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300031236|Ga0302324_100484657All Organisms → cellular organisms → Bacteria1812Open in IMG/M
3300031236|Ga0302324_101925226All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium745Open in IMG/M
3300031474|Ga0170818_115561104All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300031820|Ga0307473_11003826All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300031938|Ga0308175_100641167All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300031962|Ga0307479_10132639All Organisms → cellular organisms → Bacteria2436Open in IMG/M
3300032515|Ga0348332_12574372All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300032515|Ga0348332_12683467All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300032828|Ga0335080_11334736All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300033004|Ga0335084_12317229All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300033158|Ga0335077_11359513All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300033475|Ga0310811_11290587All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300033545|Ga0316214_1051615All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300033888|Ga0334792_024842All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_62082Open in IMG/M
3300033977|Ga0314861_0261329All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300034091|Ga0326724_0498318All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300034124|Ga0370483_0274464All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300034163|Ga0370515_0240337All Organisms → cellular organisms → Bacteria769Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.06%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.39%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.52%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.23%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.87%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.58%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.94%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.94%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.94%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.94%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.29%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.29%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.29%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.29%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.29%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.29%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.29%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.65%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.65%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.65%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.65%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.65%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.65%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.65%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.65%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886011Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300001166Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001990Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3Host-AssociatedOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028563Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaGHost-AssociatedOpen in IMG/M
3300028774Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3EnvironmentalOpen in IMG/M
3300028858Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_2EnvironmentalOpen in IMG/M
3300029918Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300029998Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030836Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033545Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4Host-AssociatedOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MRS1b_0984.000016402162886011Miscanthus RhizosphereITRKLNMDVLLLEQKYYPALRNFFQLVRTTDEEQILVQPGDTATANR
JGI12694J13545_102117313300001166Forest SoilKLDINFLLLEQKYYMALRNFFQAVRTGDEEQILLQPGTASASN*
JGI12712J15308_1006212713300001471Forest SoilDFLMLEAKYYRALRNFFQIVRNGDEEQVLLQPGTASARN*
JGI24737J22298_1020767413300001990Corn RhizosphereNMDVLLLEQKYYPALRNFFQLVRTTDEEQILVQPGDTATANR*
JGI25613J43889_1001164213300002907Grasslands SoilRRVMVEILLLDPKYYPALRDFFQVVRTGDEEQIVLQPGAANASN*
Ga0062386_10040520913300004152Bog Forest SoilGKLHLARMLNVDFLLLETKYYTALRDFFHTVKTADEEQIVLQPGTATAGK*
Ga0066677_1006276613300005171SoilKLNIDMVFLQQKYYPALRAFFQTVRTGDEEQIVLQPGSATASN*
Ga0066679_1029831113300005176SoilLSRKLNLDLVLLDQKYYATLRNFFQVVRTGDEEQIVLQPMASARN*
Ga0066688_1062408923300005178SoilLDLLLLDQKSYPALRNFFQVVRTGDEEQIVLQPIGATASK*
Ga0066678_1053131023300005181SoilLAIDLLLAEAKYYPAVRNFFQTVRTGDEEQIVLQPGATVSVN*
Ga0070689_10005277813300005340Switchgrass RhizosphereRKLNMDVLLLEQKYYPALRNFFQLVRTTDEEQILVQPGDTATANR*
Ga0070714_10239858323300005435Agricultural SoilKLDLLLLEAKYYPALRNFFQVVRTGDEEQVILQPIGAQASN*
Ga0068867_10103695313300005459Miscanthus RhizosphereLTRNLNVDFLLLDPKYYGALRNFFQVVRTSDEEQIVLQPGTASAAN*
Ga0070731_1037639213300005538Surface SoilFLMLDAKYYGALRNFFEVVRTGDEQQIVLQPGAATASN*
Ga0070732_1082695513300005542Surface SoilTLHLTRQLVWNFLFLDQKYYPALRNFFQTVRTTDEQQIILLPPGTSASN*
Ga0066661_1095121913300005554SoilRSGLTFLEQKYYPALRNFYQAVRTGDEQQIVLQPGASAASK*
Ga0066704_1031339023300005557SoilRKLNLDLVLLDQKYYATLRNFFQVVRTGDEEQIVLQPMASARN*
Ga0066700_1110108423300005559SoilLLLQQKYYMALRNFFQAVRAGDEEQIVLQPGTTTAIN*
Ga0066703_1003821233300005568SoilILLLDQKYYPALRNFFQVVRIGDEEQMLLQPASASARN*
Ga0070761_1001335343300005591SoilLNIDLLILEQKYYAALRNFFQTVRTGDEGQILLQPGTASASN*
Ga0066706_1128670623300005598SoilTFLEQKYYPALRNFYQAVRTGDEQQIVLQPGASAASR*
Ga0070762_1083640313300005602SoilETKYYAALRNFYQGVRTGDEQQVVLSTTASAVQN*
Ga0068852_10125862623300005616Corn RhizosphereVVLLDQRAYPVLRTLFMAVRTGDEEQVVLQPGATTASN*
Ga0070716_10008258223300006173Corn, Switchgrass And Miscanthus RhizosphereLARKLNFDLLILDVKFYPALRNFFQAVRTGDEEQVVLQPGKASASN*
Ga0079221_1172429723300006804Agricultural SoilVLNVDVLLLDSKYYTALRNFFQVVRTGDDEQVVLQPGVASAAN*
Ga0075425_10315892113300006854Populus RhizosphereDVLLLEQKYYPALRNFFQLVRTTDEEQILVQPGDTATANR*
Ga0099793_1003839513300007258Vadose Zone SoilMVEVKLYPTLRNFFQVVRTGDEQQIVLQPGAAAASN*
Ga0099794_1019672513300007265Vadose Zone SoilMDLLLVDQKLYPTLRNFFQVVRSGDEQQIVLQPGAAAASN*
Ga0099830_1060668513300009088Vadose Zone SoilLMLEQKYYPALRSFFQAVRTADEEQIVLQPGAATASN*
Ga0116221_101960113300009523Peatlands SoilLSVDFLILDSKYYLALRNFYQVVRTGDEEQIVLQPGAAKASN*
Ga0116112_108493113300009636PeatlandMLDRKYYTALRNFFQVVRTGDEKQIVLQPGAATASN*
Ga0116110_104444913300009643PeatlandVHVIRKLNVDFLMLDRKYYTALRNFFQVVRTGDEKQIVLQPGAATASN*
Ga0126384_1128168513300010046Tropical Forest SoilLILLDPKYYPTLREFFQIVRKGDEQKIVLQPGAAGSSN*
Ga0126373_1109947313300010048Tropical Forest SoilIDLVILEQKYYPTLRNFFQSVRTGDDEQVVLQPGAAMASN*
Ga0074044_1087138323300010343Bog Forest SoilLRINFLLLEPKYYTALRNFFQTVRTGDEGQILLQPGTASASN*
Ga0126376_1283067223300010359Tropical Forest SoilLILDVKYYPALRNFFQIVRTGDEEQVVLQPGSASASN*
Ga0126383_1105844313300010398Tropical Forest SoilSVRITRQLNMDMLLMEQKYYPALRNFFQLVRTTDEEQILVQPGDTATANR*
Ga0134122_1005388633300010400Terrestrial SoilDPKYYGALRNFFQVVRTSDEEQIVLQPGTASAAN*
Ga0150983_1333552423300011120Forest SoilGAIHVVRKLSFDFLVLEQKYYAALRDFFQAVRTADEEQVLLQPGAANASN*
Ga0137392_1070027923300011269Vadose Zone SoilQLNMDLLMVEVKLYPTLRNFFQVVRTGDEQQVVLQPGATAANN*
Ga0137393_1003714313300011271Vadose Zone SoilDLLMVEVKLYPTLRNFFQVVRTGDEQQIVLQPGAAAASN*
Ga0137393_1038275723300011271Vadose Zone SoilVTVDILMLDTKYYTALRDFFQMVRTSDEAQIVLQPGAATASN*
Ga0137382_1031609613300012200Vadose Zone SoilLTRQLSIDVLILEQKYYTALRNFFQIVRSGDEEQIVLQPGTAAATN*
Ga0137363_1008176333300012202Vadose Zone SoilMLLDQKYYAALRNFFQAVRTGDEEQIVLQPIGATASK*
Ga0137381_1160996313300012207Vadose Zone SoilWLNMDLLMVEVKFYPTLRNFFQVVRTGDEQQIVLQPGAAAASN*
Ga0137378_1094032213300012210Vadose Zone SoilHLTRRLNMDMLTLEQKLYPALRNFFQVVRTGDEQQIVLQPGAAAASN*
Ga0150984_10956048413300012469Avena Fatua RhizosphereVNRKLKVDILLVEQKYYPALRSFFQVVRSGDEEQVLLQPLASTATN*
Ga0137397_1001155773300012685Vadose Zone SoilLLIVEAKLYPTLRNFFQIVRTGDEQQVVLQPGAAAASN*
Ga0137404_1166223913300012929Vadose Zone SoilIDFLFLEQKFYPSLRAFFQTVRTGDDEQIVLQPGSATASN*
Ga0126369_1072432823300012971Tropical Forest SoilRIDVLILDPKYYPALRGFFQIVRKGDEQQVVLLPGGANASN*
Ga0157373_1022382313300013100Corn RhizosphereTLHLTRNLSVDFLLLDPKYYGALRNFFQVVRTSDEEQIVLQPGTASAAN*
Ga0163163_1051211613300014325Switchgrass RhizosphereNNKLHLNRILNVNTALLDQKYYNALRNLFMSVRAGDEQQIVLQPGAATAVN*
Ga0181519_1009412713300014658BogFLILEPKYYPALRNFFQVVRSGDEEQIVLQPGVASARN*
Ga0137420_122554813300015054Vadose Zone SoilMDLLMVEVKLYPTLRNFFQVVRTGDEQQIVLQPGAAAASN*
Ga0137418_1037584113300015241Vadose Zone SoilLHLTRRLKVDVLMLDQKYYPALRTFFQAVRTADEEQIVLQPGAATASN*
Ga0187818_1028939613300017823Freshwater SedimentNQTTLRLGRKLTVDIFLVGTAYYAALRDFFQTVRTGDEQQIVLQPAAAAAGN
Ga0187801_1026366023300017933Freshwater SedimentDFLLLETKYYAALRRFFQIVRTGDEEQIVLQPGSAAASN
Ga0187819_1074823613300017943Freshwater SedimentVLRKLDVDVLLLEPKYYPALRNFFQVVKTGDEEQVLLQPPAASASN
Ga0187817_1017947013300017955Freshwater SedimentNVDFLLLETKYYAALRKFFQIVRTGDEEQIVLRPGSAAASN
Ga0187783_1005838343300017970Tropical PeatlandLTVDFLLLESKYYTALRNFFQVVRTGDEEQIVLQPGNTSASN
Ga0187780_1048217613300017973Tropical PeatlandLSVDILMLETKYYTALRNFFQVVRTGDEQQVLLQPAAASVSN
Ga0187782_1126412913300017975Tropical PeatlandSVNLLMIEAKYYPALRNFFQVVRTGDEQQIILQPNAASGSN
Ga0187880_105680823300018016PeatlandENSSGTVHVIRKLNVDFLMLDRKYYTALRNFFQVVRTGDEKQIVLQPGAATASN
Ga0187886_108469513300018018PeatlandTVHVIRKLNVDFLMLDRKYYTALRNFFQVVRTGDEKQIVLQPGAATASK
Ga0187875_1017132913300018035PeatlandLNVDFLMLDRKYYTALRNFFQVVRTGDEKQIVLQPGAATASN
Ga0187875_1065150713300018035PeatlandTRKLNVDFLLLETKYYPALRNFFQTVRTGDEQQIVLQPGAATASN
Ga0187858_1018843213300018057PeatlandFLLLEQKYYSSLRNFFESVRTGDEEQIVLQPGSATASN
Ga0187772_1071851323300018085Tropical PeatlandRKLTLDFLMLEPKYYTALRNFFQTVRTADGEQIVLQPGEAHASN
Ga0187771_1100063313300018088Tropical PeatlandHLARMLSVNFLLLETKYYTALRDFFQMVKTTDEEQIVLQASRAAASR
Ga0187770_1131048913300018090Tropical PeatlandRKVGMDFLLLEQKYYASLRNFFQTVCANDEQQILLQPGAASTGN
Ga0066667_1000114013300018433Grasslands SoilRSGLTFLEQKYYPALRNFYQAVRTGDEQQIVLQPGASAASK
Ga0066669_1060992813300018482Grasslands SoilGLTFLEQKYYPALRNFYQAVRTGDEQQIVLQPGASAASK
Ga0181508_162748713300019256PeatlandFDFLLLEVKYYASLRNFFQVVRNGDEAQIVLQSGTATASN
Ga0179590_109002023300020140Vadose Zone SoilSDLLMIDAKNYPALRNFYQIVRTGDEEQIILQPVGAQASN
Ga0210407_1021241223300020579SoilMRSDLISLEPKYYPALRNFYQTVRTTDEQQIVLQPGGASSSN
Ga0210403_1013049713300020580SoilLNIDLLILEQKYYMALRNFFQTVRTGDEEQILLQPGTASASN
Ga0210399_1089906313300020581SoilNINFLLLEQKYYTALRNFFQTVRTGDEEQILLQPGTASASN
Ga0210405_1018838723300021171SoilTTRKLTWDFLLIEAKYYPALRNFFQTVRIGDDQQIVLQSAAASAGN
Ga0210405_1086113223300021171SoilKVKVDVLFLETKYYGSLRNFFQVVRTGDEEQVVLQPAAATAGN
Ga0210408_1017896713300021178SoilLETKYYQALRSFFQTVRTGDEQQIIVQPGAAAAHN
Ga0210408_1033341513300021178SoilLMVDTKLYPTLRNFFQVVRTGDEQQIVLQPGVTAAGN
Ga0210396_1006255653300021180SoilVEAKLYPVLRTFFQTVRTGDEEQIIVQPGAAAATNN
Ga0210388_1040091523300021181SoilLHLTRKLNVDFLFLETKYYGALRTFFQVVRTGDEEQIVLQPGAATALN
Ga0210388_1045185013300021181SoilGVLHVTRILNVDFLFLETKYYGALRTFFQAVRTGDEEQIVLQPGSARASN
Ga0193719_1028541013300021344SoilLHWNRRVSLDILMMQTKYYPALRNFFQTVRAGDEQQIVLLPI
Ga0210385_1141396923300021402SoilSDVVMLEPKYYPAVRNFYQAVRTGDEEQIVLQPAASGAGN
Ga0210386_1037486823300021406SoilLEPKYYPAVRNFYQAVRTGDEEQIVLQPAVAGARN
Ga0210384_1091288213300021432SoilVARKLNIDVLLLETKYYPALRKFFQTVRNGDEEQIVLQPAAAAASN
Ga0210390_1006182013300021474SoilTFDFLLLEVKYYASLRNFFQVVRTGDEAQIVLQSGTTTASK
Ga0210390_1038779523300021474SoilTRKLKVDFMILEAKYYPALRSFYELVRTGDEEQIVLQPAAANASN
Ga0210402_1048716123300021478SoilLSVDFLILDQKYYPALRKFFQTVRSEDEQQIVLQPGAATASN
Ga0210402_1074193213300021478SoilNGSVHVVRKLNVDFLLLESKYYGALRNFFQTVRTGDDEQVLLQPGSATASN
Ga0210402_1130776823300021478SoilDFLFLETKYYGALRTFFQVVRSGDEEQIVLQPGAATASN
Ga0210410_1008345513300021479SoilAKNTLRLQRKLSVDFMVLDQKYYPALRHFFQTVRTGDEQQIVLQPL
Ga0210409_1027995623300021559SoilQRKLSVDFLLLDLKYYPALRKFFQTVRTTDEQQIVLQPI
Ga0126371_1153103723300021560Tropical Forest SoilDSAKDSLRMQRKLGVDFLILETKYYPSLQKFFQTVRTQDEQQIVLQPGAATAKN
Ga0222729_104939923300022507SoilFLLLEPKYYPALRNFFQAVRTGDDEQIILQPAAASASN
Ga0242659_104632123300022522SoilLILEQKYYMALRNFFQTVRTGDEEQILLQPGTASASN
Ga0242655_1007533313300022532SoilLLLEPKYYPALRNFFQTVRTGDDEQIILQPAAASASN
Ga0242654_1026988223300022726SoilSLHLTRKMMVDVLLLDTKYYAALRSFFQFVRTGDEEQVVLLPGAASASN
Ga0224572_100131813300024225RhizosphereLEQKYYMALRNFFQTVRTGDEEQILLQPGTASASN
Ga0207697_1038557613300025315Corn, Switchgrass And Miscanthus RhizosphereLNMDVLLLEQKYYPALRNFFQLVRTTDEEQILVQPGDTATANR
Ga0208562_100649513300025460PeatlandHMTRKLTIDFLLLEQNYYLSLRNFFESVRNGDEQQILLQPGTASASN
Ga0207693_1133194813300025915Corn, Switchgrass And Miscanthus RhizosphereNTLHLSRKLSLAFLLLEQKYYTALRNFFQTVRTNDEQQILLQPPPAAAAN
Ga0207663_1038784923300025916Corn, Switchgrass And Miscanthus RhizosphereVRLSRKLSTDLIILDQKYYPALRNFFQAVRTGDEEQIVLQPGGATASN
Ga0209801_108275023300026326SoilVDILLLDTKYYNALRNFFQVVRTGDEEQIVLQPAAATASN
Ga0209806_105685813300026529SoilDILLLDQKYYPALRNFFQVVRIGDEEQMLLQPASASARN
Ga0209056_1025647313300026538SoilLLAEAKYYPAVRNFFQTVRTGDEEQIVLQPGATVSVN
Ga0209376_128040313300026540SoilLLDQKYYPALRNFFQVVRIGDEEQMLLQPASASARN
Ga0209161_1027283223300026548SoilLLLDTKYYNALRNFFQVVRTGDEEQIVLQPAAATASN
Ga0179587_1053778613300026557Vadose Zone SoilDLLNLEQKYYPTLRAIYQTVRTGDEQQVVLRPGGLAAGN
Ga0209116_108435723300027590Forest SoilTRKLTINFLLLDQKYYAALRNFFQTVRTGDEEQILLQPGTASASN
Ga0208827_105378013300027641Peatlands SoilVDFLILDSKYYLALRNFYQVVRTGDEEQIVLQPGAAKASN
Ga0208991_118214013300027681Forest SoilLTRRLNMDLLMVEAKLYPTLRNFFQVVRTGDEQQIVLQPGAAAASN
Ga0209446_103943513300027698Bog Forest SoilRTLDTNFLMLQTQYYSALRNFFQQVRTGDEQQIVLQSGTATANK
Ga0209772_1017894623300027768Bog Forest SoilVDLLQVDVKYYATLRNFFQTVRTGDETQIVLQPGAAAAQN
Ga0209274_1000334953300027853SoilLNIDLLILEQKYYAALRNFFQTVRTGDEGQILLQPGTASASN
Ga0265337_115327323300028556RhizosphereSDVVMLEPKYYPAVRNFYQAVRTSDEEQIVLQPAVTGASN
Ga0265319_128171313300028563RhizosphereVVMLEPKYYPAVRNFYQAVRTSDEEQIVLQPAVTGASN
Ga0302208_1002667513300028774FenRTLSFDVLILEQKYYTALRKFFQAVRTGDEEQIVLQPGTPSALN
Ga0302216_101151023300028858FenHVTRTLSFDVLILEQKYYTALRKFFQVVRTGDDEQIVLQPGTASALN
Ga0302143_105578523300029918BogDVLLLEPKYYPALQSFFQGVRTGDEQQIVLQPGTATAAK
Ga0311336_1136534223300029990FenLTRKLNVDVLLLEQKYYGALRNFFQVVRTGDEEQIVLQPGTTSASN
Ga0302271_1000998473300029998BogRTLSFDVLILEQKYYTALRKFFQVVRTGDDEQIVLQPGTASALN
Ga0311339_1132950623300029999PalsaKSLHLSRKLKVDVLLLEPKYYAALRNFFQVVRSGDEEQIVLQPGTATASN
Ga0311338_1019924533300030007PalsaKVTVDFLMIDAKYYLALRNFFQVVRTGDEEQIVLQPGTASASN
Ga0302176_1014342023300030057PalsaVDFTMLELKYYPALRNFFEVVRAGDGQQIVLQPGEVHAGN
Ga0311370_1131269423300030503PalsaVDFLMLERKYYGPLRTFFQVVRTGDEEQVLLQPATAKASN
Ga0302275_1040330323300030518BogLLLEPKYYPALQSFFQGVRTGDEQQIVLQPGTATAAK
Ga0265462_1045994033300030738SoilLLEQNYYLSLRNFFESVRNGDEQQILLQPGTASASN
Ga0265460_1019858123300030740SoilRKLKVDFMILDSKYYGALRNFFQAVRSADEDQIVLQPGSATASN
Ga0265461_1229805413300030743SoilGTVRVTRKLNIDLLILEQKYYMALRNFFQTVRTGDEEQILLQPGTASASN
Ga0265746_103577223300030815SoilGLLVVRKLNIDILMLEAKYYGALRNFFQVVRTGDEEQVLLQPGTASARN
Ga0265767_10327013300030836SoilFLLLEQKYYAALRNFFQTVRTGDEEQILLQPGTASASN
Ga0073994_1006714023300030991SoilMDLLMVEAKLYPTLRNFFQVVRTGDEQQIVLQPGVAAAGN
Ga0302324_10048465713300031236PalsaRNLRVDFLLLDPKYYPALRNFFHMVKAGDEEQVVLQPGTASASN
Ga0302324_10192522613300031236PalsaLVDTKFYLPLRSFFQNVRTGDEQQVVLQPVAAVSSN
Ga0302324_10275753523300031236PalsaVDVLLLEPKYYPALQSFFQGVRTGDEQQIVLQPGTATAAK
Ga0170818_11556110413300031474Forest SoilRKLTWDFLLLEAKYYTALRDFFQSVRTGDDQQIVLQPAAASAGN
Ga0307473_1100382623300031820Hardwood Forest SoilLILEQKYYAALRNFFQVVRSGDEEQIVLQPGTTAASN
Ga0308175_10064116713300031938SoilTRKLNIDLMFLQQKYYPALRAFFQTVRTGDEEQIVLQPGSATASN
Ga0306926_1235012123300031954SoilLDVKYYATLRDFFQMVRKGDEQQIVLQPGAARTSN
Ga0307479_1013263913300031962Hardwood Forest SoilLKRELKMDLFMVELKLYPALRNFFQVVRTGDEQQIVLQPGGAAASN
Ga0348332_1257437223300032515Plant LitterHLTRKVTVDFLMIDVKYYPALRNFFQVVRTGDEEQIVLQPGTASATN
Ga0348332_1268346723300032515Plant LitterTVDLLLIEVKYYPALRNFFQVVRTGDEEQIVLQPGAASASN
Ga0335080_1133473623300032828SoilGVVHVTRQLNVDVLLLEQKYYEALRNFFQVVRSGDEEQIVLQPGVATAHN
Ga0335084_1231722913300033004SoilLNSDILLLETKYYLSLRNFFQVVRTGDEQQVLLEPSQASASN
Ga0335077_1135951313300033158SoilRVLDVNFVMLDTKYYPALRNFFQQARTNDEQQIVLQQGASSASK
Ga0310811_1129058713300033475SoilTRNLSVDFLLLDPKYYGALRNFFQVVRTSDEEQIVLQPGTASAAN
Ga0316214_105161513300033545RootsLLILEQKYYMALRNFFQTVRTGDEEQILLQPGTASASN
Ga0334792_024842_1_1203300033888SoilNVLMLETKYYPTVREFFQKVRTGDEQQVVLQPAATTAIN
Ga0314861_0261329_3_1613300033977PeatlandDKGRLHLARTLNVDFLLLETKYYTALRNFFQVVKTADEEQIVLQPSRASASK
Ga0326724_0498318_2_1603300034091Peat SoilDKAKLHIARTLNVDFLLLETKYYTALRNFFQMVKTSDEGQIVLQPGRATASK
Ga0370483_0274464_460_5763300034124Untreated Peat SoilMMMLEPKYYTALRNFFQVVRSGDEEQIVLQPGGASASN
Ga0370515_0240337_635_7693300034163Untreated Peat SoilRKLTVDFLLLDAKYYMALRNFFQVVRTGDEEQIVLQPGAASASN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.