| Basic Information | |
|---|---|
| Family ID | F044100 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 155 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MRKLEKIQIIKNVGSSWFALGVNVLVGVFLSPFILHRLGD |
| Number of Associated Samples | 141 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 53.55 % |
| % of genes near scaffold ends (potentially truncated) | 99.35 % |
| % of genes from short scaffolds (< 2000 bps) | 91.61 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.194 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.613 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.290 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.484 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF00685 | Sulfotransfer_1 | 29.68 |
| PF00975 | Thioesterase | 5.16 |
| PF01648 | ACPS | 5.16 |
| PF13193 | AMP-binding_C | 3.87 |
| PF13480 | Acetyltransf_6 | 2.58 |
| PF00719 | Pyrophosphatase | 1.94 |
| PF00535 | Glycos_transf_2 | 1.94 |
| PF01527 | HTH_Tnp_1 | 1.94 |
| PF00459 | Inositol_P | 1.94 |
| PF13231 | PMT_2 | 1.29 |
| PF01370 | Epimerase | 1.29 |
| PF02811 | PHP | 1.29 |
| PF00903 | Glyoxalase | 0.65 |
| PF01636 | APH | 0.65 |
| PF01451 | LMWPc | 0.65 |
| PF13620 | CarboxypepD_reg | 0.65 |
| PF01694 | Rhomboid | 0.65 |
| PF02369 | Big_1 | 0.65 |
| PF04456 | DUF503 | 0.65 |
| PF00668 | Condensation | 0.65 |
| PF06528 | Phage_P2_GpE | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 1.94 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG1020 | EntF, seryl-AMP synthase component of non-ribosomal peptide synthetase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
| COG1550 | Stress-induced protein YlxP, DUF503 family | Function unknown [S] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.19 % |
| Unclassified | root | N/A | 5.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12760266 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 849 | Open in IMG/M |
| 3300000789|JGI1027J11758_12792091 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300000955|JGI1027J12803_109348430 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300001177|JGI12634J13548_1006363 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300001356|JGI12269J14319_10334129 | Not Available | 537 | Open in IMG/M |
| 3300004152|Ga0062386_100696998 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300005435|Ga0070714_102259894 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005451|Ga0066681_10521168 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005553|Ga0066695_10555045 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005555|Ga0066692_10023162 | All Organisms → cellular organisms → Bacteria | 3185 | Open in IMG/M |
| 3300005558|Ga0066698_10366108 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300005576|Ga0066708_10923422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300005598|Ga0066706_11527720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300005712|Ga0070764_10904484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300005764|Ga0066903_107236464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300005994|Ga0066789_10481010 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005995|Ga0066790_10534269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300006032|Ga0066696_10992523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300006052|Ga0075029_100005451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7044 | Open in IMG/M |
| 3300006052|Ga0075029_101173277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300006173|Ga0070716_100941528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300006174|Ga0075014_100474885 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300006175|Ga0070712_100117355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1997 | Open in IMG/M |
| 3300006796|Ga0066665_10867375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300006800|Ga0066660_10189868 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300009093|Ga0105240_11780058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300009143|Ga0099792_10447933 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300009143|Ga0099792_10727020 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300009645|Ga0116106_1220669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300009762|Ga0116130_1125874 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300009762|Ga0116130_1304787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300009824|Ga0116219_10396853 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300010301|Ga0134070_10372875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300010359|Ga0126376_10188001 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
| 3300010360|Ga0126372_11016818 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300010361|Ga0126378_11997173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300010373|Ga0134128_11098609 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300010376|Ga0126381_101107929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1144 | Open in IMG/M |
| 3300010398|Ga0126383_12613587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300011120|Ga0150983_15262677 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300012189|Ga0137388_11565997 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012198|Ga0137364_10890025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300012203|Ga0137399_11001271 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012206|Ga0137380_11322681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300012208|Ga0137376_10402570 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300012210|Ga0137378_11708268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300012362|Ga0137361_10471545 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300012363|Ga0137390_10011127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7986 | Open in IMG/M |
| 3300012469|Ga0150984_101352932 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300012923|Ga0137359_11705975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300012929|Ga0137404_11539167 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300014158|Ga0181521_10334823 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300014501|Ga0182024_10329814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2003 | Open in IMG/M |
| 3300014638|Ga0181536_10492989 | Not Available | 534 | Open in IMG/M |
| 3300014654|Ga0181525_10219202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300015242|Ga0137412_10613588 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300015245|Ga0137409_10119289 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2432 | Open in IMG/M |
| 3300015245|Ga0137409_10469556 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300016294|Ga0182041_11513052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300016387|Ga0182040_11837692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300016404|Ga0182037_11239115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300017657|Ga0134074_1066816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1220 | Open in IMG/M |
| 3300017822|Ga0187802_10302663 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300017931|Ga0187877_1250119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300017942|Ga0187808_10444050 | Not Available | 596 | Open in IMG/M |
| 3300018019|Ga0187874_10011894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4957 | Open in IMG/M |
| 3300018020|Ga0187861_10429356 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300018024|Ga0187881_10139415 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300018026|Ga0187857_10303422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300018038|Ga0187855_10597714 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300018040|Ga0187862_10426879 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300018043|Ga0187887_10526331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300018062|Ga0187784_10030004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4394 | Open in IMG/M |
| 3300018062|Ga0187784_10659281 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300018064|Ga0187773_10256415 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300018085|Ga0187772_10317773 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300018085|Ga0187772_11102919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300018468|Ga0066662_11401394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300018468|Ga0066662_12666400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300019888|Ga0193751_1273574 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300020579|Ga0210407_10197091 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300020581|Ga0210399_11321626 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300021170|Ga0210400_10125928 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
| 3300021170|Ga0210400_10460353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1049 | Open in IMG/M |
| 3300021178|Ga0210408_10522424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300021181|Ga0210388_10619985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300021401|Ga0210393_10018793 | All Organisms → cellular organisms → Bacteria | 5355 | Open in IMG/M |
| 3300021420|Ga0210394_10278094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1467 | Open in IMG/M |
| 3300021420|Ga0210394_11523742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300021432|Ga0210384_11195295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300021477|Ga0210398_11117856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300021479|Ga0210410_10594678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
| 3300021479|Ga0210410_11333156 | Not Available | 610 | Open in IMG/M |
| 3300021559|Ga0210409_10875236 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300021861|Ga0213853_10500953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300022724|Ga0242665_10019733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1533 | Open in IMG/M |
| 3300024295|Ga0224556_1118708 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 647 | Open in IMG/M |
| 3300025442|Ga0208034_1037667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1098 | Open in IMG/M |
| 3300025581|Ga0208355_1131723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300025910|Ga0207684_11259794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300025922|Ga0207646_11633826 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300025928|Ga0207700_10744557 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300025949|Ga0207667_11386268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300026295|Ga0209234_1296343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300026307|Ga0209469_1152839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300026314|Ga0209268_1154108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300026328|Ga0209802_1015691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4297 | Open in IMG/M |
| 3300026329|Ga0209375_1179492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300026377|Ga0257171_1049937 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300026514|Ga0257168_1095787 | Not Available | 660 | Open in IMG/M |
| 3300026537|Ga0209157_1176660 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300026552|Ga0209577_10171854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1687 | Open in IMG/M |
| 3300026557|Ga0179587_10656924 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300026839|Ga0207764_126199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300027371|Ga0209418_1054420 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300027505|Ga0209218_1118067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300027629|Ga0209422_1107818 | Not Available | 641 | Open in IMG/M |
| 3300027667|Ga0209009_1035315 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300027681|Ga0208991_1230450 | Not Available | 530 | Open in IMG/M |
| 3300027768|Ga0209772_10062128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1121 | Open in IMG/M |
| 3300027842|Ga0209580_10616464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300027905|Ga0209415_10415878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1077 | Open in IMG/M |
| 3300027905|Ga0209415_10921665 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300027908|Ga0209006_11304536 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300028572|Ga0302152_10185551 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300028654|Ga0265322_10215144 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300028798|Ga0302222_10088373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1239 | Open in IMG/M |
| 3300028798|Ga0302222_10179211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300028906|Ga0308309_10583946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300030294|Ga0311349_10284586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geothermobacter → Geothermobacter ehrlichii | 1560 | Open in IMG/M |
| 3300030399|Ga0311353_11056557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300030509|Ga0302183_10254815 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300030618|Ga0311354_10390110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1409 | Open in IMG/M |
| 3300030746|Ga0302312_10298734 | Not Available | 606 | Open in IMG/M |
| 3300031231|Ga0170824_105218978 | Not Available | 687 | Open in IMG/M |
| 3300031232|Ga0302323_100440291 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300031249|Ga0265339_10157124 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300031525|Ga0302326_11068095 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300031668|Ga0318542_10140467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1194 | Open in IMG/M |
| 3300031715|Ga0307476_10850813 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 674 | Open in IMG/M |
| 3300031718|Ga0307474_10012075 | All Organisms → cellular organisms → Bacteria | 6260 | Open in IMG/M |
| 3300031720|Ga0307469_10211676 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300031726|Ga0302321_101646104 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300031754|Ga0307475_10221550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1514 | Open in IMG/M |
| 3300031823|Ga0307478_11440295 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300031910|Ga0306923_11118386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300031954|Ga0306926_12996358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300032180|Ga0307471_100274333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1756 | Open in IMG/M |
| 3300032180|Ga0307471_103516985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300032205|Ga0307472_100006092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 5641 | Open in IMG/M |
| 3300032783|Ga0335079_10912156 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300032893|Ga0335069_10658007 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300032895|Ga0335074_10000473 | All Organisms → cellular organisms → Bacteria | 58222 | Open in IMG/M |
| 3300033402|Ga0326728_10362321 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300033433|Ga0326726_11103516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.32% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.16% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.16% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.23% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.23% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.58% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.58% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.94% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.94% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.29% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.29% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.29% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.65% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.65% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.65% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001177 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026839 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_127602661 | 3300000789 | Soil | MKFNKGQILKNVGSSWFALGVNVLVGIFLSPYILHRLGDVAFGLWI |
| JGI1027J11758_127920912 | 3300000789 | Soil | MKFNKRQILENVGSTWFALGLNVVVGIFLSPYILHRLGDDAFGLWI |
| JGI1027J12803_1093484304 | 3300000955 | Soil | MKFNKRQILENVGSTWFALGLNVVVGIFLSPYILHRLGDDAFGLWILI |
| JGI12634J13548_10063632 | 3300001177 | Forest Soil | MRKLEKLQIIKNVGSNWVALATNVLVGIFLSPFILHRLG |
| JGI12269J14319_103341291 | 3300001356 | Peatlands Soil | MRKYEKTQILKNVGSSWSALATNVLVGIFLSPFILH |
| Ga0062386_1006969981 | 3300004152 | Bog Forest Soil | MLKTEIFKNVSASWLSLGTNILVGIFLSPFILHRLGNLAYGAWVLA |
| Ga0070714_1022598943 | 3300005435 | Agricultural Soil | MRRFEKIQFISNVSSSWFALGINVAVGIFLSPFILHRLGDSAFGI |
| Ga0066681_105211682 | 3300005451 | Soil | MKRFDKVQILKNVGSSWFALGLNIVVGIFLSPYILHRLGDDAF |
| Ga0066695_105550452 | 3300005553 | Soil | MRKSEIIKNVSSSWFSLGVNILVGIFLSPFILHRLGNTAYGAW |
| Ga0066692_100231623 | 3300005555 | Soil | MRKFEKLEIIKNVSSSWFGLAVNVLVGIFLSPFILH |
| Ga0066698_103661081 | 3300005558 | Soil | MKKLDKVEILKNVGSSWCALGVNVLVGIFLSPYILHRLGDEAF |
| Ga0066708_109234221 | 3300005576 | Soil | MLRWEKIHIIKNVGSSWFSLGFNIVVGVFLSPFILHRLG |
| Ga0066706_115277201 | 3300005598 | Soil | MKKFNKLEIVKNVSSNWFALGLNVLVGIFLSPYVLHHLGDEAFG |
| Ga0070764_109044842 | 3300005712 | Soil | MKKLDKIALFKNVGSSWFALGVNILVGIFISPYIIHHLGDDAFGLWFLVFSI |
| Ga0066903_1072364642 | 3300005764 | Tropical Forest Soil | MRRMEIFKNVGSSWFSLTVTILVGIFLSPFILHRL |
| Ga0066789_104810102 | 3300005994 | Soil | MKFNKGQILKNVGSSWFSLGVNVVVGIFLSPFILHRLGDD |
| Ga0066790_105342692 | 3300005995 | Soil | MLKLEKLQILKNVGSTWFSTGINILIGVFLSPFILHR |
| Ga0066696_109925232 | 3300006032 | Soil | MRKWEKIQIVKNVGSSWFALGINVLVGILLWPFVLHRLGDV |
| Ga0075029_1000054518 | 3300006052 | Watersheds | MSRIERLQILKNVSSSWFSLGINILVGIFLSPFILHR |
| Ga0075029_1011732771 | 3300006052 | Watersheds | MSSQKLQIIRNVGSSWSALAVNVAVGVFLSPFILHHLGDAAF |
| Ga0070716_1009415281 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFNKGQILKNVSSSWFSLGVNVVTGFILSPFIVHHLGDE |
| Ga0075014_1004748851 | 3300006174 | Watersheds | MRKSEIIKNVSSSWFSLGINILVGIFLSPFILHRLGN |
| Ga0070712_1001173552 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFNKGQILKNVSSSWFSLGVNVVTGFILSPFIVHHLG |
| Ga0066665_108673751 | 3300006796 | Soil | MKKLDKVEILKNVGSSWFAPGVNVLVGIFLSLYMFHRLGDEAFGLWVLIFSI |
| Ga0066660_101898681 | 3300006800 | Soil | MKRFEKLAVLKNVGSSWSSLGANILVGVFLSPYIVHRLGDEAYG |
| Ga0105240_117800581 | 3300009093 | Corn Rhizosphere | MKFDKRQILRNVGSTWFALGLNVVVGIFLSPFILHRLGDDAFG |
| Ga0099792_104479331 | 3300009143 | Vadose Zone Soil | MRKREKRQILKNVGSSWSALATNVAVGIFLSPFILH |
| Ga0099792_107270202 | 3300009143 | Vadose Zone Soil | MRKLEKGQIIKNISSSWFSLGINIVTGIFLSPFILHHLG |
| Ga0116106_12206691 | 3300009645 | Peatland | MKFDKRQILRNVGSSWFALGVNVLVGIFLSPYILHRLGDEAFGLWIL |
| Ga0116130_11258741 | 3300009762 | Peatland | MKFDKRQILKNVGSSWFALGVNVLVGIFLSPYILHRL |
| Ga0116130_13047871 | 3300009762 | Peatland | MKFDKRQILRNVGSSWFALGVNVLVGIFLSPYILHRL |
| Ga0116219_103968531 | 3300009824 | Peatlands Soil | MRKYEKTQILKNVGSSWSALATNVLVGIFLSPFILHRLGDAAFG |
| Ga0134070_103728751 | 3300010301 | Grasslands Soil | MKRFEKLAVLKNVGSSWSSLGANILVGVFLSPYIVHRLG |
| Ga0126376_101880011 | 3300010359 | Tropical Forest Soil | MRRIEILKNVTSSWFSLGVNILVGIFLSPYTLHRLGDTAYGI |
| Ga0126372_110168181 | 3300010360 | Tropical Forest Soil | LGIDLGTTMRKREIIKNVTSVWFSLGVNVLVGIFLSP |
| Ga0126378_119971731 | 3300010361 | Tropical Forest Soil | MRKHEKIRILKNVGSSWISLAVNIATGLILSPFILHR |
| Ga0134128_110986091 | 3300010373 | Terrestrial Soil | MRKFEKMQFINNVGSSWFALGINVSVGVFLTPFILHRLGD |
| Ga0126381_1011079291 | 3300010376 | Tropical Forest Soil | MKTFSKAELLKNVGSSWFALGINVLVGIFISPYILHRLGDDAFGLWVLIFSVTG |
| Ga0126383_126135872 | 3300010398 | Tropical Forest Soil | MSLKTQALKNVGSSWFGLAVNMLVGFFLSPFILHRL |
| Ga0150983_152626771 | 3300011120 | Forest Soil | MLKFEKTQILKNVGSSWSALATNVLVGIFMSPFILHRLGDAAYGIW |
| Ga0137388_115659971 | 3300012189 | Vadose Zone Soil | MRKREKRQILKNVGSSWSALATNVAVGIFLSPFILHRLGDA |
| Ga0137364_108900251 | 3300012198 | Vadose Zone Soil | MKKFNKLEIVKNVSSNWFALGLNVLVGIFLSPYVLHHLGDEA |
| Ga0137399_110012711 | 3300012203 | Vadose Zone Soil | MLKFEKTQILKNVGSSWSALATNVAVGIFLSPFILH |
| Ga0137380_113226811 | 3300012206 | Vadose Zone Soil | MRRVELVQIVKNVSSSWIALGTNVLVGIFLSPFILHR |
| Ga0137376_104025701 | 3300012208 | Vadose Zone Soil | MLKLEKLQFIKNVSSNGVALAVNVLVGIFLSPYILHRLGDSA |
| Ga0137378_117082681 | 3300012210 | Vadose Zone Soil | MKKLDKVEILKNVGSSWCALGVNVLVGIFLSPYILHRLGDEAFGLWVLIFSI |
| Ga0137361_104715451 | 3300012362 | Vadose Zone Soil | MRKLEKLQIIKNVSSNGIALGTNVLVGVFLSPFILHRLG |
| Ga0137390_100111271 | 3300012363 | Vadose Zone Soil | MLKFEKRQILKNVGSSWSALALNVVVGIFLSPFILHHLGDAA |
| Ga0150984_1013529323 | 3300012469 | Avena Fatua Rhizosphere | MQKLEKIQLLKNVGSSWFSLGVNILVGLFLSPYILHRL |
| Ga0137359_117059752 | 3300012923 | Vadose Zone Soil | MRKLEILKNVGSSWVSLGVNIILGLFLSPFILHRLGDDAF |
| Ga0137404_115391671 | 3300012929 | Vadose Zone Soil | MRKFEKGQIIKNISSSWFSLGINIVTGIFLSPFILHHLGDTAFGV |
| Ga0181521_103348231 | 3300014158 | Bog | MRKYEKRQILKNVGSSWSALAVNVLVGIFLSPFILHRLGDV |
| Ga0182024_103298142 | 3300014501 | Permafrost | MRKIEIFKNVGASWLSLGVNILVGIFLSPFILHRLGNLA |
| Ga0181536_104929892 | 3300014638 | Bog | MRKYEKAQILKNVGSSWSALAMNVLVGIFLSPFILHRLGDAA |
| Ga0181525_102192021 | 3300014654 | Bog | MKKTEKRQFLHNVGTSWFSLGTNVLIGIFLSPFILHRIGD |
| Ga0137412_106135883 | 3300015242 | Vadose Zone Soil | MRKLEKGQIIKNISSSWFSLGINIVTGIFLYPFIIHH |
| Ga0137409_101192894 | 3300015245 | Vadose Zone Soil | MRKLEKRQIIKNVTSSWFALGMNVVVGIILWPYILHR |
| Ga0137409_104695562 | 3300015245 | Vadose Zone Soil | MRKLDILKNVGSSWVSLGVNIVIGFFLSPFILHRL |
| Ga0182041_115130521 | 3300016294 | Soil | MKFDKSQILKNVGSSWFALGVSVLVGIFLSPYILHRL |
| Ga0182040_118376922 | 3300016387 | Soil | MKFDKNQILKNIGSSWFSLAVNVVLGIFLSPFILHHLGDD |
| Ga0182037_112391152 | 3300016404 | Soil | MKTFSKAEILKNVGSSWFALGINVLVGIFISPYILHHLGD |
| Ga0134074_10668161 | 3300017657 | Grasslands Soil | MKKLDKVEILKNVGSSWCALGVNVLVGIFLSPYILHRLGDEAFGLWVLIFS |
| Ga0187802_103026632 | 3300017822 | Freshwater Sediment | MRKLELIKNVGSGWFSLGVNILVGIFLSPFILHRLGNTAYG |
| Ga0187877_12501191 | 3300017931 | Peatland | MKFDKRQILKNVGSSWFALGVNVLVGIFLSPYILHRLGDE |
| Ga0187808_104440501 | 3300017942 | Freshwater Sediment | MRKLEKLQIVKNVGSSWASLGVNILVGIFLSPFILH |
| Ga0187874_100118941 | 3300018019 | Peatland | MHAQKLQIIRNVGSSWSALAVNVAVGIFLSPFILHRL |
| Ga0187861_104293561 | 3300018020 | Peatland | MRKYEKKQILKNVGSSWSALAVNVSVGIFLSPFILHRLGDVAFG |
| Ga0187881_101394152 | 3300018024 | Peatland | MRKYEKTQILKNVGSSWSALAMNVLVGIFLSPFILHRLGD |
| Ga0187857_103034221 | 3300018026 | Peatland | MRKLEKIQIIKNVGSSWFALGVNILVGIFLSPFIL |
| Ga0187855_105977141 | 3300018038 | Peatland | MSINKRQIIKNVSSSWFSLGVDVVVGILLYPFILHK |
| Ga0187862_104268791 | 3300018040 | Peatland | MRKYEKKQILKNVGSSWSALAVNVSVGIFLSPFILHRLGDV |
| Ga0187887_105263312 | 3300018043 | Peatland | MKFDKRQILRNVGSSWFSLGVNVVVGVFLSPYILHRLGDEAFGLWILIFS |
| Ga0187784_100300045 | 3300018062 | Tropical Peatland | MRKLEKRQILKNVGSSWSALAINVLVGIFLSPFILHRLG |
| Ga0187784_106592812 | 3300018062 | Tropical Peatland | MKKRDKVALFKNVGSSWIALGVNLTVGFFLSPYIIHHLGDTAFGL |
| Ga0187773_102564151 | 3300018064 | Tropical Peatland | MRKFEKGQIIKNISSNWFSLGINVVTGIIVSPFIVHRLGDTANG |
| Ga0187772_103177731 | 3300018085 | Tropical Peatland | MRRFEKLQIIKNVSSSWFALGVNILVGVFLSPFILHRL |
| Ga0187772_111029192 | 3300018085 | Tropical Peatland | MRKLEKIQIIKNVGSSWVALAVNIVVGIFLSPFILHRL |
| Ga0066662_114013941 | 3300018468 | Grasslands Soil | MKKLDKVEILKNVGSSWCALGVNILVGIFLSPYILHRLGDEAFGLWVLIF |
| Ga0066662_126664002 | 3300018468 | Grasslands Soil | MKRVDKVALVKNVGSSWFALGINILVGIFLSPYILHRLGDEAFGLWVLIFSI |
| Ga0193751_12735742 | 3300019888 | Soil | MRKLEKRQILKNVGSSWSALATNVAVGIFLSPFILHRLGDAA |
| Ga0210407_101970913 | 3300020579 | Soil | MRKSEIIKNVGSSWFALGVNVVVGIFLSPYILHRLG |
| Ga0210399_113216261 | 3300020581 | Soil | MHKIDKRQIIKNIGSSWFALGVEVTVGIFLSPFILH |
| Ga0210400_101259283 | 3300021170 | Soil | MRYREIVKNVSSSWLSLGVNILVGLFLSPYILHRLGNTS |
| Ga0210400_104603532 | 3300021170 | Soil | MRKLEKIQIIKNVGSSWFALGVNVLVGVFLSPFILHRLGDT |
| Ga0210408_105224242 | 3300021178 | Soil | MRKSEIIKNVGSSWFALGVNVVVGIFLSPYILHRLGDEAF |
| Ga0210388_106199851 | 3300021181 | Soil | MKFNRGQILKNVGSSWFALGVNVLVGIFLSPFILH |
| Ga0210393_100187934 | 3300021401 | Soil | MRFDKTQILRNVGSSWFALGVNVMVGIFLSPYIIHHLGDDAFGLWVI |
| Ga0210394_102780941 | 3300021420 | Soil | MKFNKGQILKNVGSSWFALGVNVMVGIFLSPYILH |
| Ga0210394_115237422 | 3300021420 | Soil | MLKIDKRQILQNIGSSWGALGTNVLIGVFLSPFILHRLGDAAF |
| Ga0210384_111952952 | 3300021432 | Soil | MRKREIIKNVSSSWFSLGVNILVGIFLSPFILHRLGNTAYG |
| Ga0210398_111178562 | 3300021477 | Soil | MRFDKTQILRNVGSSWFALGVNVMVGIFLSPYIIHHLGD |
| Ga0210410_105946782 | 3300021479 | Soil | MRKLEIFKNVGSSWFSLGVNIVVGIFLSPFILHRL |
| Ga0210410_113331562 | 3300021479 | Soil | MLKFEKTQILKNVGSSWSALATNVLVGIFMSPFILH |
| Ga0210409_108752362 | 3300021559 | Soil | MRKLEKMQILTNVGSSWFSLGINVLTGLFLSPFILHRLGDS |
| Ga0213853_105009531 | 3300021861 | Watersheds | MKFNKGQILKNVSSSWFSLGVNVVTGFILSPFIVHHLGDEA |
| Ga0242665_100197333 | 3300022724 | Soil | MRNREIFKNVGSSWFSLGVSILVGVFLSPFILHRLGD |
| Ga0224556_11187081 | 3300024295 | Soil | MKRLDKIAIFKNVGSSWFALGLNILVGLFLSPYILHRLG |
| Ga0208034_10376671 | 3300025442 | Peatland | MHAQKLQIIRNVGSSWSALAVNVLVGIFLSPFILHRLG |
| Ga0208355_11317232 | 3300025581 | Arctic Peat Soil | MKFDKSQILKNVGSSWFALGVNVVVGVFLSPYILHRLGDTAF |
| Ga0207684_112597942 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLKLQAMKNVGSSWFSLGVNVAVGFFLSPFILHRLGDDAF |
| Ga0207646_116338262 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MHKFEKGQIIKNIGSGWFSLGINVLVGVFLSPFILHRLGD |
| Ga0207700_107445572 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKLEKLQIIKNVSSSWISLATNVLVGLFLSPYILHR |
| Ga0207667_113862681 | 3300025949 | Corn Rhizosphere | MRRFEKIQFINNVGSSWFALAINVAVGVFLTPFILH |
| Ga0209234_12963431 | 3300026295 | Grasslands Soil | MKKLDKVEILKNVGSSWCALGVNILVGIFLSPYIL |
| Ga0209469_11528391 | 3300026307 | Soil | MKKLDKVEILKNVGSSWCALGVNVLVGIFLSPYIL |
| Ga0209268_11541081 | 3300026314 | Soil | MKKLDKVEILKNVGSSWCALGVNILVGILLSPYILHRLGDEAFGLWVLIF |
| Ga0209802_10156912 | 3300026328 | Soil | MKKLDKVEILKNVGSSWCALGVNILVGIFLSPYILHRLG |
| Ga0209375_11794922 | 3300026329 | Soil | MKRFEKLAVLKNVGSSWSSLGANILVGVFLSPYIVH |
| Ga0257171_10499371 | 3300026377 | Soil | MLKFEKRQILKNVGSSWSALALNVVVGIFLSPFILHHLGDAAF |
| Ga0257168_10957871 | 3300026514 | Soil | MRTFEKKQILKNVGSSWSALAINVIVGIFLSPFIV |
| Ga0209157_11766602 | 3300026537 | Soil | MRKFEKGQIIKNISSSWFSLGINIVTGIFLSPFILHHLGD |
| Ga0209577_101718541 | 3300026552 | Soil | MKRFEKLAVLKNVGSSWSSLGANILVGVFLSPYIVHRLGDE |
| Ga0179587_106569241 | 3300026557 | Vadose Zone Soil | MRKREKRQILKNVGSSWSALATNVAVGIFLSPFILHR |
| Ga0207764_1261991 | 3300026839 | Tropical Forest Soil | MTKIDKLEILKNAGSSWFALGVTVVVGFFLSPYILHHLGDEAFG |
| Ga0209418_10544202 | 3300027371 | Forest Soil | MRKREIIKNVSSSWFSLGVNILVGIFLSPFILHRLGNTA |
| Ga0209218_11180671 | 3300027505 | Forest Soil | MRKIEVIKNVSASWFALGVSILVGIFLSPFILHRLGNMAYGAWVLAFS |
| Ga0209422_11078181 | 3300027629 | Forest Soil | MRTFEKKQILKNVGSSWSALAINVIVGIFLSPFILHRLGDAAF |
| Ga0209009_10353153 | 3300027667 | Forest Soil | MRKYEKKQILKNVGSSWSALAMNVLVGIFLSPFILH |
| Ga0208991_12304501 | 3300027681 | Forest Soil | MRKYEKKQILKNVGSSWSALGTNVLVGIFLSPLILHR |
| Ga0209772_100621281 | 3300027768 | Bog Forest Soil | MLKLEKRQILKNVGSSWSALGVNVIVGIFLSPFILHHL |
| Ga0209580_106164642 | 3300027842 | Surface Soil | MRNTEIFKNVGSSWFSLGVSILVGVFLSPFILHRL |
| Ga0209415_104158781 | 3300027905 | Peatlands Soil | MLKLEKRQILKNVGSSWSALGINVIVGIFLSPFILHHLGDAAF |
| Ga0209415_109216653 | 3300027905 | Peatlands Soil | MKRLDKVALFKNVGSSWFALGINIFVGILLSPYILHHLGDEAF |
| Ga0209006_113045361 | 3300027908 | Forest Soil | MQKIDKRQIIKNVGSSWFSLGINVVLGLALSPFIVH |
| Ga0302152_101855512 | 3300028572 | Bog | MKKLEKLAILKNLGSSWFALGINILVGIFLSPYILHHLGDDA |
| Ga0265322_102151442 | 3300028654 | Rhizosphere | LRKYEERTGMKIQKSQIVKNVGSSWVALAVNVLVGILLSPFIVHRLGDA |
| Ga0302222_100883731 | 3300028798 | Palsa | MRKFERTQILKNIGSSWSALGTNVLVGIFLSPVILHRLGDAAY |
| Ga0302222_101792111 | 3300028798 | Palsa | MKKLDKIAIFKNVGSSWFALGFNILAGLFLSPYILHHLGDDAF |
| Ga0308309_105839462 | 3300028906 | Soil | MRFDKTQILRNVGSSWFALGVNVMVGIFLSPYIIHHLGDDAFGLWVIIFSVT |
| Ga0311349_102845861 | 3300030294 | Fen | MRKFEKGQIIKNISSSWFSLGINIVTGIFLSPFILHHL |
| Ga0311353_110565572 | 3300030399 | Palsa | MRKYEKTQILKNVGSSWSALGINVIVGVFLSPFILHRLGDAAF |
| Ga0302183_102548151 | 3300030509 | Palsa | MHKFERRQIIKNIGSSWFALGVNIVIGIFLSPFIL |
| Ga0311354_103901103 | 3300030618 | Palsa | MRKIEIIKNVSASWFALGVSILVGLFLSPFILHRLGNMAYGA |
| Ga0302312_102987342 | 3300030746 | Palsa | MKKLDKIALFKNVGSSWFALGVNILVGIFISPYIIHHLGDDAFGLWFL |
| Ga0170824_1052189782 | 3300031231 | Forest Soil | MRKLEKKQILKNVGSSWSALAINVIVGIFLSPFIVHRLGDAA |
| Ga0302323_1004402912 | 3300031232 | Fen | MLKLEKRQILKNVGSSWFALAINVIVGIFLSPFILHHLGDA |
| Ga0265339_101571241 | 3300031249 | Rhizosphere | MRKLEKIRVMKNVGSSWFSLGVNVLVGIFLSPFIMHRLG |
| Ga0302326_110680952 | 3300031525 | Palsa | MLKLERNQIIKNVGSSWFALGVNILVGIFLSPFILHRLGDAA |
| Ga0318542_101404672 | 3300031668 | Soil | MRRAEIIKNVGSSWFSLGTSILVGIFLSPFILHRLGD |
| Ga0307476_108508132 | 3300031715 | Hardwood Forest Soil | MKRIEKIALFKNVGSSWFALGINVLAGIFLSPYILHHLGD |
| Ga0307474_100120751 | 3300031718 | Hardwood Forest Soil | MRFDKTQILRNVGSSWFALGVNVMVGIFLSPYIIHHLG |
| Ga0307469_102116763 | 3300031720 | Hardwood Forest Soil | MKKVEKLEILKNVGSSWFALGINVLVGLFLSPYILHRLG |
| Ga0302321_1016461042 | 3300031726 | Fen | MKLDKSQILKNVGSSWFALGINVLVGIFLSPFILHRLGDTA |
| Ga0307475_102215501 | 3300031754 | Hardwood Forest Soil | MSKRQIIKNVGASWFSLGVSVLVGIFLSPFILHRLGD |
| Ga0307478_114402951 | 3300031823 | Hardwood Forest Soil | MRKLEKIQIIKNVGSSWFALGVNVLVGVFLSPFILHRLGD |
| Ga0306923_111183862 | 3300031910 | Soil | MKFDKNQILKNIGSSWFSLAVNVVLGIFLSPFILHHLGDDAF |
| Ga0306926_129963581 | 3300031954 | Soil | MRKPEILKIIKNVGSSWFSLGANIVVGIFLSPFILHH |
| Ga0307471_1002743332 | 3300032180 | Hardwood Forest Soil | MKFNKGQIFEIGSSWFSLGMNVVSGIFLSPFILRRLGDEAFGLRVLIFSIAGSHFLLPSQ |
| Ga0307471_1035169851 | 3300032180 | Hardwood Forest Soil | MKFNKGQILKNVSSSWFSLGVNVVTGFILSPFIVHHLGDAAF |
| Ga0307472_1000060921 | 3300032205 | Hardwood Forest Soil | MKRFDKVQILKNVGSSWFALGLNIVVGIFLSPYILHRLGD |
| Ga0335079_109121562 | 3300032783 | Soil | MRRTERLQIIRNVGSSWFALGVNILVGLVLSPLILHRLGDA |
| Ga0335069_106580072 | 3300032893 | Soil | MRKLELHIIKNVGSSWFSLGVNILVGIFLSPFILHRLGDSAF |
| Ga0335074_100004731 | 3300032895 | Soil | VRKLEKLQLFKNVSSTWLMLAVNILIGVFLAPFIL |
| Ga0326728_103623211 | 3300033402 | Peat Soil | MKFDKNQILKNVGSSWFALGVNVLVGIFLSPYILHRLGDEAFGLWILIFSATGY |
| Ga0326726_111035162 | 3300033433 | Peat Soil | MKKLEKLQILKNVGSSWFGLGVNVIVGLFLSPYILHHLGDEA |
| ⦗Top⦘ |