NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044100

Metagenome / Metatranscriptome Family F044100

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044100
Family Type Metagenome / Metatranscriptome
Number of Sequences 155
Average Sequence Length 40 residues
Representative Sequence MRKLEKIQIIKNVGSSWFALGVNVLVGVFLSPFILHRLGD
Number of Associated Samples 141
Number of Associated Scaffolds 155

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 53.55 %
% of genes near scaffold ends (potentially truncated) 99.35 %
% of genes from short scaffolds (< 2000 bps) 91.61 %
Associated GOLD sequencing projects 137
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.194 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.613 % of family members)
Environment Ontology (ENVO) Unclassified
(21.290 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.484 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 54.41%    β-sheet: 0.00%    Coil/Unstructured: 45.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 155 Family Scaffolds
PF00685Sulfotransfer_1 29.68
PF00975Thioesterase 5.16
PF01648ACPS 5.16
PF13193AMP-binding_C 3.87
PF13480Acetyltransf_6 2.58
PF00719Pyrophosphatase 1.94
PF00535Glycos_transf_2 1.94
PF01527HTH_Tnp_1 1.94
PF00459Inositol_P 1.94
PF13231PMT_2 1.29
PF01370Epimerase 1.29
PF02811PHP 1.29
PF00903Glyoxalase 0.65
PF01636APH 0.65
PF01451LMWPc 0.65
PF13620CarboxypepD_reg 0.65
PF01694Rhomboid 0.65
PF02369Big_1 0.65
PF04456DUF503 0.65
PF00668Condensation 0.65
PF06528Phage_P2_GpE 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 155 Family Scaffolds
COG0221Inorganic pyrophosphataseEnergy production and conversion [C] 1.94
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 0.65
COG1020EntF, seryl-AMP synthase component of non-ribosomal peptide synthetaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.65
COG1550Stress-induced protein YlxP, DUF503 familyFunction unknown [S] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.19 %
UnclassifiedrootN/A5.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000789|JGI1027J11758_12760266All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia849Open in IMG/M
3300000789|JGI1027J11758_12792091All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300000955|JGI1027J12803_109348430All Organisms → cellular organisms → Bacteria1754Open in IMG/M
3300001177|JGI12634J13548_1006363All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300001356|JGI12269J14319_10334129Not Available537Open in IMG/M
3300004152|Ga0062386_100696998All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300005435|Ga0070714_102259894All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005451|Ga0066681_10521168All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300005553|Ga0066695_10555045All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300005555|Ga0066692_10023162All Organisms → cellular organisms → Bacteria3185Open in IMG/M
3300005558|Ga0066698_10366108All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300005576|Ga0066708_10923422All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300005598|Ga0066706_11527720All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300005712|Ga0070764_10904484All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300005764|Ga0066903_107236464All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300005994|Ga0066789_10481010All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300005995|Ga0066790_10534269All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300006032|Ga0066696_10992523All Organisms → cellular organisms → Bacteria → Proteobacteria534Open in IMG/M
3300006052|Ga0075029_100005451All Organisms → cellular organisms → Bacteria → Proteobacteria7044Open in IMG/M
3300006052|Ga0075029_101173277All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300006173|Ga0070716_100941528All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300006174|Ga0075014_100474885All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300006175|Ga0070712_100117355All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1997Open in IMG/M
3300006796|Ga0066665_10867375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium703Open in IMG/M
3300006800|Ga0066660_10189868All Organisms → cellular organisms → Bacteria1557Open in IMG/M
3300009093|Ga0105240_11780058All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300009143|Ga0099792_10447933All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300009143|Ga0099792_10727020All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300009645|Ga0116106_1220669All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300009762|Ga0116130_1125874All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300009762|Ga0116130_1304787All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300009824|Ga0116219_10396853All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300010301|Ga0134070_10372875All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300010359|Ga0126376_10188001All Organisms → cellular organisms → Bacteria1698Open in IMG/M
3300010360|Ga0126372_11016818All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300010361|Ga0126378_11997173All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300010373|Ga0134128_11098609All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300010376|Ga0126381_101107929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1144Open in IMG/M
3300010398|Ga0126383_12613587All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300011120|Ga0150983_15262677All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300012189|Ga0137388_11565997All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300012198|Ga0137364_10890025All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300012203|Ga0137399_11001271All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300012206|Ga0137380_11322681All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300012208|Ga0137376_10402570All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300012210|Ga0137378_11708268All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300012362|Ga0137361_10471545All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300012363|Ga0137390_10011127All Organisms → cellular organisms → Bacteria → Acidobacteria7986Open in IMG/M
3300012469|Ga0150984_101352932All Organisms → cellular organisms → Bacteria1732Open in IMG/M
3300012923|Ga0137359_11705975All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300012929|Ga0137404_11539167All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300014158|Ga0181521_10334823All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300014501|Ga0182024_10329814All Organisms → cellular organisms → Bacteria → Acidobacteria2003Open in IMG/M
3300014638|Ga0181536_10492989Not Available534Open in IMG/M
3300014654|Ga0181525_10219202All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1038Open in IMG/M
3300015242|Ga0137412_10613588All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300015245|Ga0137409_10119289All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes2432Open in IMG/M
3300015245|Ga0137409_10469556All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300016294|Ga0182041_11513052All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300016387|Ga0182040_11837692All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300016404|Ga0182037_11239115All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300017657|Ga0134074_1066816All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1220Open in IMG/M
3300017822|Ga0187802_10302663All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300017931|Ga0187877_1250119All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300017942|Ga0187808_10444050Not Available596Open in IMG/M
3300018019|Ga0187874_10011894All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4957Open in IMG/M
3300018020|Ga0187861_10429356All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300018024|Ga0187881_10139415All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300018026|Ga0187857_10303422All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium728Open in IMG/M
3300018038|Ga0187855_10597714All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300018040|Ga0187862_10426879All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300018043|Ga0187887_10526331All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300018062|Ga0187784_10030004All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4394Open in IMG/M
3300018062|Ga0187784_10659281All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300018064|Ga0187773_10256415All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300018085|Ga0187772_10317773All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300018085|Ga0187772_11102919All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300018468|Ga0066662_11401394All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300018468|Ga0066662_12666400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300019888|Ga0193751_1273574All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300020579|Ga0210407_10197091All Organisms → cellular organisms → Bacteria1564Open in IMG/M
3300020581|Ga0210399_11321626All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300021170|Ga0210400_10125928All Organisms → cellular organisms → Bacteria2048Open in IMG/M
3300021170|Ga0210400_10460353All Organisms → cellular organisms → Bacteria → Acidobacteria1049Open in IMG/M
3300021178|Ga0210408_10522424All Organisms → cellular organisms → Bacteria → Acidobacteria943Open in IMG/M
3300021181|Ga0210388_10619985All Organisms → cellular organisms → Bacteria → Acidobacteria945Open in IMG/M
3300021401|Ga0210393_10018793All Organisms → cellular organisms → Bacteria5355Open in IMG/M
3300021420|Ga0210394_10278094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1467Open in IMG/M
3300021420|Ga0210394_11523742All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300021432|Ga0210384_11195295All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300021477|Ga0210398_11117856All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300021479|Ga0210410_10594678All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium983Open in IMG/M
3300021479|Ga0210410_11333156Not Available610Open in IMG/M
3300021559|Ga0210409_10875236All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300021861|Ga0213853_10500953All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300022724|Ga0242665_10019733All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1533Open in IMG/M
3300024295|Ga0224556_1118708All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium647Open in IMG/M
3300025442|Ga0208034_1037667All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1098Open in IMG/M
3300025581|Ga0208355_1131723All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300025910|Ga0207684_11259794All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300025922|Ga0207646_11633826All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300025928|Ga0207700_10744557All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300025949|Ga0207667_11386268All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300026295|Ga0209234_1296343All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300026307|Ga0209469_1152839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300026314|Ga0209268_1154108All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300026328|Ga0209802_1015691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4297Open in IMG/M
3300026329|Ga0209375_1179492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium841Open in IMG/M
3300026377|Ga0257171_1049937All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300026514|Ga0257168_1095787Not Available660Open in IMG/M
3300026537|Ga0209157_1176660All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300026552|Ga0209577_10171854All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1687Open in IMG/M
3300026557|Ga0179587_10656924All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300026839|Ga0207764_126199All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300027371|Ga0209418_1054420All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300027505|Ga0209218_1118067All Organisms → cellular organisms → Bacteria → Proteobacteria557Open in IMG/M
3300027629|Ga0209422_1107818Not Available641Open in IMG/M
3300027667|Ga0209009_1035315All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300027681|Ga0208991_1230450Not Available530Open in IMG/M
3300027768|Ga0209772_10062128All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1121Open in IMG/M
3300027842|Ga0209580_10616464All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300027905|Ga0209415_10415878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1077Open in IMG/M
3300027905|Ga0209415_10921665All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300027908|Ga0209006_11304536All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300028572|Ga0302152_10185551All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300028654|Ga0265322_10215144All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300028798|Ga0302222_10088373All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1239Open in IMG/M
3300028798|Ga0302222_10179211All Organisms → cellular organisms → Bacteria → Acidobacteria832Open in IMG/M
3300028906|Ga0308309_10583946All Organisms → cellular organisms → Bacteria → Acidobacteria969Open in IMG/M
3300030294|Ga0311349_10284586All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geothermobacter → Geothermobacter ehrlichii1560Open in IMG/M
3300030399|Ga0311353_11056557All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300030509|Ga0302183_10254815All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300030618|Ga0311354_10390110All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1409Open in IMG/M
3300030746|Ga0302312_10298734Not Available606Open in IMG/M
3300031231|Ga0170824_105218978Not Available687Open in IMG/M
3300031232|Ga0302323_100440291All Organisms → cellular organisms → Bacteria1386Open in IMG/M
3300031249|Ga0265339_10157124All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300031525|Ga0302326_11068095All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300031668|Ga0318542_10140467All Organisms → cellular organisms → Bacteria → Acidobacteria1194Open in IMG/M
3300031715|Ga0307476_10850813All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium674Open in IMG/M
3300031718|Ga0307474_10012075All Organisms → cellular organisms → Bacteria6260Open in IMG/M
3300031720|Ga0307469_10211676All Organisms → cellular organisms → Bacteria1524Open in IMG/M
3300031726|Ga0302321_101646104All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300031754|Ga0307475_10221550All Organisms → cellular organisms → Bacteria → Acidobacteria1514Open in IMG/M
3300031823|Ga0307478_11440295All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300031910|Ga0306923_11118386All Organisms → cellular organisms → Bacteria → Acidobacteria847Open in IMG/M
3300031954|Ga0306926_12996358All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300032180|Ga0307471_100274333All Organisms → cellular organisms → Bacteria → Acidobacteria1756Open in IMG/M
3300032180|Ga0307471_103516985All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300032205|Ga0307472_100006092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales5641Open in IMG/M
3300032783|Ga0335079_10912156All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300032893|Ga0335069_10658007All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300032895|Ga0335074_10000473All Organisms → cellular organisms → Bacteria58222Open in IMG/M
3300033402|Ga0326728_10362321All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300033433|Ga0326726_11103516All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.32%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.16%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.16%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.16%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.23%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.23%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.58%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.58%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.94%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.94%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.94%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.29%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.29%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.29%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.29%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.29%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.29%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.29%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.65%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.65%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.65%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.65%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.65%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001177Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025581Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026839Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes)EnvironmentalOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028654Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaGHost-AssociatedOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J11758_1276026613300000789SoilMKFNKGQILKNVGSSWFALGVNVLVGIFLSPYILHRLGDVAFGLWI
JGI1027J11758_1279209123300000789SoilMKFNKRQILENVGSTWFALGLNVVVGIFLSPYILHRLGDDAFGLWI
JGI1027J12803_10934843043300000955SoilMKFNKRQILENVGSTWFALGLNVVVGIFLSPYILHRLGDDAFGLWILI
JGI12634J13548_100636323300001177Forest SoilMRKLEKLQIIKNVGSNWVALATNVLVGIFLSPFILHRLG
JGI12269J14319_1033412913300001356Peatlands SoilMRKYEKTQILKNVGSSWSALATNVLVGIFLSPFILH
Ga0062386_10069699813300004152Bog Forest SoilMLKTEIFKNVSASWLSLGTNILVGIFLSPFILHRLGNLAYGAWVLA
Ga0070714_10225989433300005435Agricultural SoilMRRFEKIQFISNVSSSWFALGINVAVGIFLSPFILHRLGDSAFGI
Ga0066681_1052116823300005451SoilMKRFDKVQILKNVGSSWFALGLNIVVGIFLSPYILHRLGDDAF
Ga0066695_1055504523300005553SoilMRKSEIIKNVSSSWFSLGVNILVGIFLSPFILHRLGNTAYGAW
Ga0066692_1002316233300005555SoilMRKFEKLEIIKNVSSSWFGLAVNVLVGIFLSPFILH
Ga0066698_1036610813300005558SoilMKKLDKVEILKNVGSSWCALGVNVLVGIFLSPYILHRLGDEAF
Ga0066708_1092342213300005576SoilMLRWEKIHIIKNVGSSWFSLGFNIVVGVFLSPFILHRLG
Ga0066706_1152772013300005598SoilMKKFNKLEIVKNVSSNWFALGLNVLVGIFLSPYVLHHLGDEAFG
Ga0070764_1090448423300005712SoilMKKLDKIALFKNVGSSWFALGVNILVGIFISPYIIHHLGDDAFGLWFLVFSI
Ga0066903_10723646423300005764Tropical Forest SoilMRRMEIFKNVGSSWFSLTVTILVGIFLSPFILHRL
Ga0066789_1048101023300005994SoilMKFNKGQILKNVGSSWFSLGVNVVVGIFLSPFILHRLGDD
Ga0066790_1053426923300005995SoilMLKLEKLQILKNVGSTWFSTGINILIGVFLSPFILHR
Ga0066696_1099252323300006032SoilMRKWEKIQIVKNVGSSWFALGINVLVGILLWPFVLHRLGDV
Ga0075029_10000545183300006052WatershedsMSRIERLQILKNVSSSWFSLGINILVGIFLSPFILHR
Ga0075029_10117327713300006052WatershedsMSSQKLQIIRNVGSSWSALAVNVAVGVFLSPFILHHLGDAAF
Ga0070716_10094152813300006173Corn, Switchgrass And Miscanthus RhizosphereMKFNKGQILKNVSSSWFSLGVNVVTGFILSPFIVHHLGDE
Ga0075014_10047488513300006174WatershedsMRKSEIIKNVSSSWFSLGINILVGIFLSPFILHRLGN
Ga0070712_10011735523300006175Corn, Switchgrass And Miscanthus RhizosphereMKFNKGQILKNVSSSWFSLGVNVVTGFILSPFIVHHLG
Ga0066665_1086737513300006796SoilMKKLDKVEILKNVGSSWFAPGVNVLVGIFLSLYMFHRLGDEAFGLWVLIFSI
Ga0066660_1018986813300006800SoilMKRFEKLAVLKNVGSSWSSLGANILVGVFLSPYIVHRLGDEAYG
Ga0105240_1178005813300009093Corn RhizosphereMKFDKRQILRNVGSTWFALGLNVVVGIFLSPFILHRLGDDAFG
Ga0099792_1044793313300009143Vadose Zone SoilMRKREKRQILKNVGSSWSALATNVAVGIFLSPFILH
Ga0099792_1072702023300009143Vadose Zone SoilMRKLEKGQIIKNISSSWFSLGINIVTGIFLSPFILHHLG
Ga0116106_122066913300009645PeatlandMKFDKRQILRNVGSSWFALGVNVLVGIFLSPYILHRLGDEAFGLWIL
Ga0116130_112587413300009762PeatlandMKFDKRQILKNVGSSWFALGVNVLVGIFLSPYILHRL
Ga0116130_130478713300009762PeatlandMKFDKRQILRNVGSSWFALGVNVLVGIFLSPYILHRL
Ga0116219_1039685313300009824Peatlands SoilMRKYEKTQILKNVGSSWSALATNVLVGIFLSPFILHRLGDAAFG
Ga0134070_1037287513300010301Grasslands SoilMKRFEKLAVLKNVGSSWSSLGANILVGVFLSPYIVHRLG
Ga0126376_1018800113300010359Tropical Forest SoilMRRIEILKNVTSSWFSLGVNILVGIFLSPYTLHRLGDTAYGI
Ga0126372_1101681813300010360Tropical Forest SoilLGIDLGTTMRKREIIKNVTSVWFSLGVNVLVGIFLSP
Ga0126378_1199717313300010361Tropical Forest SoilMRKHEKIRILKNVGSSWISLAVNIATGLILSPFILHR
Ga0134128_1109860913300010373Terrestrial SoilMRKFEKMQFINNVGSSWFALGINVSVGVFLTPFILHRLGD
Ga0126381_10110792913300010376Tropical Forest SoilMKTFSKAELLKNVGSSWFALGINVLVGIFISPYILHRLGDDAFGLWVLIFSVTG
Ga0126383_1261358723300010398Tropical Forest SoilMSLKTQALKNVGSSWFGLAVNMLVGFFLSPFILHRL
Ga0150983_1526267713300011120Forest SoilMLKFEKTQILKNVGSSWSALATNVLVGIFMSPFILHRLGDAAYGIW
Ga0137388_1156599713300012189Vadose Zone SoilMRKREKRQILKNVGSSWSALATNVAVGIFLSPFILHRLGDA
Ga0137364_1089002513300012198Vadose Zone SoilMKKFNKLEIVKNVSSNWFALGLNVLVGIFLSPYVLHHLGDEA
Ga0137399_1100127113300012203Vadose Zone SoilMLKFEKTQILKNVGSSWSALATNVAVGIFLSPFILH
Ga0137380_1132268113300012206Vadose Zone SoilMRRVELVQIVKNVSSSWIALGTNVLVGIFLSPFILHR
Ga0137376_1040257013300012208Vadose Zone SoilMLKLEKLQFIKNVSSNGVALAVNVLVGIFLSPYILHRLGDSA
Ga0137378_1170826813300012210Vadose Zone SoilMKKLDKVEILKNVGSSWCALGVNVLVGIFLSPYILHRLGDEAFGLWVLIFSI
Ga0137361_1047154513300012362Vadose Zone SoilMRKLEKLQIIKNVSSNGIALGTNVLVGVFLSPFILHRLG
Ga0137390_1001112713300012363Vadose Zone SoilMLKFEKRQILKNVGSSWSALALNVVVGIFLSPFILHHLGDAA
Ga0150984_10135293233300012469Avena Fatua RhizosphereMQKLEKIQLLKNVGSSWFSLGVNILVGLFLSPYILHRL
Ga0137359_1170597523300012923Vadose Zone SoilMRKLEILKNVGSSWVSLGVNIILGLFLSPFILHRLGDDAF
Ga0137404_1153916713300012929Vadose Zone SoilMRKFEKGQIIKNISSSWFSLGINIVTGIFLSPFILHHLGDTAFGV
Ga0181521_1033482313300014158BogMRKYEKRQILKNVGSSWSALAVNVLVGIFLSPFILHRLGDV
Ga0182024_1032981423300014501PermafrostMRKIEIFKNVGASWLSLGVNILVGIFLSPFILHRLGNLA
Ga0181536_1049298923300014638BogMRKYEKAQILKNVGSSWSALAMNVLVGIFLSPFILHRLGDAA
Ga0181525_1021920213300014654BogMKKTEKRQFLHNVGTSWFSLGTNVLIGIFLSPFILHRIGD
Ga0137412_1061358833300015242Vadose Zone SoilMRKLEKGQIIKNISSSWFSLGINIVTGIFLYPFIIHH
Ga0137409_1011928943300015245Vadose Zone SoilMRKLEKRQIIKNVTSSWFALGMNVVVGIILWPYILHR
Ga0137409_1046955623300015245Vadose Zone SoilMRKLDILKNVGSSWVSLGVNIVIGFFLSPFILHRL
Ga0182041_1151305213300016294SoilMKFDKSQILKNVGSSWFALGVSVLVGIFLSPYILHRL
Ga0182040_1183769223300016387SoilMKFDKNQILKNIGSSWFSLAVNVVLGIFLSPFILHHLGDD
Ga0182037_1123911523300016404SoilMKTFSKAEILKNVGSSWFALGINVLVGIFISPYILHHLGD
Ga0134074_106681613300017657Grasslands SoilMKKLDKVEILKNVGSSWCALGVNVLVGIFLSPYILHRLGDEAFGLWVLIFS
Ga0187802_1030266323300017822Freshwater SedimentMRKLELIKNVGSGWFSLGVNILVGIFLSPFILHRLGNTAYG
Ga0187877_125011913300017931PeatlandMKFDKRQILKNVGSSWFALGVNVLVGIFLSPYILHRLGDE
Ga0187808_1044405013300017942Freshwater SedimentMRKLEKLQIVKNVGSSWASLGVNILVGIFLSPFILH
Ga0187874_1001189413300018019PeatlandMHAQKLQIIRNVGSSWSALAVNVAVGIFLSPFILHRL
Ga0187861_1042935613300018020PeatlandMRKYEKKQILKNVGSSWSALAVNVSVGIFLSPFILHRLGDVAFG
Ga0187881_1013941523300018024PeatlandMRKYEKTQILKNVGSSWSALAMNVLVGIFLSPFILHRLGD
Ga0187857_1030342213300018026PeatlandMRKLEKIQIIKNVGSSWFALGVNILVGIFLSPFIL
Ga0187855_1059771413300018038PeatlandMSINKRQIIKNVSSSWFSLGVDVVVGILLYPFILHK
Ga0187862_1042687913300018040PeatlandMRKYEKKQILKNVGSSWSALAVNVSVGIFLSPFILHRLGDV
Ga0187887_1052633123300018043PeatlandMKFDKRQILRNVGSSWFSLGVNVVVGVFLSPYILHRLGDEAFGLWILIFS
Ga0187784_1003000453300018062Tropical PeatlandMRKLEKRQILKNVGSSWSALAINVLVGIFLSPFILHRLG
Ga0187784_1065928123300018062Tropical PeatlandMKKRDKVALFKNVGSSWIALGVNLTVGFFLSPYIIHHLGDTAFGL
Ga0187773_1025641513300018064Tropical PeatlandMRKFEKGQIIKNISSNWFSLGINVVTGIIVSPFIVHRLGDTANG
Ga0187772_1031777313300018085Tropical PeatlandMRRFEKLQIIKNVSSSWFALGVNILVGVFLSPFILHRL
Ga0187772_1110291923300018085Tropical PeatlandMRKLEKIQIIKNVGSSWVALAVNIVVGIFLSPFILHRL
Ga0066662_1140139413300018468Grasslands SoilMKKLDKVEILKNVGSSWCALGVNILVGIFLSPYILHRLGDEAFGLWVLIF
Ga0066662_1266640023300018468Grasslands SoilMKRVDKVALVKNVGSSWFALGINILVGIFLSPYILHRLGDEAFGLWVLIFSI
Ga0193751_127357423300019888SoilMRKLEKRQILKNVGSSWSALATNVAVGIFLSPFILHRLGDAA
Ga0210407_1019709133300020579SoilMRKSEIIKNVGSSWFALGVNVVVGIFLSPYILHRLG
Ga0210399_1132162613300020581SoilMHKIDKRQIIKNIGSSWFALGVEVTVGIFLSPFILH
Ga0210400_1012592833300021170SoilMRYREIVKNVSSSWLSLGVNILVGLFLSPYILHRLGNTS
Ga0210400_1046035323300021170SoilMRKLEKIQIIKNVGSSWFALGVNVLVGVFLSPFILHRLGDT
Ga0210408_1052242423300021178SoilMRKSEIIKNVGSSWFALGVNVVVGIFLSPYILHRLGDEAF
Ga0210388_1061998513300021181SoilMKFNRGQILKNVGSSWFALGVNVLVGIFLSPFILH
Ga0210393_1001879343300021401SoilMRFDKTQILRNVGSSWFALGVNVMVGIFLSPYIIHHLGDDAFGLWVI
Ga0210394_1027809413300021420SoilMKFNKGQILKNVGSSWFALGVNVMVGIFLSPYILH
Ga0210394_1152374223300021420SoilMLKIDKRQILQNIGSSWGALGTNVLIGVFLSPFILHRLGDAAF
Ga0210384_1119529523300021432SoilMRKREIIKNVSSSWFSLGVNILVGIFLSPFILHRLGNTAYG
Ga0210398_1111785623300021477SoilMRFDKTQILRNVGSSWFALGVNVMVGIFLSPYIIHHLGD
Ga0210410_1059467823300021479SoilMRKLEIFKNVGSSWFSLGVNIVVGIFLSPFILHRL
Ga0210410_1133315623300021479SoilMLKFEKTQILKNVGSSWSALATNVLVGIFMSPFILH
Ga0210409_1087523623300021559SoilMRKLEKMQILTNVGSSWFSLGINVLTGLFLSPFILHRLGDS
Ga0213853_1050095313300021861WatershedsMKFNKGQILKNVSSSWFSLGVNVVTGFILSPFIVHHLGDEA
Ga0242665_1001973333300022724SoilMRNREIFKNVGSSWFSLGVSILVGVFLSPFILHRLGD
Ga0224556_111870813300024295SoilMKRLDKIAIFKNVGSSWFALGLNILVGLFLSPYILHRLG
Ga0208034_103766713300025442PeatlandMHAQKLQIIRNVGSSWSALAVNVLVGIFLSPFILHRLG
Ga0208355_113172323300025581Arctic Peat SoilMKFDKSQILKNVGSSWFALGVNVVVGVFLSPYILHRLGDTAF
Ga0207684_1125979423300025910Corn, Switchgrass And Miscanthus RhizosphereMSLKLQAMKNVGSSWFSLGVNVAVGFFLSPFILHRLGDDAF
Ga0207646_1163382623300025922Corn, Switchgrass And Miscanthus RhizosphereMHKFEKGQIIKNIGSGWFSLGINVLVGVFLSPFILHRLGD
Ga0207700_1074455723300025928Corn, Switchgrass And Miscanthus RhizosphereMRKLEKLQIIKNVSSSWISLATNVLVGLFLSPYILHR
Ga0207667_1138626813300025949Corn RhizosphereMRRFEKIQFINNVGSSWFALAINVAVGVFLTPFILH
Ga0209234_129634313300026295Grasslands SoilMKKLDKVEILKNVGSSWCALGVNILVGIFLSPYIL
Ga0209469_115283913300026307SoilMKKLDKVEILKNVGSSWCALGVNVLVGIFLSPYIL
Ga0209268_115410813300026314SoilMKKLDKVEILKNVGSSWCALGVNILVGILLSPYILHRLGDEAFGLWVLIF
Ga0209802_101569123300026328SoilMKKLDKVEILKNVGSSWCALGVNILVGIFLSPYILHRLG
Ga0209375_117949223300026329SoilMKRFEKLAVLKNVGSSWSSLGANILVGVFLSPYIVH
Ga0257171_104993713300026377SoilMLKFEKRQILKNVGSSWSALALNVVVGIFLSPFILHHLGDAAF
Ga0257168_109578713300026514SoilMRTFEKKQILKNVGSSWSALAINVIVGIFLSPFIV
Ga0209157_117666023300026537SoilMRKFEKGQIIKNISSSWFSLGINIVTGIFLSPFILHHLGD
Ga0209577_1017185413300026552SoilMKRFEKLAVLKNVGSSWSSLGANILVGVFLSPYIVHRLGDE
Ga0179587_1065692413300026557Vadose Zone SoilMRKREKRQILKNVGSSWSALATNVAVGIFLSPFILHR
Ga0207764_12619913300026839Tropical Forest SoilMTKIDKLEILKNAGSSWFALGVTVVVGFFLSPYILHHLGDEAFG
Ga0209418_105442023300027371Forest SoilMRKREIIKNVSSSWFSLGVNILVGIFLSPFILHRLGNTA
Ga0209218_111806713300027505Forest SoilMRKIEVIKNVSASWFALGVSILVGIFLSPFILHRLGNMAYGAWVLAFS
Ga0209422_110781813300027629Forest SoilMRTFEKKQILKNVGSSWSALAINVIVGIFLSPFILHRLGDAAF
Ga0209009_103531533300027667Forest SoilMRKYEKKQILKNVGSSWSALAMNVLVGIFLSPFILH
Ga0208991_123045013300027681Forest SoilMRKYEKKQILKNVGSSWSALGTNVLVGIFLSPLILHR
Ga0209772_1006212813300027768Bog Forest SoilMLKLEKRQILKNVGSSWSALGVNVIVGIFLSPFILHHL
Ga0209580_1061646423300027842Surface SoilMRNTEIFKNVGSSWFSLGVSILVGVFLSPFILHRL
Ga0209415_1041587813300027905Peatlands SoilMLKLEKRQILKNVGSSWSALGINVIVGIFLSPFILHHLGDAAF
Ga0209415_1092166533300027905Peatlands SoilMKRLDKVALFKNVGSSWFALGINIFVGILLSPYILHHLGDEAF
Ga0209006_1130453613300027908Forest SoilMQKIDKRQIIKNVGSSWFSLGINVVLGLALSPFIVH
Ga0302152_1018555123300028572BogMKKLEKLAILKNLGSSWFALGINILVGIFLSPYILHHLGDDA
Ga0265322_1021514423300028654RhizosphereLRKYEERTGMKIQKSQIVKNVGSSWVALAVNVLVGILLSPFIVHRLGDA
Ga0302222_1008837313300028798PalsaMRKFERTQILKNIGSSWSALGTNVLVGIFLSPVILHRLGDAAY
Ga0302222_1017921113300028798PalsaMKKLDKIAIFKNVGSSWFALGFNILAGLFLSPYILHHLGDDAF
Ga0308309_1058394623300028906SoilMRFDKTQILRNVGSSWFALGVNVMVGIFLSPYIIHHLGDDAFGLWVIIFSVT
Ga0311349_1028458613300030294FenMRKFEKGQIIKNISSSWFSLGINIVTGIFLSPFILHHL
Ga0311353_1105655723300030399PalsaMRKYEKTQILKNVGSSWSALGINVIVGVFLSPFILHRLGDAAF
Ga0302183_1025481513300030509PalsaMHKFERRQIIKNIGSSWFALGVNIVIGIFLSPFIL
Ga0311354_1039011033300030618PalsaMRKIEIIKNVSASWFALGVSILVGLFLSPFILHRLGNMAYGA
Ga0302312_1029873423300030746PalsaMKKLDKIALFKNVGSSWFALGVNILVGIFISPYIIHHLGDDAFGLWFL
Ga0170824_10521897823300031231Forest SoilMRKLEKKQILKNVGSSWSALAINVIVGIFLSPFIVHRLGDAA
Ga0302323_10044029123300031232FenMLKLEKRQILKNVGSSWFALAINVIVGIFLSPFILHHLGDA
Ga0265339_1015712413300031249RhizosphereMRKLEKIRVMKNVGSSWFSLGVNVLVGIFLSPFIMHRLG
Ga0302326_1106809523300031525PalsaMLKLERNQIIKNVGSSWFALGVNILVGIFLSPFILHRLGDAA
Ga0318542_1014046723300031668SoilMRRAEIIKNVGSSWFSLGTSILVGIFLSPFILHRLGD
Ga0307476_1085081323300031715Hardwood Forest SoilMKRIEKIALFKNVGSSWFALGINVLAGIFLSPYILHHLGD
Ga0307474_1001207513300031718Hardwood Forest SoilMRFDKTQILRNVGSSWFALGVNVMVGIFLSPYIIHHLG
Ga0307469_1021167633300031720Hardwood Forest SoilMKKVEKLEILKNVGSSWFALGINVLVGLFLSPYILHRLG
Ga0302321_10164610423300031726FenMKLDKSQILKNVGSSWFALGINVLVGIFLSPFILHRLGDTA
Ga0307475_1022155013300031754Hardwood Forest SoilMSKRQIIKNVGASWFSLGVSVLVGIFLSPFILHRLGD
Ga0307478_1144029513300031823Hardwood Forest SoilMRKLEKIQIIKNVGSSWFALGVNVLVGVFLSPFILHRLGD
Ga0306923_1111838623300031910SoilMKFDKNQILKNIGSSWFSLAVNVVLGIFLSPFILHHLGDDAF
Ga0306926_1299635813300031954SoilMRKPEILKIIKNVGSSWFSLGANIVVGIFLSPFILHH
Ga0307471_10027433323300032180Hardwood Forest SoilMKFNKGQIFEIGSSWFSLGMNVVSGIFLSPFILRRLGDEAFGLRVLIFSIAGSHFLLPSQ
Ga0307471_10351698513300032180Hardwood Forest SoilMKFNKGQILKNVSSSWFSLGVNVVTGFILSPFIVHHLGDAAF
Ga0307472_10000609213300032205Hardwood Forest SoilMKRFDKVQILKNVGSSWFALGLNIVVGIFLSPYILHRLGD
Ga0335079_1091215623300032783SoilMRRTERLQIIRNVGSSWFALGVNILVGLVLSPLILHRLGDA
Ga0335069_1065800723300032893SoilMRKLELHIIKNVGSSWFSLGVNILVGIFLSPFILHRLGDSAF
Ga0335074_1000047313300032895SoilVRKLEKLQLFKNVSSTWLMLAVNILIGVFLAPFIL
Ga0326728_1036232113300033402Peat SoilMKFDKNQILKNVGSSWFALGVNVLVGIFLSPYILHRLGDEAFGLWILIFSATGY
Ga0326726_1110351623300033433Peat SoilMKKLEKLQILKNVGSSWFGLGVNVIVGLFLSPYILHHLGDEA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.