| Basic Information | |
|---|---|
| Family ID | F044098 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 155 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLARL |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.71 % |
| % of genes near scaffold ends (potentially truncated) | 25.16 % |
| % of genes from short scaffolds (< 2000 bps) | 81.29 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.903 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.742 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.323 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF13545 | HTH_Crp_2 | 17.42 |
| PF00027 | cNMP_binding | 17.42 |
| PF00072 | Response_reg | 1.94 |
| PF00011 | HSP20 | 1.29 |
| PF13478 | XdhC_C | 0.65 |
| PF04041 | Glyco_hydro_130 | 0.65 |
| PF13502 | AsmA_2 | 0.65 |
| PF07690 | MFS_1 | 0.65 |
| PF04366 | Ysc84 | 0.65 |
| PF00196 | GerE | 0.65 |
| PF02371 | Transposase_20 | 0.65 |
| PF12779 | WXXGXW | 0.65 |
| PF14534 | DUF4440 | 0.65 |
| PF00005 | ABC_tran | 0.65 |
| PF04542 | Sigma70_r2 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.29 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.65 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.65 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.65 |
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.65 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.65 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.90 % |
| Unclassified | root | N/A | 7.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459016|G1P06HT02FI15M | Not Available | 609 | Open in IMG/M |
| 3300004114|Ga0062593_100213113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1553 | Open in IMG/M |
| 3300004114|Ga0062593_100829576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300004479|Ga0062595_100341107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1037 | Open in IMG/M |
| 3300004479|Ga0062595_100932890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300004479|Ga0062595_101647977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300005166|Ga0066674_10064951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1665 | Open in IMG/M |
| 3300005167|Ga0066672_10134074 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300005172|Ga0066683_10136265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1503 | Open in IMG/M |
| 3300005172|Ga0066683_10408013 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300005174|Ga0066680_10137855 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300005175|Ga0066673_10172523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1218 | Open in IMG/M |
| 3300005175|Ga0066673_10214380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1104 | Open in IMG/M |
| 3300005176|Ga0066679_10034640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2810 | Open in IMG/M |
| 3300005177|Ga0066690_10283041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1117 | Open in IMG/M |
| 3300005178|Ga0066688_10784177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300005179|Ga0066684_10051619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2359 | Open in IMG/M |
| 3300005179|Ga0066684_11009168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300005180|Ga0066685_10168613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1495 | Open in IMG/M |
| 3300005187|Ga0066675_10860366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300005329|Ga0070683_100094698 | All Organisms → cellular organisms → Bacteria | 2807 | Open in IMG/M |
| 3300005329|Ga0070683_102033325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300005336|Ga0070680_100057614 | All Organisms → cellular organisms → Bacteria | 3176 | Open in IMG/M |
| 3300005337|Ga0070682_101371227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300005341|Ga0070691_10533436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300005365|Ga0070688_100602057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300005434|Ga0070709_10902944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300005434|Ga0070709_11245514 | Not Available | 599 | Open in IMG/M |
| 3300005435|Ga0070714_100144053 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
| 3300005435|Ga0070714_100541062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
| 3300005435|Ga0070714_100702146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 976 | Open in IMG/M |
| 3300005436|Ga0070713_100027539 | All Organisms → cellular organisms → Bacteria | 4475 | Open in IMG/M |
| 3300005436|Ga0070713_100285702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1515 | Open in IMG/M |
| 3300005436|Ga0070713_100431030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1235 | Open in IMG/M |
| 3300005436|Ga0070713_101315138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300005436|Ga0070713_101752530 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005437|Ga0070710_10109428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1658 | Open in IMG/M |
| 3300005439|Ga0070711_101370959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300005445|Ga0070708_100027716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4864 | Open in IMG/M |
| 3300005456|Ga0070678_101685974 | Not Available | 596 | Open in IMG/M |
| 3300005529|Ga0070741_10487177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1117 | Open in IMG/M |
| 3300005542|Ga0070732_10000090 | All Organisms → cellular organisms → Bacteria | 84971 | Open in IMG/M |
| 3300005542|Ga0070732_10012870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4622 | Open in IMG/M |
| 3300005542|Ga0070732_10045757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2522 | Open in IMG/M |
| 3300005542|Ga0070732_10239997 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300005542|Ga0070732_10784348 | Not Available | 581 | Open in IMG/M |
| 3300005547|Ga0070693_101449797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300005552|Ga0066701_10136583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1466 | Open in IMG/M |
| 3300005556|Ga0066707_10047306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2477 | Open in IMG/M |
| 3300005559|Ga0066700_10704225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300005560|Ga0066670_10076129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1819 | Open in IMG/M |
| 3300005560|Ga0066670_10481861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300005568|Ga0066703_10168086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1323 | Open in IMG/M |
| 3300005569|Ga0066705_10862899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300005614|Ga0068856_101416021 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005834|Ga0068851_10291533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300006028|Ga0070717_10001332 | All Organisms → cellular organisms → Bacteria | 16951 | Open in IMG/M |
| 3300006028|Ga0070717_10223827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1654 | Open in IMG/M |
| 3300006028|Ga0070717_11398132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300006028|Ga0070717_11994257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300006173|Ga0070716_101109318 | Not Available | 631 | Open in IMG/M |
| 3300006175|Ga0070712_100775991 | Not Available | 821 | Open in IMG/M |
| 3300006175|Ga0070712_100790541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300006755|Ga0079222_11667773 | Not Available | 609 | Open in IMG/M |
| 3300006794|Ga0066658_10295767 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300006796|Ga0066665_10211179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1513 | Open in IMG/M |
| 3300006797|Ga0066659_10176417 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300006806|Ga0079220_10824891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300006854|Ga0075425_100037848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5375 | Open in IMG/M |
| 3300006954|Ga0079219_10400123 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300009012|Ga0066710_103628799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300009093|Ga0105240_10056327 | All Organisms → cellular organisms → Bacteria | 4920 | Open in IMG/M |
| 3300009162|Ga0075423_12581258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300009545|Ga0105237_12601383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300010159|Ga0099796_10065966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1296 | Open in IMG/M |
| 3300010371|Ga0134125_11114222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300010373|Ga0134128_11705158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300010373|Ga0134128_13109064 | Not Available | 510 | Open in IMG/M |
| 3300010375|Ga0105239_13499693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300010396|Ga0134126_10104702 | All Organisms → cellular organisms → Bacteria | 3474 | Open in IMG/M |
| 3300010396|Ga0134126_10414795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1562 | Open in IMG/M |
| 3300010396|Ga0134126_10844200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
| 3300010399|Ga0134127_13463886 | Not Available | 517 | Open in IMG/M |
| 3300012198|Ga0137364_10224303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1383 | Open in IMG/M |
| 3300012199|Ga0137383_10018391 | All Organisms → cellular organisms → Bacteria | 4814 | Open in IMG/M |
| 3300012200|Ga0137382_10628960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
| 3300012201|Ga0137365_10208780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1458 | Open in IMG/M |
| 3300012205|Ga0137362_11453174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300012208|Ga0137376_10578129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
| 3300012210|Ga0137378_10353676 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300012210|Ga0137378_11119644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300012285|Ga0137370_10303194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 954 | Open in IMG/M |
| 3300012350|Ga0137372_10081617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2750 | Open in IMG/M |
| 3300012350|Ga0137372_10857332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300012359|Ga0137385_11083862 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012363|Ga0137390_10308598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1564 | Open in IMG/M |
| 3300012363|Ga0137390_11069380 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300012371|Ga0134022_1037219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300012951|Ga0164300_10743132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300012957|Ga0164303_10076302 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300013296|Ga0157374_10735359 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300013296|Ga0157374_12401369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300013296|Ga0157374_12564633 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300013307|Ga0157372_10043550 | All Organisms → cellular organisms → Bacteria | 4970 | Open in IMG/M |
| 3300013307|Ga0157372_10410246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1579 | Open in IMG/M |
| 3300013307|Ga0157372_11575781 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300015261|Ga0182006_1179100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300017656|Ga0134112_10448067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300017994|Ga0187822_10036709 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300018431|Ga0066655_10096843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1645 | Open in IMG/M |
| 3300018433|Ga0066667_10387871 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300018433|Ga0066667_10474869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1025 | Open in IMG/M |
| 3300018433|Ga0066667_11573634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300018468|Ga0066662_10012596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4474 | Open in IMG/M |
| 3300018482|Ga0066669_10584665 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300019870|Ga0193746_1001243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1962 | Open in IMG/M |
| 3300019877|Ga0193722_1038334 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300021445|Ga0182009_10007452 | All Organisms → cellular organisms → Bacteria | 3626 | Open in IMG/M |
| 3300025905|Ga0207685_10129748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1117 | Open in IMG/M |
| 3300025906|Ga0207699_11156911 | Not Available | 573 | Open in IMG/M |
| 3300025911|Ga0207654_10083600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1928 | Open in IMG/M |
| 3300025913|Ga0207695_10056797 | All Organisms → cellular organisms → Bacteria | 4071 | Open in IMG/M |
| 3300025915|Ga0207693_10322999 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300025915|Ga0207693_10723065 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300025916|Ga0207663_11209326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300025917|Ga0207660_10821619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300025922|Ga0207646_10051071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3700 | Open in IMG/M |
| 3300025922|Ga0207646_11739271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300025927|Ga0207687_11402845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300025928|Ga0207700_10025061 | All Organisms → cellular organisms → Bacteria | 4136 | Open in IMG/M |
| 3300025928|Ga0207700_11581296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300025929|Ga0207664_10669075 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300025938|Ga0207704_10867300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300025939|Ga0207665_10780645 | Not Available | 754 | Open in IMG/M |
| 3300025939|Ga0207665_11313249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300025949|Ga0207667_10381616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1436 | Open in IMG/M |
| 3300026078|Ga0207702_11036053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300026088|Ga0207641_10315319 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300026326|Ga0209801_1304078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300026327|Ga0209266_1056216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1905 | Open in IMG/M |
| 3300026331|Ga0209267_1030767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2569 | Open in IMG/M |
| 3300026332|Ga0209803_1191307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300026335|Ga0209804_1212532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300026538|Ga0209056_10008780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 10357 | Open in IMG/M |
| 3300026540|Ga0209376_1336583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300026550|Ga0209474_10013166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6597 | Open in IMG/M |
| 3300026550|Ga0209474_10567864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300026853|Ga0207443_1012668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300027842|Ga0209580_10000007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 613108 | Open in IMG/M |
| 3300027842|Ga0209580_10006746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4908 | Open in IMG/M |
| 3300027842|Ga0209580_10030472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2448 | Open in IMG/M |
| 3300027842|Ga0209580_10383828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300031057|Ga0170834_111244168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300031231|Ga0170824_105404659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1632 | Open in IMG/M |
| 3300033475|Ga0310811_10601469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1105 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 19.35% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 6.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.23% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.29% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.65% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026853 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2ZMR_04096630 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MHPEELMKPDLLSEIVLLTFGTLVLSSLVWFAVAALARP |
| Ga0062593_1002131133 | 3300004114 | Soil | MHPKELMKPDLLSEIVLLTFGTIVLSSVALVVVAAIARS* |
| Ga0062593_1008295762 | 3300004114 | Soil | MHPEELMKPDILSEIVLLTFGMIVLSSIGLVVAAALARS* |
| Ga0062595_1003411072 | 3300004479 | Soil | MHPEELMKPDLLSEIVLLTFSTLILAALLLFVTTSLARF* |
| Ga0062595_1009328902 | 3300004479 | Soil | MHPNELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS* |
| Ga0062595_1016479772 | 3300004479 | Soil | MHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMTTLARS* |
| Ga0066674_100649512 | 3300005166 | Soil | MHPQELLKPDLLSEFVLLTFGTLILASLVLFVTTTLARF* |
| Ga0066672_101340742 | 3300005167 | Soil | MHPEELMKPDLLSEVVLLTFGTLILASLVLFVTITLTRL* |
| Ga0066683_101362651 | 3300005172 | Soil | MHPEELMKPDLLSEFVLLTFGTLILASLVLFTTTTLARL* |
| Ga0066683_104080132 | 3300005172 | Soil | MHPQELLKPDLLSEFVLLTFGTLVLASLVLFVTTTLARF* |
| Ga0066680_101378553 | 3300005174 | Soil | MHPQELLKPDLLSEFVLLTFGTLILASLVLFVTTTLARL* |
| Ga0066673_101725232 | 3300005175 | Soil | MRSNELMKPDLLSEIVLLTFCALILASLVLFVMTTLAQS* |
| Ga0066673_102143801 | 3300005175 | Soil | MHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLARL* |
| Ga0066679_100346401 | 3300005176 | Soil | MHPEELMKPDLLSEFVLFTFGTLILASLVLFVTTTLTRL* |
| Ga0066690_102830412 | 3300005177 | Soil | MHPEELLKPDLLSEVVLLTFGTLILASLVLFVTTTLARF* |
| Ga0066688_107841772 | 3300005178 | Soil | MHPEELMKPDLLSEFVLLTFGTLTLASLVLFVTTTLARF* |
| Ga0066684_100516192 | 3300005179 | Soil | MRSNELLKPDLLSEIVLLTFCALILASLVLFVMTTLAQS* |
| Ga0066684_110091682 | 3300005179 | Soil | MHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLTQL* |
| Ga0066685_101686132 | 3300005180 | Soil | MHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLARF* |
| Ga0066675_108603661 | 3300005187 | Soil | ANRGEQMHPEDLMKPDLLSEIVLSAFGILTFSSLLLFVAAAFARP* |
| Ga0070683_1000946984 | 3300005329 | Corn Rhizosphere | MHPEELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARS* |
| Ga0070683_1020333251 | 3300005329 | Corn Rhizosphere | MHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA* |
| Ga0070680_1000576142 | 3300005336 | Corn Rhizosphere | MHPEELMKPDLLSEIVLLTFGTLVLSSLVWFAVAALARP* |
| Ga0070682_1013712272 | 3300005337 | Corn Rhizosphere | MHPEELMKPDLLSEVVLFAFGTMVLTSLVLFVMSTLARS* |
| Ga0070691_105334361 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | RRSDMHPEELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARS* |
| Ga0070688_1006020573 | 3300005365 | Switchgrass Rhizosphere | MHPKELMKPDLVSEMVLLTFGTLLSSSLVWFVVAALTRP* |
| Ga0070709_109029442 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEELMKPDLLSEIVLLAFGTLVLTSLVLFAITTLARS* |
| Ga0070709_112455141 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEELMKPDLLSEVVLLAFGALVLTSFVPCVIRTFART* |
| Ga0070714_1001440534 | 3300005435 | Agricultural Soil | MHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMSTFARS* |
| Ga0070714_1005410621 | 3300005435 | Agricultural Soil | MHPEELMRPDLLSEIVLFTFGTLLLSSLVWFVVAALARA* |
| Ga0070714_1007021462 | 3300005435 | Agricultural Soil | MHPEELMKPDLLSEIVLMTLVTLVLSSLVWFAMAAFARP* |
| Ga0070713_1000275394 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MHQEEIMKPDLLSEIVLITFGTLMLSSLVWFAMAAFARP* |
| Ga0070713_1002857022 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMSTLARS* |
| Ga0070713_1004310303 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEELMKPDLLSEIVLMTLGTLILSSLVWFAMAAFARP* |
| Ga0070713_1013151382 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEELMKPDLLSEIVLLTFATMILASALLFFATTLTLS* |
| Ga0070713_1017525302 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEELMRPDLLSEIVLLTFGTLLLSSLVWFVVAALARP* |
| Ga0070710_101094284 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEELMKPDLLSEVVLLAFGTLVLTSLVLFAITTLARS* |
| Ga0070711_1013709591 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | QFPGGPVHPADLMKPDLLSEIVLATFATLTLSSLLLFVAVALARP* |
| Ga0070708_1000277162 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEEIMKPDLLSEIVLLTFATLILASLVLFVATTLARS* |
| Ga0070678_1016859741 | 3300005456 | Miscanthus Rhizosphere | VIRRINIHPKELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS |
| Ga0070741_104871771 | 3300005529 | Surface Soil | MHPEELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS* |
| Ga0070732_100000906 | 3300005542 | Surface Soil | MHPEELMKPDLLSEIVLLTFGTLVLSSLLLFVLAAFARP* |
| Ga0070732_100128702 | 3300005542 | Surface Soil | MHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLALS* |
| Ga0070732_100457573 | 3300005542 | Surface Soil | MHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLVL* |
| Ga0070732_102399972 | 3300005542 | Surface Soil | MHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLALL* |
| Ga0070732_107843481 | 3300005542 | Surface Soil | MHPEELMKPDLLSEIVLLTFCTLILGSVILFFATTLVLS* |
| Ga0070693_1014497971 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | KGTDMHPEELMKPDLLSEIVLLAFGTLVLTSLVLFVMSTFARS* |
| Ga0066701_101365833 | 3300005552 | Soil | ELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL* |
| Ga0066707_100473063 | 3300005556 | Soil | MHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL* |
| Ga0066700_107042251 | 3300005559 | Soil | MHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLARL* |
| Ga0066670_100761293 | 3300005560 | Soil | MHPKELMKTDLLSGVVPFTFGTLILASVVLFVTLARF* |
| Ga0066670_104818612 | 3300005560 | Soil | MHPEELMKPDLLSEFVLLTFGTLTLASLVPFVTTTLARL* |
| Ga0066703_101680862 | 3300005568 | Soil | MHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLSQL* |
| Ga0066705_108628991 | 3300005569 | Soil | MHPEDLMKPDLLSEIVLVTLATLTFSSLLLFVAAAVARP* |
| Ga0068856_1014160211 | 3300005614 | Corn Rhizosphere | MHPEELMRPDLLSEIVLFTFGTLLLSSLVWFVVAALAR |
| Ga0068851_102915332 | 3300005834 | Corn Rhizosphere | MHPNELMKPDLLSEIVLLTFGTIVLSSVALVVVAAIARS* |
| Ga0070717_100013322 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMTTFVRS* |
| Ga0070717_102238274 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRADLLSPDVLSEIVLLAFGTLILASLVLFLVTVFCRV* |
| Ga0070717_113981321 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RRNAMHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLALS* |
| Ga0070717_119942572 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPKELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS* |
| Ga0070716_1011093181 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPAEIMKPDVLSEIVLFTFGTLIISSLVLFAMAAFART* |
| Ga0070712_1007759912 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEDLMKPDLLSEIVLATFATLTVSSLLLFLAVALARP* |
| Ga0070712_1007905412 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEELMKPDLLSEIVLLAFGTLVLTSLVLFVMTTFARS* |
| Ga0079222_116677731 | 3300006755 | Agricultural Soil | MHPEELMKPDLLSEIVLLTFGTLVLSSLVWFVVAVLART* |
| Ga0066658_102957672 | 3300006794 | Soil | MHPEELLKPDLLSEFVLLTFGTLILASLVLFVTTTLTRL* |
| Ga0066665_102111791 | 3300006796 | Soil | ELLKPDLLSEFVLLTFGTLILASLVLFTTTTLARL* |
| Ga0066659_101764172 | 3300006797 | Soil | MHPEELLKPDLLSEVVLLTFGTLILASLVLFVTTTLAR |
| Ga0079220_108248912 | 3300006806 | Agricultural Soil | MHPEELMRPDLLSEIVLFTFGTLLLSSLVWFVVAALARP* |
| Ga0075425_1000378483 | 3300006854 | Populus Rhizosphere | MHPEELMKPDLLSEIVLLTFGTLIISSLALFVVAILARS* |
| Ga0079219_104001232 | 3300006954 | Agricultural Soil | MHPEELMKPDLLSEIVLLTFGTLVLSSLVWFAVAALAR |
| Ga0066710_1036287992 | 3300009012 | Grasslands Soil | MHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLARL |
| Ga0105240_100563275 | 3300009093 | Corn Rhizosphere | LATGVRRIDMHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA* |
| Ga0075423_125812581 | 3300009162 | Populus Rhizosphere | AAPVIRRINMHPKELMKPDLLSEIVLLTFGTIVLSSVALVVVAAIARS* |
| Ga0105237_126013831 | 3300009545 | Corn Rhizosphere | MHPEDLMKPDLLSEIVLLTFGAAVLSSLVLFVAAELARI* |
| Ga0099796_100659662 | 3300010159 | Vadose Zone Soil | MHPEELMKPDLLSEFVLLTFGTLTLASLVLFVTTMLARF* |
| Ga0134125_111142222 | 3300010371 | Terrestrial Soil | MHPEELMKPDLLSEIVLLTFGTLVLSSLLWFVVGALARS* |
| Ga0134128_117051582 | 3300010373 | Terrestrial Soil | MHPEELMKPDLLSEIVLLTFGAAVLSSLVLFVAAALARI* |
| Ga0134128_131090642 | 3300010373 | Terrestrial Soil | MHPEELMRPDLLSEIVLLTFGTLLLSSLVWFVVAALARL* |
| Ga0105239_134996932 | 3300010375 | Corn Rhizosphere | LMKPDILSEIVLLTFGMIVLSSIGLVVAAALARS* |
| Ga0134126_101047022 | 3300010396 | Terrestrial Soil | MHPEELMKPDLLSEVVLWTFGTLVLSSLVWFVVGAFAQS* |
| Ga0134126_104147953 | 3300010396 | Terrestrial Soil | HPEELMKPDLLSEVVLWTFGTLVLSSLLWFVVGALARS* |
| Ga0134126_108442002 | 3300010396 | Terrestrial Soil | VAADRRNDMHPEDLMKPDLLSEIVLLTFGAAVLSSLVLFVAAELARI* |
| Ga0134127_134638861 | 3300010399 | Terrestrial Soil | MHPEDLMKPDLLSEIVLLTFGAAVLSSLVLFVAAE |
| Ga0137364_102243033 | 3300012198 | Vadose Zone Soil | MHPEELMKPDLLSEFVLLTFGTLILASLVLFATTTLARF* |
| Ga0137383_100183912 | 3300012199 | Vadose Zone Soil | MHPEELMKPDLLSEIVLLGFATLILASLVLFVATMLARS* |
| Ga0137382_106289602 | 3300012200 | Vadose Zone Soil | MHPEELLKPDLLSEFVLLTFGTLILASLVLFVTTTLDRF* |
| Ga0137365_102087802 | 3300012201 | Vadose Zone Soil | MHPEELMKPDLLSEVVLFTFGTLILASLVLFVTLARF* |
| Ga0137362_114531741 | 3300012205 | Vadose Zone Soil | RRNDMHPEELMKPDLLSEFVLLTFGTLIVASLVLFITTTLARL* |
| Ga0137376_105781292 | 3300012208 | Vadose Zone Soil | MHPEELLKPDLLSEFVLLTFGTLILASLVLFATTTLARF* |
| Ga0137378_103536762 | 3300012210 | Vadose Zone Soil | MHPEELMKPDLLSEVVLLTFATLMVASLVLFVATMLARP* |
| Ga0137378_111196442 | 3300012210 | Vadose Zone Soil | MHPEELMKPDLLSEVVLFTFGTLILASLVLFVTTMLARF* |
| Ga0137370_103031941 | 3300012285 | Vadose Zone Soil | MHPEELMNPYLRSEFVLLTFGTLTLASLVVFVTTALARF* |
| Ga0137372_100816172 | 3300012350 | Vadose Zone Soil | MADAAKRNHMHPEEIMKPDLLSEIVLTTFGTLTLSFLVLFAMAAFDRP* |
| Ga0137372_108573322 | 3300012350 | Vadose Zone Soil | MHPEDVMKSDLFSEIVLLTFGTLTLSSLLLLFVAAALARS* |
| Ga0137385_110838621 | 3300012359 | Vadose Zone Soil | MHPEDLMKADLLSEIVLLTFAALICVSMVLFVATMVAQS* |
| Ga0137390_103085981 | 3300012363 | Vadose Zone Soil | MHPEELMKPALLSEIVLLFGTLIIASLVVFVATTLARS* |
| Ga0137390_110693801 | 3300012363 | Vadose Zone Soil | MHPEELMKPDLLSEFVLLTFGTLTLASLVLFVTTTLA |
| Ga0134022_10372192 | 3300012371 | Grasslands Soil | MHPQELLKPDLLSEFVLLTFATLILASLVLFVTTTLARF* |
| Ga0164300_107431321 | 3300012951 | Soil | MHPEEIMKPDLLSEIVLSTFGTLVLSSLVLFVAAALART* |
| Ga0164303_100763023 | 3300012957 | Soil | MHPEEIMKPDLLSEIVLLTFGTLVLSSLVLFVAAALART* |
| Ga0157374_107353592 | 3300013296 | Miscanthus Rhizosphere | MHPEELMKPDLLSEIVLFAFGTMVLTSLVLFVMSTLARS* |
| Ga0157374_124013691 | 3300013296 | Miscanthus Rhizosphere | RLATGVRRIDMHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA* |
| Ga0157374_125646331 | 3300013296 | Miscanthus Rhizosphere | MHPEELMRPDLLSEIVLLTFGTLLLSSLVWFVVAA |
| Ga0157372_100435505 | 3300013307 | Corn Rhizosphere | MRPDQLMKPDLLSEIVLLSLGAFVLSSMVLFVAAVLARM* |
| Ga0157372_104102461 | 3300013307 | Corn Rhizosphere | PEELMKPDLLSEVVLWTFGTLVLSSLVWFVVGAFAQS* |
| Ga0157372_115757811 | 3300013307 | Corn Rhizosphere | MHLEELMKPDLLSEIVLLTFGTLLLSSLVWFVVAALARP* |
| Ga0182006_11791001 | 3300015261 | Rhizosphere | NNMHPEELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS* |
| Ga0134112_104480672 | 3300017656 | Grasslands Soil | RNDMHPEELMKPDLLSEFVLLTFGTLVLASLVLFLTTTLTRL |
| Ga0187822_100367092 | 3300017994 | Freshwater Sediment | MHPEELMKPDLLSEIVLFTFGTLLLSSLVWFVVEALARP |
| Ga0066655_100968431 | 3300018431 | Grasslands Soil | MHPEELLKPDLLSEVVLFTFGTLILASLVLFVTTTLARF |
| Ga0066667_103878711 | 3300018433 | Grasslands Soil | MHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTL |
| Ga0066667_104748692 | 3300018433 | Grasslands Soil | MTDARRNDMHPEEIMKPDLLSEIVLTTFGTLTLSVLVLFAMAAFARR |
| Ga0066667_115736342 | 3300018433 | Grasslands Soil | MHPKELMKTDLLSGVVPFTFGTLILASVVLFVTLARF |
| Ga0066662_100125962 | 3300018468 | Grasslands Soil | MHPEEIMKPDLLSEIVLTPFGTLTLSFLVLFAIAAFARS |
| Ga0066669_105846652 | 3300018482 | Grasslands Soil | MHPQELLKPDLLSEFVLLTFGALILASFVLFTTTMLARL |
| Ga0193746_10012432 | 3300019870 | Soil | MRNYMHPEEIMKPDLLSEVVLLAFGTLILASLLLFLTLARF |
| Ga0193722_10383342 | 3300019877 | Soil | MHPEDLMKPDLLSEIVLSAFGILTFSSLLLFVAAAFARP |
| Ga0182009_100074523 | 3300021445 | Soil | MHPEELMRPDLLSEIVLLTFGTLLLSSLVWFVVAALARA |
| Ga0207685_101297482 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | PEELMKPDLLSEIVLLAFGTLVLTSLVLFVMTTFARS |
| Ga0207699_111569112 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEELMKPDLLSEVVLLAFGALVLTSLVLFVMTTFARS |
| Ga0207654_100836005 | 3300025911 | Corn Rhizosphere | ELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARS |
| Ga0207695_100567974 | 3300025913 | Corn Rhizosphere | MHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA |
| Ga0207693_103229991 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VHPADLMKPDLLSEIVLATFATLTLSSLLLFVAVALARP |
| Ga0207693_107230652 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEDLMKPDLLSEIVLATFATLTVSSLLLFLAVALARP |
| Ga0207663_112093261 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAELRLEPEHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMTTFVRS |
| Ga0207660_108216192 | 3300025917 | Corn Rhizosphere | VIRRDNMHPNELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS |
| Ga0207646_100510712 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEEIMKPDLLSEIVLLTFATLILASLVLFVATTLARS |
| Ga0207646_117392711 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EELMKADLLSEIVLLTFGTLILASLVLFVATMLARS |
| Ga0207687_114028452 | 3300025927 | Miscanthus Rhizosphere | RRSDMHPEELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARS |
| Ga0207700_100250614 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEELMKPDLLSEIVLLTFATMILASALLFFATTLTLS |
| Ga0207700_115812962 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PAFPGGPVHPADLMKPDLLSEIVLATFATLTLSSLLLFVAVALARP |
| Ga0207664_106690752 | 3300025929 | Agricultural Soil | MHPEELMRPDLLSEIVLFTFGTLLLSSLVWFVVAALARA |
| Ga0207704_108673003 | 3300025938 | Miscanthus Rhizosphere | RINMHPKELMKPDLLSEIVLLTFGTIVLSSVALVVVAAIARS |
| Ga0207665_107806451 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPAEIMKPDVLSEIVLFTFGTLIISSLVLFAMAAFART |
| Ga0207665_113132492 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEEIMKPDLLSEIVLLTFGTLVLSSLVLFVAAALART |
| Ga0207667_103816161 | 3300025949 | Corn Rhizosphere | TGVRRIDMHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA |
| Ga0207702_110360531 | 3300026078 | Corn Rhizosphere | AWRSNMHPEELMKPDLLSEIVLFAFGTMVLTSLVLFVMSTLARS |
| Ga0207641_103153193 | 3300026088 | Switchgrass Rhizosphere | MHPEELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARSSRA |
| Ga0209801_13040782 | 3300026326 | Soil | AVAARRTDMHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL |
| Ga0209266_10562163 | 3300026327 | Soil | MHPQELLKPDLLSEFVLLTFGTLILASLVLFTTTTLARL |
| Ga0209267_10307674 | 3300026331 | Soil | MHPEELMKPDLLSEFVLFTFGTLILASLVLFVTTTLTRL |
| Ga0209803_11913071 | 3300026332 | Soil | ARRTDMHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL |
| Ga0209804_12125322 | 3300026335 | Soil | MHPEELLKPDLLSEVVLLTFGTLILASLVLFVTTTLARF |
| Ga0209056_100087805 | 3300026538 | Soil | MHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL |
| Ga0209376_13365832 | 3300026540 | Soil | MHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLARF |
| Ga0209474_100131662 | 3300026550 | Soil | MRSNELLKPDLLSEIVLLTFCALILASLVLFVMTTLAQS |
| Ga0209474_105678642 | 3300026550 | Soil | MHPEELMKPDLLSEFVLLTFGTLTLASLVPFVTTTLARL |
| Ga0207443_10126682 | 3300026853 | Soil | GLAPVTRRNNMHPEELMKPDILSEIVLLTFGMIVLSSIGLVVAAALARS |
| Ga0209580_10000007461 | 3300027842 | Surface Soil | MHPEELMKPDLLSEIVLLTFGTLVLSSLLLFVLAAFARP |
| Ga0209580_100067462 | 3300027842 | Surface Soil | MHPEELMKPDLLSEIVLLTFATIILASVLLFFATTLVL |
| Ga0209580_100304723 | 3300027842 | Surface Soil | MHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLVL |
| Ga0209580_103838282 | 3300027842 | Surface Soil | MHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLALS |
| Ga0170834_1112441681 | 3300031057 | Forest Soil | MHPEELMKPDLLSEVVLLAFGTLVLTSLVLCAMTMLARS |
| Ga0170824_1054046592 | 3300031231 | Forest Soil | MHPEELMKPDLLSEVVLFAFGTLVLTSLVLFVITTLARS |
| Ga0310811_106014692 | 3300033475 | Soil | HPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMTTLARS |
| ⦗Top⦘ |