Metagenome / Metatranscriptome Family F044098

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F044098
Family Type	Metagenome / Metatranscriptome
Number of Sequences	155
Average Sequence Length	40 residues
Representative Sequence	MHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLARL
Number of Associated Samples	112
Number of Associated Scaffolds	155

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	78.71 %
% of genes near scaffold ends (potentially truncated)	25.16 %
% of genes from short scaffolds (< 2000 bps)	81.29 %
Associated GOLD sequencing projects	97
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (92.903 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (20.000 % of family members)
Environment Ontology (ENVO)	Unclassified (27.742 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (50.323 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.53
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 155 Family Scaffolds
PF13545	HTH_Crp_2	17.42
PF00027	cNMP_binding	17.42
PF00072	Response_reg	1.94
PF00011	HSP20	1.29
PF13478	XdhC_C	0.65
PF04041	Glyco_hydro_130	0.65
PF13502	AsmA_2	0.65
PF07690	MFS_1	0.65
PF04366	Ysc84	0.65
PF00196	GerE	0.65
PF02371	Transposase_20	0.65
PF12779	WXXGXW	0.65
PF14534	DUF4440	0.65
PF00005	ABC_tran	0.65
PF04542	Sigma70_r2	0.65

COG ID	Name	Functional Category	% Frequency in 155 Family Scaffolds
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	1.29
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.65
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.65
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.65
COG2152	Predicted glycosyl hydrolase, GH43/DUF377 family	Carbohydrate transport and metabolism [G]	0.65
COG2930	Lipid-binding SYLF domain, Ysc84/FYVE family	Lipid transport and metabolism [I]	0.65
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.65
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.65

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	92.90 %
Unclassified	root	N/A	7.10 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	92.90 %
Unclassified	root	N/A	7.10 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	92.90 %
Unclassified	root	N/A	7.10 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	69.03 %
Unclassified	root	N/A	7.10 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	48.39 %
Unclassified	root	N/A	7.10 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	3.87 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	48.39 %
Unclassified	root	N/A	7.10 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	3.87 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	48.39 %
Unclassified	root	N/A	7.10 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3.87 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459016\|G1P06HT02FI15M	Not Available	609	Open in IMG/M
3300004114\|Ga0062593_100213113	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1553	Open in IMG/M
3300004114\|Ga0062593_100829576	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	924	Open in IMG/M
3300004479\|Ga0062595_100341107	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1037	Open in IMG/M
3300004479\|Ga0062595_100932890	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	736	Open in IMG/M
3300004479\|Ga0062595_101647977	All Organisms → cellular organisms → Bacteria → Acidobacteria	601	Open in IMG/M
3300005166\|Ga0066674_10064951	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1665	Open in IMG/M
3300005167\|Ga0066672_10134074	All Organisms → cellular organisms → Bacteria	1542	Open in IMG/M
3300005172\|Ga0066683_10136265	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1503	Open in IMG/M
3300005172\|Ga0066683_10408013	All Organisms → cellular organisms → Bacteria	839	Open in IMG/M
3300005174\|Ga0066680_10137855	All Organisms → cellular organisms → Bacteria	1519	Open in IMG/M
3300005175\|Ga0066673_10172523	All Organisms → cellular organisms → Bacteria → Acidobacteria	1218	Open in IMG/M
3300005175\|Ga0066673_10214380	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1104	Open in IMG/M
3300005176\|Ga0066679_10034640	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2810	Open in IMG/M
3300005177\|Ga0066690_10283041	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1117	Open in IMG/M
3300005178\|Ga0066688_10784177	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	597	Open in IMG/M
3300005179\|Ga0066684_10051619	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2359	Open in IMG/M
3300005179\|Ga0066684_11009168	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	537	Open in IMG/M
3300005180\|Ga0066685_10168613	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1495	Open in IMG/M
3300005187\|Ga0066675_10860366	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	686	Open in IMG/M
3300005329\|Ga0070683_100094698	All Organisms → cellular organisms → Bacteria	2807	Open in IMG/M
3300005329\|Ga0070683_102033325	All Organisms → cellular organisms → Bacteria → Acidobacteria	552	Open in IMG/M
3300005336\|Ga0070680_100057614	All Organisms → cellular organisms → Bacteria	3176	Open in IMG/M
3300005337\|Ga0070682_101371227	All Organisms → cellular organisms → Bacteria → Acidobacteria	603	Open in IMG/M
3300005341\|Ga0070691_10533436	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	683	Open in IMG/M
3300005365\|Ga0070688_100602057	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	841	Open in IMG/M
3300005434\|Ga0070709_10902944	All Organisms → cellular organisms → Bacteria → Acidobacteria	699	Open in IMG/M
3300005434\|Ga0070709_11245514	Not Available	599	Open in IMG/M
3300005435\|Ga0070714_100144053	All Organisms → cellular organisms → Bacteria	2141	Open in IMG/M
3300005435\|Ga0070714_100541062	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1114	Open in IMG/M
3300005435\|Ga0070714_100702146	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	976	Open in IMG/M
3300005436\|Ga0070713_100027539	All Organisms → cellular organisms → Bacteria	4475	Open in IMG/M
3300005436\|Ga0070713_100285702	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1515	Open in IMG/M
3300005436\|Ga0070713_100431030	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1235	Open in IMG/M
3300005436\|Ga0070713_101315138	All Organisms → cellular organisms → Bacteria → Acidobacteria	701	Open in IMG/M
3300005436\|Ga0070713_101752530	All Organisms → cellular organisms → Bacteria	603	Open in IMG/M
3300005437\|Ga0070710_10109428	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1658	Open in IMG/M
3300005439\|Ga0070711_101370959	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	615	Open in IMG/M
3300005445\|Ga0070708_100027716	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4864	Open in IMG/M
3300005456\|Ga0070678_101685974	Not Available	596	Open in IMG/M
3300005529\|Ga0070741_10487177	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1117	Open in IMG/M
3300005542\|Ga0070732_10000090	All Organisms → cellular organisms → Bacteria	84971	Open in IMG/M
3300005542\|Ga0070732_10012870	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4622	Open in IMG/M
3300005542\|Ga0070732_10045757	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2522	Open in IMG/M
3300005542\|Ga0070732_10239997	All Organisms → cellular organisms → Bacteria	1085	Open in IMG/M
3300005542\|Ga0070732_10784348	Not Available	581	Open in IMG/M
3300005547\|Ga0070693_101449797	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	535	Open in IMG/M
3300005552\|Ga0066701_10136583	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1466	Open in IMG/M
3300005556\|Ga0066707_10047306	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2477	Open in IMG/M
3300005559\|Ga0066700_10704225	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	692	Open in IMG/M
3300005560\|Ga0066670_10076129	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1819	Open in IMG/M
3300005560\|Ga0066670_10481861	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	764	Open in IMG/M
3300005568\|Ga0066703_10168086	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1323	Open in IMG/M
3300005569\|Ga0066705_10862899	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	538	Open in IMG/M
3300005614\|Ga0068856_101416021	All Organisms → cellular organisms → Bacteria	709	Open in IMG/M
3300005834\|Ga0068851_10291533	All Organisms → cellular organisms → Bacteria → Acidobacteria	936	Open in IMG/M
3300006028\|Ga0070717_10001332	All Organisms → cellular organisms → Bacteria	16951	Open in IMG/M
3300006028\|Ga0070717_10223827	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1654	Open in IMG/M
3300006028\|Ga0070717_11398132	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	636	Open in IMG/M
3300006028\|Ga0070717_11994257	All Organisms → cellular organisms → Bacteria → Acidobacteria	523	Open in IMG/M
3300006173\|Ga0070716_101109318	Not Available	631	Open in IMG/M
3300006175\|Ga0070712_100775991	Not Available	821	Open in IMG/M
3300006175\|Ga0070712_100790541	All Organisms → cellular organisms → Bacteria → Acidobacteria	814	Open in IMG/M
3300006755\|Ga0079222_11667773	Not Available	609	Open in IMG/M
3300006794\|Ga0066658_10295767	All Organisms → cellular organisms → Bacteria	866	Open in IMG/M
3300006796\|Ga0066665_10211179	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1513	Open in IMG/M
3300006797\|Ga0066659_10176417	All Organisms → cellular organisms → Bacteria	1543	Open in IMG/M
3300006806\|Ga0079220_10824891	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	706	Open in IMG/M
3300006854\|Ga0075425_100037848	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5375	Open in IMG/M
3300006954\|Ga0079219_10400123	All Organisms → cellular organisms → Bacteria	910	Open in IMG/M
3300009012\|Ga0066710_103628799	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	581	Open in IMG/M
3300009093\|Ga0105240_10056327	All Organisms → cellular organisms → Bacteria	4920	Open in IMG/M
3300009162\|Ga0075423_12581258	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	555	Open in IMG/M
3300009545\|Ga0105237_12601383	All Organisms → cellular organisms → Bacteria → Acidobacteria	517	Open in IMG/M
3300010159\|Ga0099796_10065966	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1296	Open in IMG/M
3300010371\|Ga0134125_11114222	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	864	Open in IMG/M
3300010373\|Ga0134128_11705158	All Organisms → cellular organisms → Bacteria → Acidobacteria	693	Open in IMG/M
3300010373\|Ga0134128_13109064	Not Available	510	Open in IMG/M
3300010375\|Ga0105239_13499693	All Organisms → cellular organisms → Bacteria → Acidobacteria	510	Open in IMG/M
3300010396\|Ga0134126_10104702	All Organisms → cellular organisms → Bacteria	3474	Open in IMG/M
3300010396\|Ga0134126_10414795	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1562	Open in IMG/M
3300010396\|Ga0134126_10844200	All Organisms → cellular organisms → Bacteria → Acidobacteria	1033	Open in IMG/M
3300010399\|Ga0134127_13463886	Not Available	517	Open in IMG/M
3300012198\|Ga0137364_10224303	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1383	Open in IMG/M
3300012199\|Ga0137383_10018391	All Organisms → cellular organisms → Bacteria	4814	Open in IMG/M
3300012200\|Ga0137382_10628960	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	767	Open in IMG/M
3300012201\|Ga0137365_10208780	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1458	Open in IMG/M
3300012205\|Ga0137362_11453174	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	572	Open in IMG/M
3300012208\|Ga0137376_10578129	All Organisms → cellular organisms → Bacteria → Acidobacteria	973	Open in IMG/M
3300012210\|Ga0137378_10353676	All Organisms → cellular organisms → Bacteria	1365	Open in IMG/M
3300012210\|Ga0137378_11119644	All Organisms → cellular organisms → Bacteria → Acidobacteria	702	Open in IMG/M
3300012285\|Ga0137370_10303194	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	954	Open in IMG/M
3300012350\|Ga0137372_10081617	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2750	Open in IMG/M
3300012350\|Ga0137372_10857332	All Organisms → cellular organisms → Bacteria → Acidobacteria	648	Open in IMG/M
3300012359\|Ga0137385_11083862	All Organisms → cellular organisms → Bacteria	659	Open in IMG/M
3300012363\|Ga0137390_10308598	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1564	Open in IMG/M
3300012363\|Ga0137390_11069380	All Organisms → cellular organisms → Bacteria	757	Open in IMG/M
3300012371\|Ga0134022_1037219	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	745	Open in IMG/M
3300012951\|Ga0164300_10743132	All Organisms → cellular organisms → Bacteria → Acidobacteria	600	Open in IMG/M
3300012957\|Ga0164303_10076302	All Organisms → cellular organisms → Bacteria	1583	Open in IMG/M
3300013296\|Ga0157374_10735359	All Organisms → cellular organisms → Bacteria	1001	Open in IMG/M
3300013296\|Ga0157374_12401369	All Organisms → cellular organisms → Bacteria → Acidobacteria	554	Open in IMG/M
3300013296\|Ga0157374_12564633	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300013307\|Ga0157372_10043550	All Organisms → cellular organisms → Bacteria	4970	Open in IMG/M
3300013307\|Ga0157372_10410246	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1579	Open in IMG/M
3300013307\|Ga0157372_11575781	All Organisms → cellular organisms → Bacteria	756	Open in IMG/M
3300015261\|Ga0182006_1179100	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	707	Open in IMG/M
3300017656\|Ga0134112_10448067	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	540	Open in IMG/M
3300017994\|Ga0187822_10036709	All Organisms → cellular organisms → Bacteria	1329	Open in IMG/M
3300018431\|Ga0066655_10096843	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1645	Open in IMG/M
3300018433\|Ga0066667_10387871	All Organisms → cellular organisms → Bacteria	1124	Open in IMG/M
3300018433\|Ga0066667_10474869	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1025	Open in IMG/M
3300018433\|Ga0066667_11573634	All Organisms → cellular organisms → Bacteria → Acidobacteria	584	Open in IMG/M
3300018468\|Ga0066662_10012596	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4474	Open in IMG/M
3300018482\|Ga0066669_10584665	All Organisms → cellular organisms → Bacteria	977	Open in IMG/M
3300019870\|Ga0193746_1001243	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1962	Open in IMG/M
3300019877\|Ga0193722_1038334	All Organisms → cellular organisms → Bacteria	1231	Open in IMG/M
3300021445\|Ga0182009_10007452	All Organisms → cellular organisms → Bacteria	3626	Open in IMG/M
3300025905\|Ga0207685_10129748	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1117	Open in IMG/M
3300025906\|Ga0207699_11156911	Not Available	573	Open in IMG/M
3300025911\|Ga0207654_10083600	All Organisms → cellular organisms → Bacteria → Acidobacteria	1928	Open in IMG/M
3300025913\|Ga0207695_10056797	All Organisms → cellular organisms → Bacteria	4071	Open in IMG/M
3300025915\|Ga0207693_10322999	All Organisms → cellular organisms → Bacteria	1208	Open in IMG/M
3300025915\|Ga0207693_10723065	All Organisms → cellular organisms → Bacteria	770	Open in IMG/M
3300025916\|Ga0207663_11209326	All Organisms → cellular organisms → Bacteria → Acidobacteria	608	Open in IMG/M
3300025917\|Ga0207660_10821619	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	758	Open in IMG/M
3300025922\|Ga0207646_10051071	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3700	Open in IMG/M
3300025922\|Ga0207646_11739271	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	535	Open in IMG/M
3300025927\|Ga0207687_11402845	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	600	Open in IMG/M
3300025928\|Ga0207700_10025061	All Organisms → cellular organisms → Bacteria	4136	Open in IMG/M
3300025928\|Ga0207700_11581296	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	580	Open in IMG/M
3300025929\|Ga0207664_10669075	All Organisms → cellular organisms → Bacteria	933	Open in IMG/M
3300025938\|Ga0207704_10867300	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	757	Open in IMG/M
3300025939\|Ga0207665_10780645	Not Available	754	Open in IMG/M
3300025939\|Ga0207665_11313249	All Organisms → cellular organisms → Bacteria → Acidobacteria	577	Open in IMG/M
3300025949\|Ga0207667_10381616	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1436	Open in IMG/M
3300026078\|Ga0207702_11036053	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	814	Open in IMG/M
3300026088\|Ga0207641_10315319	All Organisms → cellular organisms → Bacteria	1481	Open in IMG/M
3300026326\|Ga0209801_1304078	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	567	Open in IMG/M
3300026327\|Ga0209266_1056216	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1905	Open in IMG/M
3300026331\|Ga0209267_1030767	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2569	Open in IMG/M
3300026332\|Ga0209803_1191307	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	764	Open in IMG/M
3300026335\|Ga0209804_1212532	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	786	Open in IMG/M
3300026538\|Ga0209056_10008780	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	10357	Open in IMG/M
3300026540\|Ga0209376_1336583	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	574	Open in IMG/M
3300026550\|Ga0209474_10013166	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	6597	Open in IMG/M
3300026550\|Ga0209474_10567864	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	578	Open in IMG/M
3300026853\|Ga0207443_1012668	All Organisms → cellular organisms → Bacteria → Acidobacteria	505	Open in IMG/M
3300027842\|Ga0209580_10000007	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	613108	Open in IMG/M
3300027842\|Ga0209580_10006746	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	4908	Open in IMG/M
3300027842\|Ga0209580_10030472	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2448	Open in IMG/M
3300027842\|Ga0209580_10383828	All Organisms → cellular organisms → Bacteria → Acidobacteria	700	Open in IMG/M
3300031057\|Ga0170834_111244168	All Organisms → cellular organisms → Bacteria → Acidobacteria	520	Open in IMG/M
3300031231\|Ga0170824_105404659	All Organisms → cellular organisms → Bacteria → Acidobacteria	1632	Open in IMG/M
3300033475\|Ga0310811_10601469	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1105	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	85.16%
Host-Associated	Host-Associated	14.19%
Engineered	Engineered	0.65%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	84.52%
Plants	Host-Associated → Plants	14.19%
Aquatic	Environmental → Aquatic	0.65%
Solid Waste	Engineered → Solid Waste	0.65%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	84.52%
Rhizosphere	Host-Associated → Plants → Rhizosphere	9.68%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.52%
Freshwater	Environmental → Aquatic → Freshwater	0.65%
Grass	Engineered → Solid Waste → Grass	0.65%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	57.42%
Loam	Environmental → Terrestrial → Soil → Loam	27.10%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.68%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.87%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.65%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.65%
Composting	Engineered → Solid Waste → Grass → Composting	0.65%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.81%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	25.81%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	24.52%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.68%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.87%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.29%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.29%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.65%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.65%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.65%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	20.00%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	19.35%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	9.68%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	6.45%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.52%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	4.52%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.23%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.23%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.23%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	3.87%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	2.58%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.58%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.94%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.29%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.29%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.29%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.29%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.65%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.65%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.65%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.65%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459016	Litter degradation ZMR2	Engineered	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental	Open in IMG/M
3300005174	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012371	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Host-Associated	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019870	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1	Environmental	Open in IMG/M
3300019877	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)	Environmental	Open in IMG/M
3300026327	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)	Environmental	Open in IMG/M
3300026331	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)	Environmental	Open in IMG/M
3300026332	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)	Environmental	Open in IMG/M
3300026335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300026540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300026853	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5w-12 (SPAdes)	Environmental	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
2ZMR_04096630	2170459016	Switchgrass, Maize And Mischanthus Litter	MHPEELMKPDLLSEIVLLTFGTLVLSSLVWFAVAALARP
Ga0062593_1002131133	3300004114	Soil	MHPKELMKPDLLSEIVLLTFGTIVLSSVALVVVAAIARS*
Ga0062593_1008295762	3300004114	Soil	MHPEELMKPDILSEIVLLTFGMIVLSSIGLVVAAALARS*
Ga0062595_1003411072	3300004479	Soil	MHPEELMKPDLLSEIVLLTFSTLILAALLLFVTTSLARF*
Ga0062595_1009328902	3300004479	Soil	MHPNELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS*
Ga0062595_1016479772	3300004479	Soil	MHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMTTLARS*
Ga0066674_100649512	3300005166	Soil	MHPQELLKPDLLSEFVLLTFGTLILASLVLFVTTTLARF*
Ga0066672_101340742	3300005167	Soil	MHPEELMKPDLLSEVVLLTFGTLILASLVLFVTITLTRL*
Ga0066683_101362651	3300005172	Soil	MHPEELMKPDLLSEFVLLTFGTLILASLVLFTTTTLARL*
Ga0066683_104080132	3300005172	Soil	MHPQELLKPDLLSEFVLLTFGTLVLASLVLFVTTTLARF*
Ga0066680_101378553	3300005174	Soil	MHPQELLKPDLLSEFVLLTFGTLILASLVLFVTTTLARL*
Ga0066673_101725232	3300005175	Soil	MRSNELMKPDLLSEIVLLTFCALILASLVLFVMTTLAQS*
Ga0066673_102143801	3300005175	Soil	MHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLARL*
Ga0066679_100346401	3300005176	Soil	MHPEELMKPDLLSEFVLFTFGTLILASLVLFVTTTLTRL*
Ga0066690_102830412	3300005177	Soil	MHPEELLKPDLLSEVVLLTFGTLILASLVLFVTTTLARF*
Ga0066688_107841772	3300005178	Soil	MHPEELMKPDLLSEFVLLTFGTLTLASLVLFVTTTLARF*
Ga0066684_100516192	3300005179	Soil	MRSNELLKPDLLSEIVLLTFCALILASLVLFVMTTLAQS*
Ga0066684_110091682	3300005179	Soil	MHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLTQL*
Ga0066685_101686132	3300005180	Soil	MHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLARF*
Ga0066675_108603661	3300005187	Soil	ANRGEQMHPEDLMKPDLLSEIVLSAFGILTFSSLLLFVAAAFARP*
Ga0070683_1000946984	3300005329	Corn Rhizosphere	MHPEELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARS*
Ga0070683_1020333251	3300005329	Corn Rhizosphere	MHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA*
Ga0070680_1000576142	3300005336	Corn Rhizosphere	MHPEELMKPDLLSEIVLLTFGTLVLSSLVWFAVAALARP*
Ga0070682_1013712272	3300005337	Corn Rhizosphere	MHPEELMKPDLLSEVVLFAFGTMVLTSLVLFVMSTLARS*
Ga0070691_105334361	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	RRSDMHPEELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARS*
Ga0070688_1006020573	3300005365	Switchgrass Rhizosphere	MHPKELMKPDLVSEMVLLTFGTLLSSSLVWFVVAALTRP*
Ga0070709_109029442	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEELMKPDLLSEIVLLAFGTLVLTSLVLFAITTLARS*
Ga0070709_112455141	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEELMKPDLLSEVVLLAFGALVLTSFVPCVIRTFART*
Ga0070714_1001440534	3300005435	Agricultural Soil	MHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMSTFARS*
Ga0070714_1005410621	3300005435	Agricultural Soil	MHPEELMRPDLLSEIVLFTFGTLLLSSLVWFVVAALARA*
Ga0070714_1007021462	3300005435	Agricultural Soil	MHPEELMKPDLLSEIVLMTLVTLVLSSLVWFAMAAFARP*
Ga0070713_1000275394	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MHQEEIMKPDLLSEIVLITFGTLMLSSLVWFAMAAFARP*
Ga0070713_1002857022	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMSTLARS*
Ga0070713_1004310303	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEELMKPDLLSEIVLMTLGTLILSSLVWFAMAAFARP*
Ga0070713_1013151382	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEELMKPDLLSEIVLLTFATMILASALLFFATTLTLS*
Ga0070713_1017525302	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEELMRPDLLSEIVLLTFGTLLLSSLVWFVVAALARP*
Ga0070710_101094284	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEELMKPDLLSEVVLLAFGTLVLTSLVLFAITTLARS*
Ga0070711_1013709591	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	QFPGGPVHPADLMKPDLLSEIVLATFATLTLSSLLLFVAVALARP*
Ga0070708_1000277162	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEEIMKPDLLSEIVLLTFATLILASLVLFVATTLARS*
Ga0070678_1016859741	3300005456	Miscanthus Rhizosphere	VIRRINIHPKELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS
Ga0070741_104871771	3300005529	Surface Soil	MHPEELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS*
Ga0070732_100000906	3300005542	Surface Soil	MHPEELMKPDLLSEIVLLTFGTLVLSSLLLFVLAAFARP*
Ga0070732_100128702	3300005542	Surface Soil	MHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLALS*
Ga0070732_100457573	3300005542	Surface Soil	MHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLVL*
Ga0070732_102399972	3300005542	Surface Soil	MHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLALL*
Ga0070732_107843481	3300005542	Surface Soil	MHPEELMKPDLLSEIVLLTFCTLILGSVILFFATTLVLS*
Ga0070693_1014497971	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	KGTDMHPEELMKPDLLSEIVLLAFGTLVLTSLVLFVMSTFARS*
Ga0066701_101365833	3300005552	Soil	ELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL*
Ga0066707_100473063	3300005556	Soil	MHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL*
Ga0066700_107042251	3300005559	Soil	MHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLARL*
Ga0066670_100761293	3300005560	Soil	MHPKELMKTDLLSGVVPFTFGTLILASVVLFVTLARF*
Ga0066670_104818612	3300005560	Soil	MHPEELMKPDLLSEFVLLTFGTLTLASLVPFVTTTLARL*
Ga0066703_101680862	3300005568	Soil	MHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLSQL*
Ga0066705_108628991	3300005569	Soil	MHPEDLMKPDLLSEIVLVTLATLTFSSLLLFVAAAVARP*
Ga0068856_1014160211	3300005614	Corn Rhizosphere	MHPEELMRPDLLSEIVLFTFGTLLLSSLVWFVVAALAR
Ga0068851_102915332	3300005834	Corn Rhizosphere	MHPNELMKPDLLSEIVLLTFGTIVLSSVALVVVAAIARS*
Ga0070717_100013322	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMTTFVRS*
Ga0070717_102238274	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MHRADLLSPDVLSEIVLLAFGTLILASLVLFLVTVFCRV*
Ga0070717_113981321	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	RRNAMHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLALS*
Ga0070717_119942572	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MHPKELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS*
Ga0070716_1011093181	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MHPAEIMKPDVLSEIVLFTFGTLIISSLVLFAMAAFART*
Ga0070712_1007759912	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEDLMKPDLLSEIVLATFATLTVSSLLLFLAVALARP*
Ga0070712_1007905412	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEELMKPDLLSEIVLLAFGTLVLTSLVLFVMTTFARS*
Ga0079222_116677731	3300006755	Agricultural Soil	MHPEELMKPDLLSEIVLLTFGTLVLSSLVWFVVAVLART*
Ga0066658_102957672	3300006794	Soil	MHPEELLKPDLLSEFVLLTFGTLILASLVLFVTTTLTRL*
Ga0066665_102111791	3300006796	Soil	ELLKPDLLSEFVLLTFGTLILASLVLFTTTTLARL*
Ga0066659_101764172	3300006797	Soil	MHPEELLKPDLLSEVVLLTFGTLILASLVLFVTTTLAR
Ga0079220_108248912	3300006806	Agricultural Soil	MHPEELMRPDLLSEIVLFTFGTLLLSSLVWFVVAALARP*
Ga0075425_1000378483	3300006854	Populus Rhizosphere	MHPEELMKPDLLSEIVLLTFGTLIISSLALFVVAILARS*
Ga0079219_104001232	3300006954	Agricultural Soil	MHPEELMKPDLLSEIVLLTFGTLVLSSLVWFAVAALAR
Ga0066710_1036287992	3300009012	Grasslands Soil	MHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLARL
Ga0105240_100563275	3300009093	Corn Rhizosphere	LATGVRRIDMHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA*
Ga0075423_125812581	3300009162	Populus Rhizosphere	AAPVIRRINMHPKELMKPDLLSEIVLLTFGTIVLSSVALVVVAAIARS*
Ga0105237_126013831	3300009545	Corn Rhizosphere	MHPEDLMKPDLLSEIVLLTFGAAVLSSLVLFVAAELARI*
Ga0099796_100659662	3300010159	Vadose Zone Soil	MHPEELMKPDLLSEFVLLTFGTLTLASLVLFVTTMLARF*
Ga0134125_111142222	3300010371	Terrestrial Soil	MHPEELMKPDLLSEIVLLTFGTLVLSSLLWFVVGALARS*
Ga0134128_117051582	3300010373	Terrestrial Soil	MHPEELMKPDLLSEIVLLTFGAAVLSSLVLFVAAALARI*
Ga0134128_131090642	3300010373	Terrestrial Soil	MHPEELMRPDLLSEIVLLTFGTLLLSSLVWFVVAALARL*
Ga0105239_134996932	3300010375	Corn Rhizosphere	LMKPDILSEIVLLTFGMIVLSSIGLVVAAALARS*
Ga0134126_101047022	3300010396	Terrestrial Soil	MHPEELMKPDLLSEVVLWTFGTLVLSSLVWFVVGAFAQS*
Ga0134126_104147953	3300010396	Terrestrial Soil	HPEELMKPDLLSEVVLWTFGTLVLSSLLWFVVGALARS*
Ga0134126_108442002	3300010396	Terrestrial Soil	VAADRRNDMHPEDLMKPDLLSEIVLLTFGAAVLSSLVLFVAAELARI*
Ga0134127_134638861	3300010399	Terrestrial Soil	MHPEDLMKPDLLSEIVLLTFGAAVLSSLVLFVAAE
Ga0137364_102243033	3300012198	Vadose Zone Soil	MHPEELMKPDLLSEFVLLTFGTLILASLVLFATTTLARF*
Ga0137383_100183912	3300012199	Vadose Zone Soil	MHPEELMKPDLLSEIVLLGFATLILASLVLFVATMLARS*
Ga0137382_106289602	3300012200	Vadose Zone Soil	MHPEELLKPDLLSEFVLLTFGTLILASLVLFVTTTLDRF*
Ga0137365_102087802	3300012201	Vadose Zone Soil	MHPEELMKPDLLSEVVLFTFGTLILASLVLFVTLARF*
Ga0137362_114531741	3300012205	Vadose Zone Soil	RRNDMHPEELMKPDLLSEFVLLTFGTLIVASLVLFITTTLARL*
Ga0137376_105781292	3300012208	Vadose Zone Soil	MHPEELLKPDLLSEFVLLTFGTLILASLVLFATTTLARF*
Ga0137378_103536762	3300012210	Vadose Zone Soil	MHPEELMKPDLLSEVVLLTFATLMVASLVLFVATMLARP*
Ga0137378_111196442	3300012210	Vadose Zone Soil	MHPEELMKPDLLSEVVLFTFGTLILASLVLFVTTMLARF*
Ga0137370_103031941	3300012285	Vadose Zone Soil	MHPEELMNPYLRSEFVLLTFGTLTLASLVVFVTTALARF*
Ga0137372_100816172	3300012350	Vadose Zone Soil	MADAAKRNHMHPEEIMKPDLLSEIVLTTFGTLTLSFLVLFAMAAFDRP*
Ga0137372_108573322	3300012350	Vadose Zone Soil	MHPEDVMKSDLFSEIVLLTFGTLTLSSLLLLFVAAALARS*
Ga0137385_110838621	3300012359	Vadose Zone Soil	MHPEDLMKADLLSEIVLLTFAALICVSMVLFVATMVAQS*
Ga0137390_103085981	3300012363	Vadose Zone Soil	MHPEELMKPALLSEIVLLFGTLIIASLVVFVATTLARS*
Ga0137390_110693801	3300012363	Vadose Zone Soil	MHPEELMKPDLLSEFVLLTFGTLTLASLVLFVTTTLA
Ga0134022_10372192	3300012371	Grasslands Soil	MHPQELLKPDLLSEFVLLTFATLILASLVLFVTTTLARF*
Ga0164300_107431321	3300012951	Soil	MHPEEIMKPDLLSEIVLSTFGTLVLSSLVLFVAAALART*
Ga0164303_100763023	3300012957	Soil	MHPEEIMKPDLLSEIVLLTFGTLVLSSLVLFVAAALART*
Ga0157374_107353592	3300013296	Miscanthus Rhizosphere	MHPEELMKPDLLSEIVLFAFGTMVLTSLVLFVMSTLARS*
Ga0157374_124013691	3300013296	Miscanthus Rhizosphere	RLATGVRRIDMHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA*
Ga0157374_125646331	3300013296	Miscanthus Rhizosphere	MHPEELMRPDLLSEIVLLTFGTLLLSSLVWFVVAA
Ga0157372_100435505	3300013307	Corn Rhizosphere	MRPDQLMKPDLLSEIVLLSLGAFVLSSMVLFVAAVLARM*
Ga0157372_104102461	3300013307	Corn Rhizosphere	PEELMKPDLLSEVVLWTFGTLVLSSLVWFVVGAFAQS*
Ga0157372_115757811	3300013307	Corn Rhizosphere	MHLEELMKPDLLSEIVLLTFGTLLLSSLVWFVVAALARP*
Ga0182006_11791001	3300015261	Rhizosphere	NNMHPEELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS*
Ga0134112_104480672	3300017656	Grasslands Soil	RNDMHPEELMKPDLLSEFVLLTFGTLVLASLVLFLTTTLTRL
Ga0187822_100367092	3300017994	Freshwater Sediment	MHPEELMKPDLLSEIVLFTFGTLLLSSLVWFVVEALARP
Ga0066655_100968431	3300018431	Grasslands Soil	MHPEELLKPDLLSEVVLFTFGTLILASLVLFVTTTLARF
Ga0066667_103878711	3300018433	Grasslands Soil	MHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTL
Ga0066667_104748692	3300018433	Grasslands Soil	MTDARRNDMHPEEIMKPDLLSEIVLTTFGTLTLSVLVLFAMAAFARR
Ga0066667_115736342	3300018433	Grasslands Soil	MHPKELMKTDLLSGVVPFTFGTLILASVVLFVTLARF
Ga0066662_100125962	3300018468	Grasslands Soil	MHPEEIMKPDLLSEIVLTPFGTLTLSFLVLFAIAAFARS
Ga0066669_105846652	3300018482	Grasslands Soil	MHPQELLKPDLLSEFVLLTFGALILASFVLFTTTMLARL
Ga0193746_10012432	3300019870	Soil	MRNYMHPEEIMKPDLLSEVVLLAFGTLILASLLLFLTLARF
Ga0193722_10383342	3300019877	Soil	MHPEDLMKPDLLSEIVLSAFGILTFSSLLLFVAAAFARP
Ga0182009_100074523	3300021445	Soil	MHPEELMRPDLLSEIVLLTFGTLLLSSLVWFVVAALARA
Ga0207685_101297482	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	PEELMKPDLLSEIVLLAFGTLVLTSLVLFVMTTFARS
Ga0207699_111569112	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEELMKPDLLSEVVLLAFGALVLTSLVLFVMTTFARS
Ga0207654_100836005	3300025911	Corn Rhizosphere	ELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARS
Ga0207695_100567974	3300025913	Corn Rhizosphere	MHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA
Ga0207693_103229991	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	VHPADLMKPDLLSEIVLATFATLTLSSLLLFVAVALARP
Ga0207693_107230652	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEDLMKPDLLSEIVLATFATLTVSSLLLFLAVALARP
Ga0207663_112093261	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MAELRLEPEHPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMTTFVRS
Ga0207660_108216192	3300025917	Corn Rhizosphere	VIRRDNMHPNELMKPDLLSEIVLLTFGMIVLSSVALVVVAAIARS
Ga0207646_100510712	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEEIMKPDLLSEIVLLTFATLILASLVLFVATTLARS
Ga0207646_117392711	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	EELMKADLLSEIVLLTFGTLILASLVLFVATMLARS
Ga0207687_114028452	3300025927	Miscanthus Rhizosphere	RRSDMHPEELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARS
Ga0207700_100250614	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEELMKPDLLSEIVLLTFATMILASALLFFATTLTLS
Ga0207700_115812962	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	PAFPGGPVHPADLMKPDLLSEIVLATFATLTLSSLLLFVAVALARP
Ga0207664_106690752	3300025929	Agricultural Soil	MHPEELMRPDLLSEIVLFTFGTLLLSSLVWFVVAALARA
Ga0207704_108673003	3300025938	Miscanthus Rhizosphere	RINMHPKELMKPDLLSEIVLLTFGTIVLSSVALVVVAAIARS
Ga0207665_107806451	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MHPAEIMKPDVLSEIVLFTFGTLIISSLVLFAMAAFART
Ga0207665_113132492	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MHPEEIMKPDLLSEIVLLTFGTLVLSSLVLFVAAALART
Ga0207667_103816161	3300025949	Corn Rhizosphere	TGVRRIDMHPEELMSPDLLSEIVLLTLGTLLLSSLVWFVVAALAPA
Ga0207702_110360531	3300026078	Corn Rhizosphere	AWRSNMHPEELMKPDLLSEIVLFAFGTMVLTSLVLFVMSTLARS
Ga0207641_103153193	3300026088	Switchgrass Rhizosphere	MHPEELMKPDLLSEIVLLTFGTLVLSSLVLAIVAALARSSRA
Ga0209801_13040782	3300026326	Soil	AVAARRTDMHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL
Ga0209266_10562163	3300026327	Soil	MHPQELLKPDLLSEFVLLTFGTLILASLVLFTTTTLARL
Ga0209267_10307674	3300026331	Soil	MHPEELMKPDLLSEFVLFTFGTLILASLVLFVTTTLTRL
Ga0209803_11913071	3300026332	Soil	ARRTDMHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL
Ga0209804_12125322	3300026335	Soil	MHPEELLKPDLLSEVVLLTFGTLILASLVLFVTTTLARF
Ga0209056_100087805	3300026538	Soil	MHPEELLKPDLLSEFVLLTFGTLILASLVLFTTTTLVRL
Ga0209376_13365832	3300026540	Soil	MHPEELMKPDLLSEFVLLTFGTLILASLVLFVTTTLARF
Ga0209474_100131662	3300026550	Soil	MRSNELLKPDLLSEIVLLTFCALILASLVLFVMTTLAQS
Ga0209474_105678642	3300026550	Soil	MHPEELMKPDLLSEFVLLTFGTLTLASLVPFVTTTLARL
Ga0207443_10126682	3300026853	Soil	GLAPVTRRNNMHPEELMKPDILSEIVLLTFGMIVLSSIGLVVAAALARS
Ga0209580_10000007461	3300027842	Surface Soil	MHPEELMKPDLLSEIVLLTFGTLVLSSLLLFVLAAFARP
Ga0209580_100067462	3300027842	Surface Soil	MHPEELMKPDLLSEIVLLTFATIILASVLLFFATTLVL
Ga0209580_100304723	3300027842	Surface Soil	MHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLVL
Ga0209580_103838282	3300027842	Surface Soil	MHPEELMKPDLLSEIVLLTFATMILASVLLFFATTLALS
Ga0170834_1112441681	3300031057	Forest Soil	MHPEELMKPDLLSEVVLLAFGTLVLTSLVLCAMTMLARS
Ga0170824_1054046592	3300031231	Forest Soil	MHPEELMKPDLLSEVVLFAFGTLVLTSLVLFVITTLARS
Ga0310811_106014692	3300033475	Soil	HPEELMKPDLLSEVVLLAFGTLVLTSLVLFVMTTLARS

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F044098

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences