| Basic Information | |
|---|---|
| Family ID | F044077 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 155 |
| Average Sequence Length | 47 residues |
| Representative Sequence | VIKIAGRVLSLVALAALATPVHGEDDFPLVGTYTENQACKPNG |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.62 % |
| % of genes near scaffold ends (potentially truncated) | 89.68 % |
| % of genes from short scaffolds (< 2000 bps) | 80.65 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.387 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.710 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.097 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.452 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 23.94% β-sheet: 0.00% Coil/Unstructured: 76.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF09955 | DUF2189 | 8.39 |
| PF10503 | Esterase_PHB | 1.29 |
| PF04392 | ABC_sub_bind | 1.29 |
| PF01575 | MaoC_dehydratas | 0.65 |
| PF12850 | Metallophos_2 | 0.65 |
| PF04311 | DUF459 | 0.65 |
| PF06577 | EipA | 0.65 |
| PF13607 | Succ_CoA_lig | 0.65 |
| PF13426 | PAS_9 | 0.65 |
| PF03928 | HbpS-like | 0.65 |
| PF00126 | HTH_1 | 0.65 |
| PF02798 | GST_N | 0.65 |
| PF00144 | Beta-lactamase | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.29 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.65 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.65 |
| COG2845 | Peptidoglycan O-acetyltransferase, SGNH hydrolase family | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.39 % |
| Unclassified | root | N/A | 11.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101325445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 729 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1061998 | Not Available | 662 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10080773 | Not Available | 695 | Open in IMG/M |
| 3300000955|JGI1027J12803_108512867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300001989|JGI24739J22299_10188349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300002568|C688J35102_118468946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300002910|JGI25615J43890_1012629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1371 | Open in IMG/M |
| 3300002911|JGI25390J43892_10124471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300004633|Ga0066395_10001269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9060 | Open in IMG/M |
| 3300005181|Ga0066678_10319283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1020 | Open in IMG/M |
| 3300005332|Ga0066388_100437731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1950 | Open in IMG/M |
| 3300005332|Ga0066388_102091227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1018 | Open in IMG/M |
| 3300005332|Ga0066388_102411020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 954 | Open in IMG/M |
| 3300005332|Ga0066388_105139016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
| 3300005332|Ga0066388_105455259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300005332|Ga0066388_108230161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300005334|Ga0068869_101239052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300005356|Ga0070674_100222628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1468 | Open in IMG/M |
| 3300005363|Ga0008090_15868168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 782 | Open in IMG/M |
| 3300005456|Ga0070678_101600546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300005467|Ga0070706_100089971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2846 | Open in IMG/M |
| 3300005549|Ga0070704_100710621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 892 | Open in IMG/M |
| 3300005614|Ga0068856_100620910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1102 | Open in IMG/M |
| 3300005713|Ga0066905_101132542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300005764|Ga0066903_105739780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300005764|Ga0066903_106285581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300005764|Ga0066903_108047226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300005842|Ga0068858_100777832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 933 | Open in IMG/M |
| 3300005937|Ga0081455_10504178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 812 | Open in IMG/M |
| 3300006046|Ga0066652_100449948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1185 | Open in IMG/M |
| 3300006175|Ga0070712_100367410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1181 | Open in IMG/M |
| 3300006175|Ga0070712_101025211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 715 | Open in IMG/M |
| 3300006358|Ga0068871_100678468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 943 | Open in IMG/M |
| 3300006580|Ga0074049_13079778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300006606|Ga0074062_12139261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300006844|Ga0075428_100152033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2514 | Open in IMG/M |
| 3300006844|Ga0075428_101367738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300006880|Ga0075429_100741120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 861 | Open in IMG/M |
| 3300009011|Ga0105251_10218488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 858 | Open in IMG/M |
| 3300009036|Ga0105244_10595597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300009167|Ga0113563_11211894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 879 | Open in IMG/M |
| 3300010043|Ga0126380_10654494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 837 | Open in IMG/M |
| 3300010046|Ga0126384_11570145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300010048|Ga0126373_11957877 | Not Available | 649 | Open in IMG/M |
| 3300010360|Ga0126372_10313008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1387 | Open in IMG/M |
| 3300010361|Ga0126378_13371313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300010371|Ga0134125_10777939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1054 | Open in IMG/M |
| 3300010396|Ga0134126_12742296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300010398|Ga0126383_10046047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3598 | Open in IMG/M |
| 3300010398|Ga0126383_11731634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 714 | Open in IMG/M |
| 3300010398|Ga0126383_12832403 | Not Available | 566 | Open in IMG/M |
| 3300010868|Ga0124844_1001260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae | 3216 | Open in IMG/M |
| 3300010868|Ga0124844_1025484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila | 1806 | Open in IMG/M |
| 3300012208|Ga0137376_11615933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300012356|Ga0137371_10235924 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300012359|Ga0137385_11032054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 678 | Open in IMG/M |
| 3300012915|Ga0157302_10415914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300012923|Ga0137359_10168191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1956 | Open in IMG/M |
| 3300012960|Ga0164301_10566963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 832 | Open in IMG/M |
| 3300012971|Ga0126369_13054201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300013306|Ga0163162_11797797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
| 3300014497|Ga0182008_10749573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300014969|Ga0157376_10188623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1889 | Open in IMG/M |
| 3300015371|Ga0132258_13493526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1077 | Open in IMG/M |
| 3300015372|Ga0132256_100519878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1302 | Open in IMG/M |
| 3300015373|Ga0132257_100174891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2530 | Open in IMG/M |
| 3300016371|Ga0182034_11330984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300016387|Ga0182040_11086727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
| 3300016404|Ga0182037_10014025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae | 4719 | Open in IMG/M |
| 3300017792|Ga0163161_10644384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 877 | Open in IMG/M |
| 3300018072|Ga0184635_10134611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 985 | Open in IMG/M |
| 3300018073|Ga0184624_10128694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1101 | Open in IMG/M |
| 3300018082|Ga0184639_10400160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300018465|Ga0190269_10125244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1294 | Open in IMG/M |
| 3300018469|Ga0190270_12523542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300018482|Ga0066669_11120452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 710 | Open in IMG/M |
| 3300021444|Ga0213878_10121516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1071 | Open in IMG/M |
| 3300021560|Ga0126371_10251575 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| 3300021560|Ga0126371_12814095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300025899|Ga0207642_10922373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300025906|Ga0207699_11343462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300025912|Ga0207707_11423859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300025915|Ga0207693_10188198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1625 | Open in IMG/M |
| 3300025923|Ga0207681_10626611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 890 | Open in IMG/M |
| 3300025941|Ga0207711_12019431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300026023|Ga0207677_11626820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300026078|Ga0207702_10940798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 857 | Open in IMG/M |
| 3300026118|Ga0207675_101777549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300026319|Ga0209647_1080021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1618 | Open in IMG/M |
| 3300026552|Ga0209577_10399553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 990 | Open in IMG/M |
| 3300027909|Ga0209382_10911439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 924 | Open in IMG/M |
| 3300028589|Ga0247818_11308209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300028712|Ga0307285_10013734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1784 | Open in IMG/M |
| 3300028713|Ga0307303_10145525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300028715|Ga0307313_10067442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1065 | Open in IMG/M |
| 3300028720|Ga0307317_10229374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 627 | Open in IMG/M |
| 3300028768|Ga0307280_10123753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300028771|Ga0307320_10035182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1830 | Open in IMG/M |
| 3300028784|Ga0307282_10072110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1571 | Open in IMG/M |
| 3300028793|Ga0307299_10300003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300028802|Ga0307503_10866640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300028811|Ga0307292_10153762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 930 | Open in IMG/M |
| 3300028814|Ga0307302_10049444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1956 | Open in IMG/M |
| 3300028875|Ga0307289_10221257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 778 | Open in IMG/M |
| 3300028878|Ga0307278_10011825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4074 | Open in IMG/M |
| 3300031226|Ga0307497_10606371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300031668|Ga0318542_10646172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300031680|Ga0318574_10081815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae | 1762 | Open in IMG/M |
| 3300031681|Ga0318572_10231398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1084 | Open in IMG/M |
| 3300031681|Ga0318572_10402256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 814 | Open in IMG/M |
| 3300031681|Ga0318572_10813478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300031719|Ga0306917_10097051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2106 | Open in IMG/M |
| 3300031724|Ga0318500_10596326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
| 3300031736|Ga0318501_10581226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300031744|Ga0306918_10094366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2114 | Open in IMG/M |
| 3300031744|Ga0306918_10402504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1066 | Open in IMG/M |
| 3300031769|Ga0318526_10187467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300031771|Ga0318546_10886320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300031781|Ga0318547_10789855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300031795|Ga0318557_10568069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300031819|Ga0318568_11001309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300031833|Ga0310917_11045937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300031846|Ga0318512_10019105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2802 | Open in IMG/M |
| 3300031846|Ga0318512_10515819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300031860|Ga0318495_10023738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2645 | Open in IMG/M |
| 3300031890|Ga0306925_10243955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila | 1936 | Open in IMG/M |
| 3300031890|Ga0306925_10907876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 905 | Open in IMG/M |
| 3300031941|Ga0310912_11524142 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031945|Ga0310913_10048619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2760 | Open in IMG/M |
| 3300031945|Ga0310913_10337275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1066 | Open in IMG/M |
| 3300031947|Ga0310909_11676020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300031954|Ga0306926_10242869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2232 | Open in IMG/M |
| 3300031954|Ga0306926_11209107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 887 | Open in IMG/M |
| 3300032001|Ga0306922_10601797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1164 | Open in IMG/M |
| 3300032008|Ga0318562_10683026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300032054|Ga0318570_10023122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2381 | Open in IMG/M |
| 3300032060|Ga0318505_10058511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1670 | Open in IMG/M |
| 3300032063|Ga0318504_10020049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae | 2515 | Open in IMG/M |
| 3300032076|Ga0306924_12622442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300034151|Ga0364935_0107736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 860 | Open in IMG/M |
| 3300034818|Ga0373950_0071218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.58% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.29% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.29% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.29% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.65% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.65% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1013254453 | 3300000364 | Soil | VIKLAGSMLSLVALVVLAAPVHGEDDFPLVGTYTENQA |
| AF_2010_repII_A100DRAFT_10619981 | 3300000655 | Forest Soil | MIKVAGRMLSLVALAVLATSVHGEDDFPLVGTYTENQAC |
| AF_2010_repII_A001DRAFT_100807732 | 3300000793 | Forest Soil | MIKVAGRMLSLVALAVLATSVHGEDDFPLVGTYTENQACK |
| JGI1027J12803_1085128671 | 3300000955 | Soil | VIKQVIKLAASMLSLVVLAVLATSVHGEDDFPLVGTYTENQA |
| JGI24739J22299_101883491 | 3300001989 | Corn Rhizosphere | VIKGAATALSIVALATLATPVLGEDDFPLVGTYTENQVCKGDGSDSGVSRVKITG |
| C688J35102_1184689461 | 3300002568 | Soil | VIKGAATALSIVAFAMFATPTLGEDDFPLVGTYTENQVCKGDGSDSGVSRVK |
| JGI25615J43890_10126291 | 3300002910 | Grasslands Soil | VVKLAASMLSIVVLAVLATSVQGEDDFPLVGTYTENQACKPNGSDPGVS |
| JGI25390J43892_101244712 | 3300002911 | Grasslands Soil | VIKVAAKVLTIVALTALATPVRAEDDFPIVGTYTENQACKLDGADPG |
| Ga0066395_100012691 | 3300004633 | Tropical Forest Soil | MIKVAGRVLSLVALAALATPVHGEDDFPLVGTYTENQACKTDGSDPGV |
| Ga0066678_103192831 | 3300005181 | Soil | MLSLVALAALATPVHAEDDFPLVGTYTENQACKMDGSDPG |
| Ga0066388_1004377311 | 3300005332 | Tropical Forest Soil | MKATGKVLTIVALVALVTPLHADDDFPIVGTYTENQACKPADPDSSVSRVKITLHD |
| Ga0066388_1020912272 | 3300005332 | Tropical Forest Soil | MSLVALAALATPVHGEDDFPLVGTYTENQACKRDGSDPGVSRVKITPRDID* |
| Ga0066388_1024110202 | 3300005332 | Tropical Forest Soil | VIKLAGRALGILALAALTTPVHGEDDFPLVGTYTENQACKPNGSDPGVSRVTITPRD |
| Ga0066388_1051390163 | 3300005332 | Tropical Forest Soil | VIKIAGRVLSLVALAALATPVHGEDDFPLVGTYTENQACKPNG |
| Ga0066388_1054552592 | 3300005332 | Tropical Forest Soil | VIKLAARALGILALAALATPVHGEDDFPLVGTYTENQACKPNGSDPGVSRVTITPRD |
| Ga0066388_1082301612 | 3300005332 | Tropical Forest Soil | VIKVAGRVLSLVALAALATPVHGEDDFPLVGTYTENQACKTDGSDPGVSRVKITP |
| Ga0068869_1012390521 | 3300005334 | Miscanthus Rhizosphere | VIKGAAKALSIVAFAMFATPVLGEDDFPLVGTYTENQVCKGDGSDSGVSRVKITGRDI |
| Ga0070674_1002226281 | 3300005356 | Miscanthus Rhizosphere | VIKGAAKALSIVAFAMFATPVLGEDDFPLVGTYTENQVCKGDGSDSGVSRVKITGRDIDSVF |
| Ga0008090_158681681 | 3300005363 | Tropical Rainforest Soil | VKRLKVIKVAGRVLSLVALAALPTPVHGEDDFPLVGTYTENQACKTDGSD |
| Ga0070678_1016005462 | 3300005456 | Miscanthus Rhizosphere | VIKGAATALSVAALAMLATPVVGEDDFPLVGTYTENQVCKGDGSDSGVSRVKITG |
| Ga0070662_1015564302 | 3300005457 | Corn Rhizosphere | MPVTARMLGIVALGILASPVLAADDFPLVGTYTENKVCNADSFNSGVSRVKITDGNIDS |
| Ga0070706_1000899714 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VIKQVIKLAASMLSLVVLAVLATSVHGEDDFPLVGTYTENQACKPNGSD |
| Ga0070704_1007106212 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VRVIKVAVRVLTIAALATLATPLLGEDDFPLVGTYTENQAC |
| Ga0068856_1006209102 | 3300005614 | Corn Rhizosphere | VIKGAATALSVVALAMFATPVLGEDDLPLVGTYTENQVCKGDGSDSGVSRVKITG |
| Ga0066905_1011325422 | 3300005713 | Tropical Forest Soil | VIKVAARVLGVIALAALGTAAPGEEDFPIVGTYTENQVCKGDGSDSGVSRV |
| Ga0066903_1057397801 | 3300005764 | Tropical Forest Soil | MIKVAGRVLSLVALAALATPVHGEDDFPLVGTYTENQACKTDGSDPGVSRV |
| Ga0066903_1062855812 | 3300005764 | Tropical Forest Soil | MKATGRVLTIVALAALATPLHADDDFPIVGTYTENQACKPADPDSSVSRVKITLHD |
| Ga0066903_1072313671 | 3300005764 | Tropical Forest Soil | VIKLQVIKLQVIKLAASMLSLVALAVLATPVHGEDDFPLIGTYTENQACK |
| Ga0066903_1080472261 | 3300005764 | Tropical Forest Soil | VVKVAARMLGVIALAALGTAAPGEEDFPIVGTYTENQVCKGDGSDSGVSRVKI |
| Ga0066903_1087488923 | 3300005764 | Tropical Forest Soil | VIKLKAIKLQVINLQAMKLAASMLSLVALAGLATPVHGEDDFPLIGTY |
| Ga0068858_1007778322 | 3300005842 | Switchgrass Rhizosphere | VIKVAVRVLTIAALATLATPLLGEDDFPLVGTYTE |
| Ga0081455_105041782 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VVKVAARVLGVIALAALGTAAPGEEDFPIVGTYTENQVCKGDGSD |
| Ga0066652_1004499481 | 3300006046 | Soil | VIKVAAKVLTIVALAALATPVRAEDDFPIVGTYTENQACKPDGADPGVSRVKITSRDID |
| Ga0070712_1003674104 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKVAGRVLSLVALAALATPVHGEDDFPLVGTYTENQACKPNGSD |
| Ga0070712_1010252111 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VIKLAASMLSLVVLAALAAPVHGEDDFPLVGTYTENQACKPNGS |
| Ga0068871_1006784682 | 3300006358 | Miscanthus Rhizosphere | VIKGAATALSIVALATLATPVLGEDDFPLVGTYTENQVCKGDGSDSGVSRVKI |
| Ga0074049_130797781 | 3300006580 | Soil | VIKGAATALSIVALATLATPVLGEDDFPLVGTYTENQVCKG |
| Ga0074062_121392612 | 3300006606 | Soil | VVKLAASMLSLVALAALATPVHGEDDFPLVGTYTENQACKPNGSDPGVSRVTITPRDI |
| Ga0075428_1001520331 | 3300006844 | Populus Rhizosphere | VIKVAARVLGVIALAALGTPAPGEEDFPLVGTYTENQVCKGDGSDSGVSRVKIT |
| Ga0075428_1013677382 | 3300006844 | Populus Rhizosphere | VIKVAAKVLTIVALLSLATPVHAEDDFPIVGTYTENQ |
| Ga0075429_1007411203 | 3300006880 | Populus Rhizosphere | VIKVAAKVLTIVALLSLATPVHAEDDFPIVGTYTENQVCKV |
| Ga0105251_102184882 | 3300009011 | Switchgrass Rhizosphere | VIKGAATALSIVALATLATPVLGEDDFPLVGTYTENQVC |
| Ga0105244_105955972 | 3300009036 | Miscanthus Rhizosphere | VIKGAATALSIVALATLATPVLGEDDFPLVGTYTENQVCKGDGSDSGV |
| Ga0113563_112118942 | 3300009167 | Freshwater Wetlands | VRVIKVAVRVLTIAALATLATPLLGEDDFPLVGTYTENQA |
| Ga0105242_125643531 | 3300009176 | Miscanthus Rhizosphere | MLGIVALGTFASPILGADDFPLVGTYTENQVCKADSSSVSRVTITLGDID |
| Ga0126380_106544941 | 3300010043 | Tropical Forest Soil | MKLAGRVLSIVVLAVLASPVQAEDDFPIVGTYTENQVCKPDGTNPGVSRVKITSRDI |
| Ga0126384_115701451 | 3300010046 | Tropical Forest Soil | VIKVAGRVLSIVALAALATPVHGGDDFPLVGTYTENQACKTDGSDGGVSR |
| Ga0126373_119578772 | 3300010048 | Tropical Forest Soil | MIKVAGRVLSLVALAALATPVHGEDDFPLVGTYTENQ |
| Ga0126372_103130084 | 3300010360 | Tropical Forest Soil | MIKVAGGVLSLVALAALATPVHGEDDFPLVGTYTENQAC |
| Ga0126378_133713132 | 3300010361 | Tropical Forest Soil | MKATGKVLTIVALVALVTPLHADDDFPIVGTYTENQACKPADPDSSVSRV |
| Ga0134125_107779392 | 3300010371 | Terrestrial Soil | VIKGAATALSIAALAMLATPVVGEDDFPLVGTYTENQVCKGDGSDSGVSRVKITGRDIDSVF |
| Ga0134126_127422962 | 3300010396 | Terrestrial Soil | VIKGAATALSIVGLATLATPVLGEDDFPLVGTYTENQ |
| Ga0126383_100460475 | 3300010398 | Tropical Forest Soil | MKLAGRLLSIVVLAMLASQVQAEDDFPIVGTYTENQACK |
| Ga0126383_117316341 | 3300010398 | Tropical Forest Soil | MKATGKVLTIVALVALVTPLHADDDFPIVGTYTENQACKPADPDSSVSRVKITLHDIES |
| Ga0126383_128324032 | 3300010398 | Tropical Forest Soil | VRKQTATILSVVALAALATPVLGEDEFPLVGTYTENQACTPG |
| Ga0124844_10012601 | 3300010868 | Tropical Forest Soil | VVKLAGRVLSILALAALATPVQGQDDFPLVGTYTENQACKTDG |
| Ga0124844_10254843 | 3300010868 | Tropical Forest Soil | VVKLAGRVLSILALAALATPVQGQDDFPLVGTYTENQACKTDGS |
| Ga0137376_116159332 | 3300012208 | Vadose Zone Soil | MKLAGRLLSIVVLAMLASQVQAEDDFPIVGTYTENQACKPDGSD |
| Ga0137371_102359245 | 3300012356 | Vadose Zone Soil | MKRLMIKVAGRVLSLVALAALATPVHGEEDFPLVGTYTENQACKT |
| Ga0137385_110320541 | 3300012359 | Vadose Zone Soil | VKRLKVIKVAGRVLSLVALAALATSVHGEDDFPLVGTYTENQACKTDG |
| Ga0150984_1120260181 | 3300012469 | Avena Fatua Rhizosphere | MLGIVALGMFALTVLGADDFPLVGTYTEDQVCRADSPDSGVPRVNITVRHIDSRFGLC |
| Ga0157302_104159142 | 3300012915 | Soil | VRVIKVAVRVLTIAALATLATPLLGEDDFPLVGTYTENQACKGDGSDS |
| Ga0137359_101681911 | 3300012923 | Vadose Zone Soil | VKRLKVIKVAGRVLSLVALAALATPVHGEDDFPLVGTYTENQACKTD |
| Ga0164301_105669632 | 3300012960 | Soil | VIKGAATALSIVGLATLATPVLGEDDFPLVGTYTEN |
| Ga0126369_130542011 | 3300012971 | Tropical Forest Soil | MKAIGKVLTIVALAALATPLHADDDFPIVGTYTENQACKPADPDSSV |
| Ga0163162_117977972 | 3300013306 | Switchgrass Rhizosphere | MLGIVALGILASPVLAADDFPLVGTYTENKVCNADSFNSGVSRVKI |
| Ga0182008_107495731 | 3300014497 | Rhizosphere | VRVIKVAVRVLTIAALATLATPLLGEDDFPLVGTYTENQ |
| Ga0157376_101886234 | 3300014969 | Miscanthus Rhizosphere | VIKGAATALSIVALAMLATPVLGEDDFPLVGTYTENQVCKGDG |
| Ga0132258_134935262 | 3300015371 | Arabidopsis Rhizosphere | MLSIVALGTFASPILGADDFPLVGTYTENQVCKADS |
| Ga0132256_1005198781 | 3300015372 | Arabidopsis Rhizosphere | VIKVAVRVLTIAALATLATPLLGEDDFLLVGTYTENQACKGDGSDSGYRA* |
| Ga0132257_1001748913 | 3300015373 | Arabidopsis Rhizosphere | MKLAGRLLSIVVLAVLASQVQAEDDFPIVGTYTENQVCKPDGSDPGVSRVK |
| Ga0182034_113309842 | 3300016371 | Soil | VIKVAGRMMSLVALAALATPVHGEDDFPLVGTYTENQACKTDGSDPGVSRVKIT |
| Ga0182040_110867272 | 3300016387 | Soil | VIKIAGRVLSLVALAALATPVHGEDDFPLVGTYTENQACKPNGSDPGVSRVTITPRDI |
| Ga0182037_100140251 | 3300016404 | Soil | MVSGGRGQVVKLAGRVLSILALAALATPVQGQDDFPLVGTYTENQACKTDGSD |
| Ga0163161_106443841 | 3300017792 | Switchgrass Rhizosphere | MKLAGRVLSIVALAVLASPVQAEDDFPIVGTYTENQVCKPDGTNPSVSRVKITT |
| Ga0184635_101346112 | 3300018072 | Groundwater Sediment | VIRVAGRVLSIVALVTLATPVLGEDDFPLVGTYTENQVCK |
| Ga0184624_101286942 | 3300018073 | Groundwater Sediment | VIKGAAKALSIVAFAMFATPVLGEDDFPLVGTYTENQVCKGDGSDSGVSRVKI |
| Ga0184639_104001602 | 3300018082 | Groundwater Sediment | VIKGAAKALSIVAFAMFATPVLGEDDFPLVGTYTENQVCKGDGSDSGVS |
| Ga0190269_101252442 | 3300018465 | Soil | VIKGAATALSIVALAMLATPVLGEDDFPLVGTYTENQVC |
| Ga0190270_105385871 | 3300018469 | Soil | MLGIVALGMFASTVLGADDFPLVGTYTEDQVCRADSPDSGVPRVKITVRH |
| Ga0190270_125235421 | 3300018469 | Soil | MLGIVALATFASPVLGADDFPLVGTYTENQVCKTDSSDP |
| Ga0066669_111204522 | 3300018482 | Grasslands Soil | VIKVAASLLAAVALASLAAPVVGEDDFPLVGTYTENQVCKGDASDAGVSRVKITS |
| Ga0213877_100338512 | 3300021372 | Bulk Soil | VRKLQVIKLQVIKLQVIKLAGGMLGLVALAALATPVHGEDDFPLVGTYT |
| Ga0213878_101215161 | 3300021444 | Bulk Soil | VRKLQVIKLQVIKLQVIKLAGGMLGLVALAALATPVHGEDDFPLVGTYTENQACKPNGSDPGVSRVTITP |
| Ga0126371_102515753 | 3300021560 | Tropical Forest Soil | MIKVAGRVLSLVALAALATPVHGEDDFPLVGTYTENQACKTDGSDP |
| Ga0126371_128140951 | 3300021560 | Tropical Forest Soil | MKLAGRLLSIVVLTMLASQVQAEDDFPIVGTYTENQ |
| Ga0207642_109223732 | 3300025899 | Miscanthus Rhizosphere | VIKGAATALSIVALATLATPVLGEDDFPLVGTYTENQVCKGDGSDSGVSRVK |
| Ga0207699_113434621 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VIKGAATALSIVALATLATPVLGEDDFPLVGTYTENQVCKGDGSDSGVSRVKIT |
| Ga0207707_114238591 | 3300025912 | Corn Rhizosphere | VIKGAATALSIVALATLATPVLGEDDFPLVGTYTENQVCKGD |
| Ga0207693_101881985 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VKRLMIKVAGRVLSLVALAALATPVHGEDDFPLVGT |
| Ga0207681_106266111 | 3300025923 | Switchgrass Rhizosphere | VIKGAATALSIVALATLATPVLGEDDFPLVGTYTENQVCKGDGS |
| Ga0207706_114165401 | 3300025933 | Corn Rhizosphere | MLGIVALGILASPVLAADDFPLVGTYTENKVCNADSFNSGVSRVKITDGNIDS |
| Ga0207711_120194311 | 3300025941 | Switchgrass Rhizosphere | VIKVAVRVLTIAALATLATPLLGEDDFPLVGTYTENQACKGDGSDS |
| Ga0207677_116268202 | 3300026023 | Miscanthus Rhizosphere | VIKVAVRVLTIAALATLATPLLGEDDFPLVGTYTEN |
| Ga0207702_109407981 | 3300026078 | Corn Rhizosphere | VIKVAVRVLTIAALATLATPLLGEDDFPLVGTYTENQACKG |
| Ga0207675_1017775492 | 3300026118 | Switchgrass Rhizosphere | VIKGAAKALSIVAFAMFATPVLGEDDFPLVGTYTENQVCKGDGSDSGVSRVKIT |
| Ga0209647_10800214 | 3300026319 | Grasslands Soil | VIKVAGRVLSLVALAALATPVHGEDDFPLVGTYTENQACKTDGSDTGVSRVKI |
| Ga0209577_103995531 | 3300026552 | Soil | VIKLAASMLSLVALAALATPVHAEDDFPLVGTYTENQACKPNGSDPGV |
| Ga0209382_109114391 | 3300027909 | Populus Rhizosphere | VIKVAAKVLTIVALLSLATPVHAEDDFPIVGTYTENQVCKVDGP |
| Ga0247818_113082092 | 3300028589 | Soil | VIKGAATALSIVALATLATPVLGEDDFPLVGTYTENQVCK |
| Ga0307285_100137343 | 3300028712 | Soil | VIKGAATALSIVAFAMFATPTLGEDDFPLVGTYTENQVC |
| Ga0307303_101455252 | 3300028713 | Soil | VIKGAFTALSIVALAMLATPVLGEDDFPLVGTYTENQ |
| Ga0307313_100674422 | 3300028715 | Soil | VIRVAGRVLSIVALVTLATPVLGEDDFPLVGTYTENQVCKGDGS |
| Ga0307317_102293743 | 3300028720 | Soil | MLGIVALATFASPVLGADDFPLVGTYTENQVCKADGSDLGVSRVK |
| Ga0307280_101237531 | 3300028768 | Soil | VIRVAGRVLSIVALVTLATPVLGEDDFPLVGTYTEN |
| Ga0307320_100351821 | 3300028771 | Soil | VIRVAGRVLSIVALVTLATPVLGEDDFPLVGTYTENQVCKGDGSDSGVSRVK |
| Ga0307282_100721103 | 3300028784 | Soil | MKLAGRVLSIVALAVLASPVQAEDDFPIVGTYTENQVCKS |
| Ga0307299_103000031 | 3300028793 | Soil | VIRVAGRVLSIVALVTLATPVLGEDDFPLVGTYTE |
| Ga0307503_108666401 | 3300028802 | Soil | MLGIVALATFASPVLGADDFPLVGTYTENQVCKADGSDL |
| Ga0307292_101537622 | 3300028811 | Soil | VIRVAGRVLSIVALVTLATPVLGEDDFPLVGTYTENQACKG |
| Ga0307302_100494441 | 3300028814 | Soil | VIRVAGRVLSIVALVTLATPVLGEDDFPLVGTYTENQA |
| Ga0307289_102212571 | 3300028875 | Soil | VIRVAGRVLSVVALVTLATPVLGEDDFPLVGTYTENQVCKGDGSDSGVSRVK |
| Ga0307278_100118255 | 3300028878 | Soil | VIKVAKRVLGLVALAALATPAHGGDDFPLVGTYTENHACKADGSDPG |
| Ga0307497_106063711 | 3300031226 | Soil | VIKGAATALSIVALATLATPVLGEDDFPLVGTYTENQVCKGDGSDSGVSR |
| Ga0318534_103048902 | 3300031544 | Soil | VIKLQVIKLQVIKLAASMLSLVALAVLATPVHGEDDFPLIGTYTENQACKPNG |
| Ga0318542_106461721 | 3300031668 | Soil | VIKLQLIKLQAIKLAASMLSLVALAALATPVHGEDDFPLIGIYTENQACKPNGSDPGVSRVTITAR |
| Ga0318574_100818151 | 3300031680 | Soil | VIKLAASMLSLVALAALATPVHGEDDFPLIGTYTENQACKPNGSDPGVSRVTIT |
| Ga0318572_102313981 | 3300031681 | Soil | VIKLAPSMLSLVALAALATPVHGEDDFPLIGTYTENQACRPNGSDPGVSRVT |
| Ga0318572_104022561 | 3300031681 | Soil | VIKVAGRVLSLVALAALATPAHGEDDFPLVGTYTENQACKTDGSDRGVSRVKI |
| Ga0318572_108134781 | 3300031681 | Soil | MIKVAGRVLSLVALAALATQVHGEDDFPLVGTYTENQAC |
| Ga0306917_100970511 | 3300031719 | Soil | VIKIAGRVLSLVALAALATPVHGEDDFPLVGTYTENQACKPNGSDPGVSR |
| Ga0318500_105963261 | 3300031724 | Soil | VIKVAGRVLSLVALAALATPAHGEDDFPLVGTYTENQA |
| Ga0318501_105812262 | 3300031736 | Soil | VIKLAASMLSLVALAALATPVHGEDDFPLIGTYTENQACKPNGSDPGV |
| Ga0306918_100943664 | 3300031744 | Soil | VIKQVIKLAASMLSLVALAVLATPVHGEDDFPLIGTYTENQACKPNGSDPGVSRVTITARDI |
| Ga0306918_104025041 | 3300031744 | Soil | VIKLQVIKLQVIKLAASMLSLVALAVLATPVHGEDDFPLIGTYTENQACKPNGSDPG |
| Ga0318509_100029611 | 3300031768 | Soil | VIKLQLIKLQAIKLAASMLSLVALAALATPVHGEDDFPLIGIYTENQACK |
| Ga0318526_101874672 | 3300031769 | Soil | VIKLAPSMLSFVALAALATPVHGEDDFPLIGTYTENQACRPNGSDPGVSRVT |
| Ga0318546_108863201 | 3300031771 | Soil | VIKQVIKLAASMLSLIALAALAAPVHGEDDFPLVGTYTDNQACKPNGSDPGVSRVT |
| Ga0318547_107898552 | 3300031781 | Soil | VIKLAASMLSLVALAALATPVHGEDDFPLIGTYTENQACKPN |
| Ga0318557_105680692 | 3300031795 | Soil | VIKQVIKLAASMLSLVALAVLATPVHGEDDFPLIGTYTENQACKPNGSDPGVSRVT |
| Ga0318568_110013092 | 3300031819 | Soil | VIKQVIKLAASMLSLVALAVLATPVHGEDDFPLIGTYTENQACKPNGSD |
| Ga0318564_101489502 | 3300031831 | Soil | VIKLQVIKLQVIKLAASMLSLVALAALATPVHGEDDFPLIGTYT |
| Ga0310917_110459371 | 3300031833 | Soil | VIKQVIKLAASMLSLVALAALATPVHGDDDFPLVGTYTENQA |
| Ga0318512_100191054 | 3300031846 | Soil | VIKLQVIKLAGGMLSLVTLAALATPMHGEDDFPLVGTYTEN |
| Ga0318512_105158192 | 3300031846 | Soil | MKATGKVLTIVALVALVTPLHADDDFPIVGTYTENQACKPADPDSSVSRVKITLHDIE |
| Ga0318495_100237381 | 3300031860 | Soil | VIRQVIKLAGSMLSLVVLAVLATPVQGEDDFPLVGTYTENQACKTDGSDPGV |
| Ga0306925_102439551 | 3300031890 | Soil | VIKQVIKLAASMLSLVALAVLATPVHGEDDFPLIGTYTENQACKPN |
| Ga0306925_109078761 | 3300031890 | Soil | VIKQVIKLAASMLSLIALAALAAPVHGEDDFPLVGT |
| Ga0310912_115241422 | 3300031941 | Soil | VIKVAGRMMSLVALAALATPVHGEDDFPLVGTYTENQACKTDG |
| Ga0310913_100486194 | 3300031945 | Soil | VIKQVIKLAASMLSLVALAVLATPVHGEDDFPLIGTYTENQACKPNGSDPGVSRGT |
| Ga0310913_103372751 | 3300031945 | Soil | VIKLAASMLSLVVLAALATPVHGEDDFPLVGTYTENQACKPNGSDPGVSRVTITPRD |
| Ga0310909_116760201 | 3300031947 | Soil | VIRQVIKLAGSMLSLVVLAVLATPVQGEDDFPLVGTY |
| Ga0306926_102428691 | 3300031954 | Soil | VIKQVIKLAASMLSLVALAVLATPVHGEDDFPLIGTYTENQACKPNGSDPGVSRVTITA |
| Ga0306926_112091072 | 3300031954 | Soil | VIKLQLIKLQAIKLAASMLSLVALAALATPVHGEDDFPLIGIYTENQACKPNGSDPGVSRVTI |
| Ga0306922_106017972 | 3300032001 | Soil | VIKLAPSMLSFVALAALATPVHGEDDFPLIGTYTENQACRPNGS |
| Ga0318562_106830262 | 3300032008 | Soil | VIRQVIKLAGSMLSLVVLAVLATPVQGEDDFPLVGTYTENQACKTDGS |
| Ga0318570_100231221 | 3300032054 | Soil | VIKLAPSMLSLVALAALATPVHGEDDFPLIGTYTENQA |
| Ga0318575_105953542 | 3300032055 | Soil | VIKLQLIKLQAIKLAASMLSLVALAALATPVHGEDDFPLIGIYTENQACKPN |
| Ga0318505_100585111 | 3300032060 | Soil | VIKLQVIKLQVIKLAASMLSLVALAALATPVHGEDDFPLIGTYTENQACKPNGSDPG |
| Ga0318504_100200495 | 3300032063 | Soil | MVSGGRGQVVKLAGRVLSILALAALATPVQGQDDFPLVGTYTENQA |
| Ga0318553_103352472 | 3300032068 | Soil | VIKLQLIKLQAIKLAASMLSLVALAALATPVHGEDDFPLIGTYTENQACKPNGSD |
| Ga0306924_102552081 | 3300032076 | Soil | VIKLQLIKLQAIKLAASMLSLVALAALATPVHGEDDFPLIGIYTENQACKPNGS |
| Ga0306924_126224421 | 3300032076 | Soil | VIKQVIKLAASMLSLIALAALAAPVHGEDDFPLVGTYTENQAC |
| Ga0364935_0107736_2_127 | 3300034151 | Sediment | MIKGAAKALSIVAFAMFATPVLGVDDFPLVGTYTENQVCKGD |
| Ga0373950_0071218_1_159 | 3300034818 | Rhizosphere Soil | VIKGAATALSIVGLATLATPVLGEDDFPLVGTYTENQVCKGDGSDSGVSRVKI |
| ⦗Top⦘ |