NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F044071

Metagenome Family F044071

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044071
Family Type Metagenome
Number of Sequences 155
Average Sequence Length 45 residues
Representative Sequence GRFAEPIWPELKPAKLFRLAFRDKGRLVDSTEHPLFKKWAARDRD
Number of Associated Samples 107
Number of Associated Scaffolds 155

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.29 %
% of genes near scaffold ends (potentially truncated) 97.42 %
% of genes from short scaffolds (< 2000 bps) 96.13 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.774 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(30.323 % of family members)
Environment Ontology (ENVO) Unclassified
(55.484 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.129 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.29%    β-sheet: 5.48%    Coil/Unstructured: 71.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 155 Family Scaffolds
PF00476DNA_pol_A 7.74
PF06841Phage_T4_gp19 0.65
PF12840HTH_20 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 155 Family Scaffolds
COG0749DNA polymerase I, 3'-5' exonuclease and polymerase domainsReplication, recombination and repair [L] 7.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.77 %
UnclassifiedrootN/A3.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_11111908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1289Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10056851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51007Open in IMG/M
3300002245|JGIcombinedJ26739_100702451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5890Open in IMG/M
3300005332|Ga0066388_103965480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5755Open in IMG/M
3300005332|Ga0066388_106932660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5570Open in IMG/M
3300005355|Ga0070671_100737942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5855Open in IMG/M
3300005435|Ga0070714_100924614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5847Open in IMG/M
3300005471|Ga0070698_100925219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria818Open in IMG/M
3300005713|Ga0066905_101260926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria663Open in IMG/M
3300005718|Ga0068866_10888328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5626Open in IMG/M
3300005764|Ga0066903_101732291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1191Open in IMG/M
3300005764|Ga0066903_101800349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51170Open in IMG/M
3300005764|Ga0066903_102530514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5994Open in IMG/M
3300005764|Ga0066903_108892485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5509Open in IMG/M
3300006175|Ga0070712_100603557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria929Open in IMG/M
3300006175|Ga0070712_101306607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria632Open in IMG/M
3300006845|Ga0075421_102146553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5591Open in IMG/M
3300006881|Ga0068865_101113636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5696Open in IMG/M
3300007076|Ga0075435_101888656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5524Open in IMG/M
3300009522|Ga0116218_1163450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51009Open in IMG/M
3300009698|Ga0116216_10582250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5675Open in IMG/M
3300009826|Ga0123355_11516505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5652Open in IMG/M
3300010043|Ga0126380_11755060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5559Open in IMG/M
3300010362|Ga0126377_12700106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5571Open in IMG/M
3300010375|Ga0105239_13224188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5531Open in IMG/M
3300010376|Ga0126381_101910372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria856Open in IMG/M
3300010376|Ga0126381_101942879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5848Open in IMG/M
3300012208|Ga0137376_10333376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1317Open in IMG/M
3300012357|Ga0137384_10931703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5699Open in IMG/M
3300012359|Ga0137385_10309239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51358Open in IMG/M
3300012948|Ga0126375_11329457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria605Open in IMG/M
3300012955|Ga0164298_10674242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria721Open in IMG/M
3300012971|Ga0126369_12492252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5603Open in IMG/M
3300012985|Ga0164308_12196068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5514Open in IMG/M
3300013297|Ga0157378_10353273All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300013306|Ga0163162_10577195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1252Open in IMG/M
3300014501|Ga0182024_10966844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51019Open in IMG/M
3300014969|Ga0157376_10490858All Organisms → cellular organisms → Bacteria → Proteobacteria1205Open in IMG/M
3300014969|Ga0157376_11527311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria701Open in IMG/M
3300016270|Ga0182036_11902591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5505Open in IMG/M
3300016294|Ga0182041_10530020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51026Open in IMG/M
3300016294|Ga0182041_10689927All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5904Open in IMG/M
3300016319|Ga0182033_12108705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5514Open in IMG/M
3300016341|Ga0182035_11252997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5663Open in IMG/M
3300016341|Ga0182035_11733038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5565Open in IMG/M
3300016357|Ga0182032_10552868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5952Open in IMG/M
3300016357|Ga0182032_11216933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5648Open in IMG/M
3300016357|Ga0182032_11583147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5570Open in IMG/M
3300016357|Ga0182032_11755447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5542Open in IMG/M
3300016371|Ga0182034_11518936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5587Open in IMG/M
3300016404|Ga0182037_11630789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5574Open in IMG/M
3300016422|Ga0182039_10159386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51758Open in IMG/M
3300016422|Ga0182039_10249564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51445Open in IMG/M
3300016422|Ga0182039_10612126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5953Open in IMG/M
3300016445|Ga0182038_10518486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51019Open in IMG/M
3300016445|Ga0182038_11552737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5595Open in IMG/M
3300017932|Ga0187814_10081855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51185Open in IMG/M
3300017942|Ga0187808_10289072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5737Open in IMG/M
3300017942|Ga0187808_10605713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5509Open in IMG/M
3300017995|Ga0187816_10417222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5598Open in IMG/M
3300018432|Ga0190275_10061454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3184Open in IMG/M
3300018468|Ga0066662_11936662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5617Open in IMG/M
3300018469|Ga0190270_13397612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5505Open in IMG/M
3300018481|Ga0190271_11631768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5760Open in IMG/M
3300021178|Ga0210408_10069977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S52744Open in IMG/M
3300021401|Ga0210393_10870396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5732Open in IMG/M
3300021405|Ga0210387_11885507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5502Open in IMG/M
3300021478|Ga0210402_11012219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5758Open in IMG/M
3300021479|Ga0210410_11074062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5695Open in IMG/M
3300021560|Ga0126371_11280050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5867Open in IMG/M
3300025929|Ga0207664_10924637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5783Open in IMG/M
3300025939|Ga0207665_11441974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300025960|Ga0207651_11865872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5541Open in IMG/M
3300026833|Ga0207728_114317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5729Open in IMG/M
3300026839|Ga0207764_120828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5585Open in IMG/M
3300026928|Ga0207779_1034727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5591Open in IMG/M
3300026979|Ga0207817_1007034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51333Open in IMG/M
3300026997|Ga0207784_1021747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5666Open in IMG/M
3300027043|Ga0207800_1031577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5772Open in IMG/M
3300027698|Ga0209446_1175804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5552Open in IMG/M
3300027703|Ga0207862_1088805Not Available930Open in IMG/M
3300027703|Ga0207862_1168963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria653Open in IMG/M
3300027812|Ga0209656_10396588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5619Open in IMG/M
3300028807|Ga0307305_10529161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5527Open in IMG/M
3300028811|Ga0307292_10156436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5923Open in IMG/M
3300031545|Ga0318541_10072899Not Available1805Open in IMG/M
3300031546|Ga0318538_10390331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5753Open in IMG/M
3300031561|Ga0318528_10066307All Organisms → cellular organisms → Bacteria → Proteobacteria1852Open in IMG/M
3300031561|Ga0318528_10428685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria710Open in IMG/M
3300031564|Ga0318573_10187252All Organisms → cellular organisms → Bacteria → Proteobacteria1095Open in IMG/M
3300031564|Ga0318573_10570305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300031572|Ga0318515_10610624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5579Open in IMG/M
3300031681|Ga0318572_10356440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5868Open in IMG/M
3300031719|Ga0306917_10060877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2579Open in IMG/M
3300031719|Ga0306917_10648481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria830Open in IMG/M
3300031719|Ga0306917_11131525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5609Open in IMG/M
3300031720|Ga0307469_10844718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria844Open in IMG/M
3300031736|Ga0318501_10327182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5821Open in IMG/M
3300031744|Ga0306918_10269415All Organisms → cellular organisms → Bacteria1304Open in IMG/M
3300031744|Ga0306918_10349765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51146Open in IMG/M
3300031744|Ga0306918_10539297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria914Open in IMG/M
3300031744|Ga0306918_11117338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5610Open in IMG/M
3300031748|Ga0318492_10529425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5626Open in IMG/M
3300031763|Ga0318537_10196826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5750Open in IMG/M
3300031763|Ga0318537_10311256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5582Open in IMG/M
3300031771|Ga0318546_10851045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5642Open in IMG/M
3300031795|Ga0318557_10450379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5592Open in IMG/M
3300031805|Ga0318497_10446099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5724Open in IMG/M
3300031819|Ga0318568_10346130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5925Open in IMG/M
3300031833|Ga0310917_10603185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5745Open in IMG/M
3300031833|Ga0310917_10905647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5593Open in IMG/M
3300031835|Ga0318517_10462003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5572Open in IMG/M
3300031845|Ga0318511_10463109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5585Open in IMG/M
3300031846|Ga0318512_10590822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5566Open in IMG/M
3300031879|Ga0306919_10575637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria869Open in IMG/M
3300031879|Ga0306919_10869259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5692Open in IMG/M
3300031890|Ga0306925_10788254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5987Open in IMG/M
3300031894|Ga0318522_10256723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria662Open in IMG/M
3300031896|Ga0318551_10470257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria719Open in IMG/M
3300031910|Ga0306923_11172633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5823Open in IMG/M
3300031910|Ga0306923_12010639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5586Open in IMG/M
3300031912|Ga0306921_10206331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S52303Open in IMG/M
3300031912|Ga0306921_10265145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S52012Open in IMG/M
3300031912|Ga0306921_10946379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria975Open in IMG/M
3300031912|Ga0306921_11771620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria665Open in IMG/M
3300031941|Ga0310912_10103882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S52098Open in IMG/M
3300031941|Ga0310912_10292325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51260Open in IMG/M
3300031941|Ga0310912_11119171All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria601Open in IMG/M
3300031946|Ga0310910_10269994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51334Open in IMG/M
3300031947|Ga0310909_10773612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5794Open in IMG/M
3300031954|Ga0306926_10755816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51175Open in IMG/M
3300031954|Ga0306926_11810567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria693Open in IMG/M
3300031954|Ga0306926_12533887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5561Open in IMG/M
3300031954|Ga0306926_12834984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5523Open in IMG/M
3300032001|Ga0306922_11134756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria799Open in IMG/M
3300032001|Ga0306922_11436512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5692Open in IMG/M
3300032001|Ga0306922_12124865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5543Open in IMG/M
3300032044|Ga0318558_10387037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5695Open in IMG/M
3300032055|Ga0318575_10723033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300032059|Ga0318533_10248215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1284Open in IMG/M
3300032059|Ga0318533_10551660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5845Open in IMG/M
3300032059|Ga0318533_10557038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5841Open in IMG/M
3300032060|Ga0318505_10183477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria977Open in IMG/M
3300032076|Ga0306924_10380865Not Available1616Open in IMG/M
3300032076|Ga0306924_11450934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria730Open in IMG/M
3300032076|Ga0306924_11545440Not Available702Open in IMG/M
3300032076|Ga0306924_12385414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5534Open in IMG/M
3300032091|Ga0318577_10181497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1005Open in IMG/M
3300032091|Ga0318577_10311538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria753Open in IMG/M
3300032261|Ga0306920_102184384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5770Open in IMG/M
3300032261|Ga0306920_103093568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5625Open in IMG/M
3300032261|Ga0306920_104432770Not Available503Open in IMG/M
3300033289|Ga0310914_10234238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51647Open in IMG/M
3300033289|Ga0310914_10461941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S51149Open in IMG/M
3300033289|Ga0310914_11661336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5542Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil30.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.39%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil9.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.52%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.58%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.58%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.94%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.29%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.29%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.29%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.29%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.65%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.65%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026833Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes)EnvironmentalOpen in IMG/M
3300026839Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes)EnvironmentalOpen in IMG/M
3300026928Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes)EnvironmentalOpen in IMG/M
3300026979Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes)EnvironmentalOpen in IMG/M
3300026997Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 66 (SPAdes)EnvironmentalOpen in IMG/M
3300027043Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1111190823300000363SoilPAGRFGDPQWPDLKPAKIFKLAFRDRGRLVDSVEHPLFKKWAARDSD*
AF_2010_repII_A1DRAFT_1005685123300000597Forest SoilPAPAGRFADPVWPVLKPAKIFRLAFRDKGRLVDSPEHPLFQKWAARDSN*
JGIcombinedJ26739_10070245123300002245Forest SoilRFGEPQWPDLKPAKVFRLAFRDKGRLIDNVHHPLFAKWAARDADK*
Ga0066388_10396548013300005332Tropical Forest SoilDPIWPELKPAKIFRLAFKDKGRLIDSPQHPLFLRWAARDKA*
Ga0066388_10693266013300005332Tropical Forest SoilRFADPIWPPLTNGKIFRLAFRDKGRLIDSPEHALFQKWAARDRDAG*
Ga0070671_10073794233300005355Switchgrass RhizosphereDEPQWPQLSEAKIFRLCFRDKGRLIDSTEHELFKKWAARDKDK*
Ga0070714_10092461423300005435Agricultural SoilEPIWPQLKPAKIFRLAFREKGRLVDSIEHPLFQRWAARDKDQ*
Ga0070698_10092521913300005471Corn, Switchgrass And Miscanthus RhizospherePQWPMLKPAKIFRLAFRDKNRLIDSAEHTLFQKWAARDRDPV*
Ga0066905_10126092613300005713Tropical Forest SoilAPEGRFDDPVWPELKHAKIFRLGFKDKGRLIDSVDHPLFQRWAARDSKE*
Ga0068866_1088832823300005718Miscanthus RhizospherePQWPMLKQAKIFRLAFRDKNRLIDSPEHTLFQKWAARDRDPV*
Ga0066903_10173229113300005764Tropical Forest SoilGRYADPIWPELTHAKIFRLAFRDKGRLIDSTEHPLFKKWAAHDAE*
Ga0066903_10180034913300005764Tropical Forest SoilVFPAPAGRFPDPIWPELKPAKIFRLAFRDKGRLIDSAEHPLFQRWAARDKDPM*
Ga0066903_10253051413300005764Tropical Forest SoilPSDPIWPELKHAKIFRLAFRDKGRLIDSPEHPLFKKWAARDR*
Ga0066903_10889248513300005764Tropical Forest SoilAGRFDDPIWPALKPAKIFRLAFRDKGRLVNSPDHALFKKWAARDRG*
Ga0070712_10060355723300006175Corn, Switchgrass And Miscanthus RhizosphereWPELSHAKVFRLGFRDKGRLIDSTQHPLFLKWAARDHDK*
Ga0070712_10130660713300006175Corn, Switchgrass And Miscanthus RhizosphereGRFAEPVWPELKHAKIFRLAFRDRGRLVDSPEHPLFQKWAARDKDAV*
Ga0075421_10214655313300006845Populus RhizosphereKPAKIFRLAFRDKNRLIDSPDHTLFQKWAARDREPA*
Ga0068865_10111363613300006881Miscanthus RhizosphereLKPAKIFKLAFRDKGRLIDSTEHPLFLKWAARDVDK*
Ga0075435_10188865623300007076Populus RhizosphereFSDPQWPDLKPAKIFKLAFRDKGRLVDSVEHPLFKKWAARDSE*
Ga0116218_116345013300009522Peatlands SoilAPVRRFPDPVWPELKPAKIFRLAFRDRGRLIDSVNHELFQRWAARDKPE*
Ga0116216_1058225013300009698Peatlands SoilPAPPGRFTDPLWPELKPAKIFKLAFRDKGRLVDSTEHPLFKKWSARDSD*
Ga0123355_1151650513300009826Termite GutWPDLSPAKIFRLAFRDRGHLIDSGEHPLFKKWAARDDD*
Ga0126380_1175506013300010043Tropical Forest SoilFSDPIWPELKQAKIFRVAFRDKGRMVDTPDHPLFLKWAARDKSK*
Ga0126377_1270010613300010362Tropical Forest SoilPAPAGRFADPIWPVLKPAKIFRLAFRDKGRLVDSTEHPLFQKWAARDSN*
Ga0105239_1322418823300010375Corn RhizosphereDLTYAKIFRLAFRDKGRLLDSTEHPLFLKWAARDIDK*
Ga0126381_10191037223300010376Tropical Forest SoilQWPDLKQSKIFRLAFRDKGRLIDSIEHSLFKKWAARDSD*
Ga0126381_10194287943300010376Tropical Forest SoilWPELKPAKIFRLAFKDKGRLIDSPQHPLFLRWAARDKA*
Ga0137376_1033337623300012208Vadose Zone SoilPNPVWPDLKPATIFRLAFRDKGRLLDSVEHPLFKKWAGRDSD*
Ga0137384_1093170323300012357Vadose Zone SoilCYKVFPAPAGRFSDPLFPDLKEAKIFRLAFRDKGRLIDSVEHPLFKKWAARDSQ*
Ga0137385_1030923923300012359Vadose Zone SoilDGRFSDPIFPELKHAKIFRLAFRDKGRMIDSTNHPLFLKWAARDKSE*
Ga0126375_1132945723300012948Tropical Forest SoilPQFPMLKPAKIFRLAFRDKNRLIDSTEHTLFQKWAARDRDPV*
Ga0164298_1067424223300012955SoilMLKEAKIFRLAFRDKNRLIDSPEHTLFQKWAARDRDPA*
Ga0126369_1249225223300012971Tropical Forest SoilDPIWPELKPAKIFRLAFRDKGRMIDSNSHPLFLKWAACDKSK*
Ga0164308_1219606813300012985SoilGRFGEPKFPDLKPAKLFKLTFRDKGRLIDSPEHPLFLKWAARDVDK*
Ga0157378_1035327333300013297Miscanthus RhizosphereRFGEPQFPDLKPAKIFKLAFRDKGRLIDSPEHSLFLKWSARDIDK*
Ga0163162_1057719523300013306Switchgrass RhizosphereFPAPADRFGAPQWPMLKQAKIFRLAFRDKNRLIDSTEHTLFQKWAARDRDPV*
Ga0182024_1096684413300014501PermafrostDRFGMPQFPDLTPARAFRLAFRDKGHLIDSTEHPLFRKWAARDVD*
Ga0157376_1049085813300014969Miscanthus RhizosphereWPALKEAKIFRLAFRDKGRLIDSTEHTLFKKWAARDSE*
Ga0157376_1152731113300014969Miscanthus RhizospherePDLKESKIFRLGFRDKGRLLDSTEHPLFKKWAARDSQ*
Ga0182036_1190259113300016270SoilFSDPIWPELKQAKIFRVAFRDKGRMVDSPNHPLFLKWAARDQSK
Ga0182041_1053002023300016294SoilWPELKDAKIFRLAFRDKGRLVDSTTHPLFLKWAARDRSK
Ga0182041_1068992723300016294SoilWPDLKPSRVFKLAFRDKGRLVDSVQHPLFLKWAALDAA
Ga0182033_1210870513300016319SoilARRFDEPQFPEIKEAKIFRLAFRDKGRLLDSTEHALFKKWAARDSNDAK
Ga0182035_1125299723300016341SoilFANPIWPELKHAKIFRLGFRDKGRLIDSPEHPLFKKWAARDRT
Ga0182035_1173303813300016341SoilKPAKIFKLAFRDKGRLIDSPEHPLFQRWAARDKDPA
Ga0182032_1055286813300016357SoilTAPAGRFSEPQWPELKEAKIFGLAFRDKGRLVDSAEHPLFKKWAARDSD
Ga0182032_1121693323300016357SoilELSEAKIFRLAFRDKGRLIDSTEHALFKKWAARDSEDTK
Ga0182032_1158314723300016357SoilCYKVFPAPAGRFDEPQWPELKEAKIFRLAFRDKGRLVDSPEHPLFKKWAARDSD
Ga0182032_1175544713300016357SoilKPAKIFKLAFRDKGRLIDGEQHRLLQRWAARDKDPA
Ga0182034_1151893623300016371SoilEPVWPELKQARIFKLAFRDKGRLVDSTEHSLFKKWAARDTN
Ga0182037_1163078913300016404SoilNRCYKVFTAPAGRFSEPQWPELKEAKIFRLAFRDKGRLVDSAEHPLFKKWAARDSD
Ga0182039_1015938623300016422SoilAGRFSDPIWPELKQAKIFRVAFRDKGRMVDTPDHPLFLKWAARDKSK
Ga0182039_1024956413300016422SoilKVFEAPADRFAEAIWPELKDAKIFRLAFRDKGRLVDSTTHPLFLKWAARDRSK
Ga0182039_1061212623300016422SoilVFPAPAGRFDEPLWPELKDAKIFRLAFRDKGHLIDSTEHPLFKKWAARDTDGK
Ga0182038_1051848623300016445SoilSDPIWPELKQAKIFRVAFRDKGRMVDSPTHPLFLKWAARDQSK
Ga0182038_1155273723300016445SoilFADPIWPELPEAKIFRLAFRDKGHLIDSTDHALFKKWAARDSD
Ga0187814_1008185513300017932Freshwater SedimentFPAPAQRFDDPQWPELKPAKIFRLAFRDKGRLIDSPEHPLFQKWAARDTD
Ga0187808_1028907223300017942Freshwater SedimentGRFPAEAQWPNLKHAKIYKLGFRDKGRLLDSTEHALFKKWAARDSD
Ga0187808_1060571313300017942Freshwater SedimentRFSDPQWPELKPAKIFKLAFRDKGRLVDTTEHPLFKKWAARDSN
Ga0187816_1041722223300017995Freshwater SedimentAQWPNLKHAKIYKLGFRDKGRLLDSTEHALFKKWAARDSD
Ga0190275_1006145413300018432SoilARRFGEPQFPELKAAKIFKLGFRDKGRLIDSTEHPLFLKWAARDTDK
Ga0066662_1193666223300018468Grasslands SoilCYQVFPAPAGRFAEPTWPDLKPAKIFKLAFRDKGRLVDSTEHALFKKWAARDSD
Ga0190270_1339761213300018469SoilPAPAGRFDDPTWPPMSEAKIFRLCFRDKGRMLDSTEHALFKKWAARDR
Ga0190271_1163176833300018481SoilLKPAKIFKLAFRDKGRLIDSPEHPLFLKWAARDIDK
Ga0210408_1006997743300021178SoilPAPAGRFGEPQWPELKHAKIFRLAFRDKGRLVDSTEHPLFKKWAARDSD
Ga0210393_1087039613300021401SoilKVFTAPHGRFDEKPPWLNLKPAKIFRLAFRDRGNLIDSREHALFKKLAARDSD
Ga0210387_1188550713300021405SoilGRFGEPQFPELKDAKIFKLAFRDKGRLLDSAEHPLFKKWAARDAD
Ga0210402_1101221923300021478SoilENPPWLNLKPAKIFRLAFRDRGNLIDSREHALFKKLAARDSD
Ga0210410_1107406213300021479SoilAPPERFGDPQWPLLSPAKIIRYAFRDKGRLIDSTEHSMFLKWTARDRKDG
Ga0126371_1128005023300021560Tropical Forest SoilWPELKEAKIFRLAFRDKDRLVDSVEHPLFKKWAARDSD
Ga0207664_1092463723300025929Agricultural SoilEPIWPQLKPAKIFRLAFREKGRLVDSIEHPLFQRWAARDKDQ
Ga0207665_1144197413300025939Corn, Switchgrass And Miscanthus RhizosphereMAGSLGAAPAGRFGEPQWPELKHAKIFRLAFRDKGRLVDSTEHPLFKKWAARDSD
Ga0207651_1186587223300025960Switchgrass RhizosphereKPAKIFKLAFRDKGRLIDSMEHPLFLKWAARDTDK
Ga0207728_11431713300026833Tropical Forest SoilPAGRFAEPIWPELKPAKYFRLAFRDKGRLVDSTEHPLFKKWAARDRD
Ga0207764_12082813300026839Tropical Forest SoilPAPAGRFAEPIWPELKPAKYFRLAFRDKGRLVDSTEHPLFKKWAARDRD
Ga0207779_103472713300026928Tropical Forest SoilGRFAEPIWPELKPAKLFRLAFRDKGRLVDSTEHPLFKKWAARDRD
Ga0207817_100703423300026979Tropical Forest SoilVYKVFPAPAGRFAEPIWPELKPAKYFRLAFRDKGRLVDSTEHPLFKKWAARDRD
Ga0207784_102174713300026997Tropical Forest SoilGVYKVFPAPAGRFAEPIWPELKPAKLFRLAFRDKGRLVDSTEHPLFKKWAARDRD
Ga0207800_103157713300027043Tropical Forest SoilAEPIWPELKPAKYFRLAFRDKGRLVDSTEHPLFKKWAARDRD
Ga0209446_117580423300027698Bog Forest SoilPGRFTDPLWPELKPAKIFKLAFRDKGRLVDSTEHPLFKKWSARDSD
Ga0207862_108880533300027703Tropical Forest SoilPDLSHAKIFKLSFRARGHLIDSPEHALFKKWAARDTDNDK
Ga0207862_116896333300027703Tropical Forest SoilELKEAKIFRLAFRDKGRLVDSVEHPLFKKWAARDSD
Ga0209656_1039658813300027812Bog Forest SoilPAPPGRFTDPLWPELKPAKIFKLAFRDKGRLVDSTEHPLFKKWAARDAG
Ga0307305_1052916113300028807SoilIWPALKPSKIFRMAFRDKGRLVDSPDHPLFLKWAARDC
Ga0307292_1015643623300028811SoilDPIWPELKPAKIFRLAFRDKGRLIDSPEHPLFLKWAAKDAKDNRG
Ga0318541_1007289923300031545SoilAPQWPILKPAKIFRLAFRDKNRLIDSPEHTLFQKWAARDRDPA
Ga0318538_1039033113300031546SoilPGRFADPIWLDLKPGKIFRLAFRDKGRLIDSPEHPLFKKWAARDR
Ga0318528_1006630733300031561SoilDPTWPDLKPARIFKLAFRDKGRLLDSVEHPLFKKWVARDAE
Ga0318528_1042868523300031561SoilLKPAKIFRLAFRDKNRLIDSPEHTLFQKWAARDRDPA
Ga0318573_1018725233300031564SoilYKVFPAPAGRYADPIWPELKQAKIFRLAFRDKGRLVDSPQHELFKKWAARDTD
Ga0318573_1057030523300031564SoilQVFTAPKDRFADPVWFDLKPAKIFRLAFKDKGRLIDSVDHPLFQRWAARDKG
Ga0318515_1061062413300031572SoilVWPELKQARIFKLAFRDKGRLVDSTEHSLFKKWAARDTN
Ga0318572_1035644033300031681SoilPVWPDLKPSKIFRLAFRDKGRLIDSPEHPLFKKWASRDR
Ga0306917_1006087713300031719SoilPELKPAKIFRLAFKDKGRLIDSVDHPLFQRWAARDNKE
Ga0306917_1064848123300031719SoilPAKIFRLAFREKGRLIDSVNHALFQRWAARDKDAK
Ga0306917_1113152523300031719SoilGRFADPIWPELKPAKIFRLAFRDKGRLIDSTEHPLFQRWAARDKDPA
Ga0307469_1084471823300031720Hardwood Forest SoilRFGDPQWPMLKQAKIFRLAFRDKNRLIDSPEHTLFQRWAARDRDPA
Ga0318501_1032718213300031736SoilDPIWPELKHARIFRLAFRDKGRLIDSVDHPLFQKWAARDKSE
Ga0306918_1026941533300031744SoilDDGKNRFDEPIWPALKPAKIFRLAFKDKGWLLDSTQHPLFLQWTARDKK
Ga0306918_1034976523300031744SoilLKPAKIFRLAFRDKGRLIDSTEHPLFQRWAARDKDPA
Ga0306918_1053929713300031744SoilLKPAKIFKIAFRDKGRLIDSTEHALFKKWAARDTD
Ga0306918_1111733813300031744SoilKVFPAPAGRFGEPQWPDLKEGKIFRLAFRDKGRLVDSTEHPLFKKWAARDSD
Ga0318492_1052942523300031748SoilCYQVFPAPAGRFAEPVWPELKQARIFKLAFRDKGRLVDSTEHSLFKKWAARDTN
Ga0318537_1019682623300031763SoilPVGRFADPIWPELKHARIFRLAFRDKGRLIDSVDHPLFQKWAARDKSE
Ga0318537_1031125613300031763SoilPAPPDRFGDPQFPMLKPAKIFRLAFRDKNRLIDSTEHTLFQRWAARDRDPV
Ga0318546_1085104523300031771SoilFADPIWPVLKPAKIFRLAFRDKGRLVDSSEHPLFQKWAARDSN
Ga0318557_1045037923300031795SoilYSAPVGRFADPIWPELKHARIFRLAFRDKGRLIDSVDHPLFQKWAARDKSE
Ga0318497_1044609923300031805SoilVWPELKYSKIFRLMFRDKGRLIDSTNHPLFLKWAGRDDKSK
Ga0318568_1034613013300031819SoilFSDPVWPEIKQAKIFRLAFRDKGRLIDSPEHALFQKWAARDKKPK
Ga0310917_1060318513300031833SoilRYDNPVWPELKYSKIFRLMFRDKGRLIDSTNHPLFLKWAGRDDKSK
Ga0310917_1090564723300031833SoilFDEPIWPALKPAKIFRLAFKDKGWLLDSTQHPLFLQWTARDKK
Ga0318517_1046200323300031835SoilKVFPAPAGRFADPTWPDLKPARIFKLAFRDKGRLLDSVEHPLFKKWVARDAK
Ga0318511_1046310923300031845SoilVFPAPAGRFADPTWPDLKPARIFKLAFRDKGRLLDSVEHPLFKKWVARDAK
Ga0318512_1059082223300031846SoilRFAEPVWPALKPAKIFRLAFREKGRLIDSVNHALFQRWAARDKDAK
Ga0306919_1057563723300031879SoilGRFAEPVWPALKPAKIFRLAFREKGRLIDSVNHALFQRWAARDKDAK
Ga0306919_1086925923300031879SoilRVYKVFPAPAGRFADPVWPILKPAKIFRLAFRDKGRLVDSPEHPLFQKWAARDSN
Ga0306925_1078825433300031890SoilFVAPAGRFDEPQFPEIKEAKIFRLAFRDKGRLLDSTEHALFKKWAARDSNDAK
Ga0318522_1025672313300031894SoilQFPMLKPAKIFRLAFRDKNRLIDSTEHTLFQKWAARDRDPV
Ga0318551_1047025713300031896SoilYQVFPAPADRFAAPQWPILKPAKIFRLAFRDKNRLIDSPEHTLFQKWAARDRDPA
Ga0306923_1117263323300031910SoilPPGRFADPHWPELKDSKIFRLAFKDKGRLIDSTEHPLFQKWAGRDAAE
Ga0306923_1201063913300031910SoilADPLWPELKPAKIFRLAFRDKGRLIDGPEHPLFQRWAARDKPE
Ga0306921_1020633113300031912SoilADPCWPELKQARIFKLAFRDKSRLVDSTEHQLFKKWAARDSD
Ga0306921_1026514533300031912SoilKVFPAPPGRFADPIWLALSPAKIFRLAFRDKGRLIDTPQHPLFKKWDARDR
Ga0306921_1094637923300031912SoilAPAGRFVEPVWPELKQARIFKLAFRDKGRLVDSTEHPLFKKWAARDTN
Ga0306921_1177162013300031912SoilRFADPVWFDLKPAKIFRLAFKDKGRLIDSVDHPLFQRWAARDKG
Ga0310912_1010388243300031941SoilGRYADPVWPDLKPSKIFRLAFRDKGRLIDSPEHPLFKKWASRDR
Ga0310912_1029232513300031941SoilEGRFPDPQWPEFKQARIFKLAFRDKGRLVDTVEHPYFLKKAARDAG
Ga0310912_1111917123300031941SoilADPVWFDLKPAKIFRLAFKDKGRLIDSVDHPLFQRWAARDKG
Ga0310910_1026999413300031946SoilFPAPAGRFSDPIWPELKQAKIFRVAFRDKGRMVDSPNHPLFLKWAARDQSK
Ga0310909_1077361213300031947SoilRFAAPQWPILKPAKIFRLAFRDKNRLIDSPEHTLFQKWAARDRDPA
Ga0306926_1075581613300031954SoilKVFPAPAGRFSEPQWPDLKPSRVFKLAFRDKGRLVDPVQHPLFLKWAARDAD
Ga0306926_1181056723300031954SoilMLTPVWPELKQAKIFRLSFRDKGRLIDSTDHEVFKKWAGRDTE
Ga0306926_1253388723300031954SoilLWPDLKPAKIFKIAFRDKGRLIDSTEHALFKKWAARDTD
Ga0306926_1283498413300031954SoilKVFPAPAGRFSEPQWPELKEAKIFRLAFRDKGRLVDSVEHPLFKKWAARDSD
Ga0306922_1113475623300032001SoilERFAEPVWPDLKPAKIFRLAFRDKGRLIDSPEHALFQRWAARDKDA
Ga0306922_1143651223300032001SoilPDGRFSDPIWPELKQAKIFRVAFRDKGRMVDTPDHPLFLKWAARDKSK
Ga0306922_1212486513300032001SoilVWPELTDAKIFKLAFRDKGHLIDSTEHSLFKKWAARDSD
Ga0318558_1038703723300032044SoilLKAARIFKLAFRDKGRLVDSVQHPLFLKWAARDTDAE
Ga0318575_1072303313300032055SoilVFPAPKDRFDDPVWPELKPAKIFRLAFKDKGRLIDSVDHPLFQRWAARDNKE
Ga0318533_1024821513300032059SoilLKQARIFKLAFRDKGRLVDSTEHPLFKKWAARDTN
Ga0318533_1055166013300032059SoilPDLKEGKIFRLAFRDKGRLVDSTEHPLFKKWAARDSD
Ga0318533_1055703813300032059SoilFSDPIWPELKQAKIFRVAFRDKGRMVDTPDHPLFLKWAARDTSK
Ga0318505_1018347713300032060SoilAEPVWPALKPAKIFRLAFREKGRLIDSVNHALFQRWAARDKDAK
Ga0306924_1038086513300032076SoilAPEGRFAEPQWPPLKQAKLFRLAFRDKGRLIDSTEHPLFQKWAARDSDPT
Ga0306924_1145093413300032076SoilPQFPNLSQAKIFKLAFTDKGRKIDSPEHIVFKKWAARDSD
Ga0306924_1154544023300032076SoilTAYRVYSAPAGRYADPIWPELKPAKIFRLAFRDKGNLIDSPQHPLFQKWAGRDKDK
Ga0306924_1238541413300032076SoilKNRYAEPVWPELKPAKIFRLAFRDKGRLIDSVEHPLFKKWAARDSE
Ga0318577_1018149723300032091SoilPADRFGDPQLPMLKPAKIFRLAFRDKNRLIDSTEHTLFQRWAARDRDPV
Ga0318577_1031153823300032091SoilIWPALKQAKIFRLAFRDRGHLIDSPEHALFKRWAARDKDAK
Ga0306920_10218438423300032261SoilQFPDLKPAKAFKLLFRDKGKLLDSPQHKLYQKWAALDADE
Ga0306920_10309356813300032261SoilRYDNPVWPELKYSKIFRLMFRDKGRLIDSTNHPLFLKWAGRDNKSK
Ga0306920_10443277023300032261SoilRFSAPQFPNLSAAKIFKLGFTDKGRRIDSTEHILFKKWTARDTEKAGDT
Ga0310914_1023423823300033289SoilGKNRFDEPIWPALKPAKIFRLAFKDKGWLLDSTQHPLFLQWTARDKK
Ga0310914_1046194123300033289SoilLLKHAKIFRLAFRDKGRLIDSTEHPLFKKWAARDRD
Ga0310914_1166133613300033289SoilKLQSIPCAVGRFSDPIWPELKHAKIFRVAFRDKGRLIDSPDHPLFLKWAARDKSK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.