| Basic Information | |
|---|---|
| Family ID | F043958 |
| Family Type | Metagenome |
| Number of Sequences | 155 |
| Average Sequence Length | 48 residues |
| Representative Sequence | VVNGHLEDSLRREIESYLESRLSAVKQEITTLQSLLNESLSTFLERQ |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.56 % |
| % of genes near scaffold ends (potentially truncated) | 96.77 % |
| % of genes from short scaffolds (< 2000 bps) | 93.55 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.452 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.613 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.323 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (73.548 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.00% β-sheet: 0.00% Coil/Unstructured: 40.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 67.74 |
| PF01979 | Amidohydro_1 | 8.39 |
| PF00722 | Glyco_hydro_16 | 7.10 |
| PF07517 | SecA_DEAD | 0.65 |
| PF03935 | SKN1_KRE6_Sbg1 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 7.74 |
| COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.45 % |
| Unclassified | root | N/A | 13.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002899|JGIcombinedJ43975_10081526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300003267|soilL1_10046638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
| 3300003319|soilL2_10008726 | All Organisms → cellular organisms → Bacteria | 27791 | Open in IMG/M |
| 3300004480|Ga0062592_101555910 | Not Available | 637 | Open in IMG/M |
| 3300005093|Ga0062594_102354492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300005330|Ga0070690_101645125 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005335|Ga0070666_10627173 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005338|Ga0068868_101000258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300005338|Ga0068868_101076289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300005340|Ga0070689_100189333 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300005340|Ga0070689_100972977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300005344|Ga0070661_100032066 | All Organisms → cellular organisms → Bacteria | 3802 | Open in IMG/M |
| 3300005365|Ga0070688_100717429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300005438|Ga0070701_10938300 | Not Available | 600 | Open in IMG/M |
| 3300005454|Ga0066687_10544399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300005466|Ga0070685_11023769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300005535|Ga0070684_100179040 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300005543|Ga0070672_100179423 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
| 3300005545|Ga0070695_100991249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300005549|Ga0070704_102262180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300005563|Ga0068855_102397120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300005577|Ga0068857_101330863 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300005577|Ga0068857_101752567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300005578|Ga0068854_100104301 | All Organisms → cellular organisms → Bacteria | 2130 | Open in IMG/M |
| 3300005578|Ga0068854_100774386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300005578|Ga0068854_101025911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300005614|Ga0068856_102507951 | Not Available | 522 | Open in IMG/M |
| 3300005615|Ga0070702_100463058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300005617|Ga0068859_102068361 | Not Available | 629 | Open in IMG/M |
| 3300005718|Ga0068866_10434574 | Not Available | 854 | Open in IMG/M |
| 3300005719|Ga0068861_100502978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300005841|Ga0068863_100261617 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300005888|Ga0075289_1065348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300005937|Ga0081455_10598046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300006358|Ga0068871_101080776 | Not Available | 750 | Open in IMG/M |
| 3300006806|Ga0079220_10449935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300006806|Ga0079220_10961167 | Not Available | 672 | Open in IMG/M |
| 3300006844|Ga0075428_101744796 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300006845|Ga0075421_101994568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300006847|Ga0075431_100696573 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300006847|Ga0075431_101292548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300006880|Ga0075429_100591595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 972 | Open in IMG/M |
| 3300006880|Ga0075429_101767007 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300007004|Ga0079218_12444182 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300009011|Ga0105251_10270272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300009036|Ga0105244_10605684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300009092|Ga0105250_10628070 | Not Available | 500 | Open in IMG/M |
| 3300009093|Ga0105240_11948481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300009094|Ga0111539_10949462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1000 | Open in IMG/M |
| 3300009094|Ga0111539_12102784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300009098|Ga0105245_11679529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300009100|Ga0075418_12329821 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300009101|Ga0105247_11221266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300009147|Ga0114129_10777391 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300009156|Ga0111538_11033582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1039 | Open in IMG/M |
| 3300009156|Ga0111538_11254071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 936 | Open in IMG/M |
| 3300009156|Ga0111538_12585684 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300009157|Ga0105092_10630367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300009162|Ga0075423_10094249 | All Organisms → cellular organisms → Bacteria | 3129 | Open in IMG/M |
| 3300009162|Ga0075423_11711255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300009174|Ga0105241_10621655 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300009174|Ga0105241_11015858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300009174|Ga0105241_12494506 | Not Available | 518 | Open in IMG/M |
| 3300009177|Ga0105248_10600286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1242 | Open in IMG/M |
| 3300009177|Ga0105248_11626479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300010036|Ga0126305_11155244 | Not Available | 534 | Open in IMG/M |
| 3300010041|Ga0126312_10324881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300010042|Ga0126314_10088740 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300010044|Ga0126310_10954734 | Not Available | 672 | Open in IMG/M |
| 3300010047|Ga0126382_11450473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300010166|Ga0126306_11348615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300010358|Ga0126370_11824512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300010362|Ga0126377_13492524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300010373|Ga0134128_12030292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300010375|Ga0105239_12772863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300010399|Ga0134127_10464762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1268 | Open in IMG/M |
| 3300010400|Ga0134122_13155859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300010999|Ga0138505_100066277 | Not Available | 532 | Open in IMG/M |
| 3300012479|Ga0157348_1007226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300012902|Ga0157291_10405851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300012957|Ga0164303_10907585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300013100|Ga0157373_10584935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300013296|Ga0157374_11580914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300013307|Ga0157372_10689017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1189 | Open in IMG/M |
| 3300013308|Ga0157375_10744732 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300014166|Ga0134079_10647062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300014325|Ga0163163_12846657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300014325|Ga0163163_12866850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300014325|Ga0163163_13279865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300014497|Ga0182008_10663927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300014745|Ga0157377_10941580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300014965|Ga0120193_10068769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300014968|Ga0157379_10637362 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300014968|Ga0157379_12154923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300014969|Ga0157376_12998858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300015371|Ga0132258_11193233 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
| 3300015374|Ga0132255_102883443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300017792|Ga0163161_11303641 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300018422|Ga0190265_12242553 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300018465|Ga0190269_11925855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300018466|Ga0190268_11147134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300018466|Ga0190268_12307931 | Not Available | 507 | Open in IMG/M |
| 3300018469|Ga0190270_11416324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300018469|Ga0190270_12700752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300018476|Ga0190274_13418013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300021445|Ga0182009_10854214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300025321|Ga0207656_10492900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300025893|Ga0207682_10467714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300025907|Ga0207645_11041887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300025911|Ga0207654_10350258 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300025911|Ga0207654_10936065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300025917|Ga0207660_10003251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 10643 | Open in IMG/M |
| 3300025917|Ga0207660_10137265 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300025923|Ga0207681_11385242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300025927|Ga0207687_10757701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300025927|Ga0207687_11618228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300025931|Ga0207644_10665297 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300025933|Ga0207706_10765576 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300025936|Ga0207670_10135856 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300025936|Ga0207670_11397995 | Not Available | 594 | Open in IMG/M |
| 3300025940|Ga0207691_10135919 | All Organisms → cellular organisms → Bacteria | 2168 | Open in IMG/M |
| 3300025941|Ga0207711_10165619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2003 | Open in IMG/M |
| 3300025942|Ga0207689_11311825 | Not Available | 608 | Open in IMG/M |
| 3300025949|Ga0207667_11895463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300025961|Ga0207712_11959588 | Not Available | 524 | Open in IMG/M |
| 3300025972|Ga0207668_10361772 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300025972|Ga0207668_11739866 | Not Available | 563 | Open in IMG/M |
| 3300025986|Ga0207658_11078101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300025986|Ga0207658_11811726 | Not Available | 557 | Open in IMG/M |
| 3300026023|Ga0207677_12300748 | Not Available | 501 | Open in IMG/M |
| 3300026088|Ga0207641_10830688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
| 3300026088|Ga0207641_12209072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300026095|Ga0207676_10723113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300026095|Ga0207676_10929681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300026095|Ga0207676_11328808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300026116|Ga0207674_11894976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300027880|Ga0209481_10500944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300027880|Ga0209481_10699321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300027909|Ga0209382_11944291 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300028381|Ga0268264_10404114 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300031538|Ga0310888_10502192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300031548|Ga0307408_102407790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300031562|Ga0310886_10541901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300031716|Ga0310813_10678475 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300031716|Ga0310813_10934777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300031716|Ga0310813_11896404 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031720|Ga0307469_12074474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300031852|Ga0307410_10371104 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300031854|Ga0310904_10344851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
| 3300031892|Ga0310893_10201128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300032005|Ga0307411_11280002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300032013|Ga0310906_10035644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2318 | Open in IMG/M |
| 3300033412|Ga0310810_11486286 | Not Available | 504 | Open in IMG/M |
| 3300033475|Ga0310811_10774084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.52% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.58% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.29% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.29% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.65% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.65% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.65% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.65% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300012479 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.yng.030610 | Environmental | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ43975_100815262 | 3300002899 | Soil | VVNGHLEDSLRREIESYLETRMGAVKQEITTLQSLVNESLSTFLE |
| soilL1_100466382 | 3300003267 | Sugarcane Root And Bulk Soil | VVNGHLEDSLRREIESYLETRMSAVKQEITTLQSLLNESLSTFV |
| soilL2_1000872610 | 3300003319 | Sugarcane Root And Bulk Soil | VVNEQLEDSLRREIESYVDSRLSAVRQEIATLQSLLNESLSTFLDRHADVQMEGSLVASI |
| Ga0062592_1015559101 | 3300004480 | Soil | VVNGHLEESLRREIESYLDSRLSAVKQEIATLQSLVNESLSG |
| Ga0062594_1023544921 | 3300005093 | Soil | VANGHLEDSLRQEIEHYFEGRLSAIKQEIALLQSQFNESLTTLLDRQGDVQTEGSLSTSI |
| Ga0070690_1016451252 | 3300005330 | Switchgrass Rhizosphere | VVNEQLEESLRREIESYLDSRLSAIRQEIATLQSLLNESLSTFLDRQGDVQMEG |
| Ga0070666_106271732 | 3300005335 | Switchgrass Rhizosphere | VVNEQLEESLRREIESYLDSRLGAIRQEIATLQSLLNESLSTFLDRQGDVQMEG |
| Ga0068868_1010002582 | 3300005338 | Miscanthus Rhizosphere | VVNGHLEDSLRREIESYLETRLSAVKQEITTLQSLLNESLSTFL |
| Ga0068868_1010762891 | 3300005338 | Miscanthus Rhizosphere | VANGQLEDSLRREIESYLESRLSAVRQEIGALQSLLNESLSTFVERQSDVQMEG |
| Ga0070689_1001893333 | 3300005340 | Switchgrass Rhizosphere | VEEQPVANGHLEDSLRQEIEHYFEGRLSAIKQEIALLQSQFN |
| Ga0070689_1009729771 | 3300005340 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESYLETRLSAVKQEITTLQSLLNESLST |
| Ga0070661_1000320665 | 3300005344 | Corn Rhizosphere | VVNGQLENSLRHEIETYLESRMSAMKQDISALQGLLNESLS |
| Ga0070688_1007174292 | 3300005365 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESYLETRMSAVKQEITTLQSLLNESLS |
| Ga0070701_109383001 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VVNGHLEDSLRREIENYLEARLSAVKQEIATLQSLLNESLS |
| Ga0066687_105443992 | 3300005454 | Soil | VANGHLEDSLRREIESYLEGRLSAVKQEITSLQNLLNESLSTFLDRQADVQMEGSLLA |
| Ga0070685_110237692 | 3300005466 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESYLETRLSAVKQEITTLQSLLNESLSAFLERQGDVQM |
| Ga0070684_1001790403 | 3300005535 | Corn Rhizosphere | VVNGQLENSLRHEIETYLESRMSAMKQDISALQGLLNESLSGLFERQSDVPLEGSLSTTIAEHLRA |
| Ga0070672_1001794231 | 3300005543 | Miscanthus Rhizosphere | VANGHLEDSLRQEIEHYFEGRLSAIKQEIALLQSQFNESLTTLLDRQGDVQTEGSLSTSIGE |
| Ga0070695_1009912492 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VVNGHLEDSLRREIESYLESRLSAVKQEITTLQSLLNESLSTFLERQ |
| Ga0070704_1022621802 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VVNGHLEDSLRREIESYLETRLSAVRQEITTLQSLLNESLSTFL |
| Ga0068855_1023971202 | 3300005563 | Corn Rhizosphere | VVNGQLEDSLRREIESYLETRLSAVRQEISALQSLLNESLSSFVDRQS |
| Ga0068857_1013308632 | 3300005577 | Corn Rhizosphere | VVNEQLEDSLRREIESYLDSRLSVIRQEISTLQSLLNESLSTFLDRQ |
| Ga0068857_1017525672 | 3300005577 | Corn Rhizosphere | VANGHLEDSLQREIESYLESRLSAVKQEITTLQSLLNESLSTFLERQGD |
| Ga0068854_1001043011 | 3300005578 | Corn Rhizosphere | MEERAVVNGHLEDSLRREIESHLESRLTAVKQEITTLQSLLNESLSSFLERQ |
| Ga0068854_1007743861 | 3300005578 | Corn Rhizosphere | VEEQPVANGHLEDSLRQEIEHYFEGRLSAIKQEIALLQS |
| Ga0068854_1010259112 | 3300005578 | Corn Rhizosphere | VVNGHLEDSLRREIESYLETRLSAVRQEITTLQSLLNESLSTFLDRQGD |
| Ga0068856_1025079511 | 3300005614 | Corn Rhizosphere | VVNGQLEDSLRHEIETYLEGRLSAIKQEIATLQSQMNE |
| Ga0070702_1004630581 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VEEQPVANGHLEDSLRQEIEHYFEGRLSAIKQEIALLQSQFNESLTTLLDRQG |
| Ga0068859_1020683611 | 3300005617 | Switchgrass Rhizosphere | VVNGHLEDSLRREIENYLETRLSAVKQEIATLHSLLNESL |
| Ga0068866_104345741 | 3300005718 | Miscanthus Rhizosphere | VVNGQLEDSLRHEIETYLEGRLSAIKQEIATLQSQMNESLAN |
| Ga0068861_1005029781 | 3300005719 | Switchgrass Rhizosphere | VVNGQLEDSLRQEIESYLEGRLGAIKQEITTLQNQLNESLAGLMDRQGDASMEGS |
| Ga0068863_1002616173 | 3300005841 | Switchgrass Rhizosphere | VVNGHLEDSLRHEIESFLDGRLSAIKQEIASLQGQL |
| Ga0075289_10653481 | 3300005888 | Rice Paddy Soil | MEERAVVNGHLEDSLRREIESHLESRLSAVKQEITTLQSLLNESLS |
| Ga0081455_105980462 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VANGQLEDSLRREIESYLESRLSAVRQEISALQSLLNESLSSFVERQSDVQMEGSMV |
| Ga0068871_1010807761 | 3300006358 | Miscanthus Rhizosphere | VVNGQLEDSLRHEIETYLEGRLSAIKQEIATLQSQMN |
| Ga0079220_104499351 | 3300006806 | Agricultural Soil | VVNGHLEDSLRREIESHLENRLTAVKQEITTLQSLLNESLSSFLERQADVQ |
| Ga0079220_109611671 | 3300006806 | Agricultural Soil | VVNGHLEDSLRREIENYLDTRLNAVKQEIATLQSLLNESLSNFLGRQSDMQLEGSLV |
| Ga0075428_1017447961 | 3300006844 | Populus Rhizosphere | VVNGHLEDSLRREIESYLDGRLEAIRQEITTLQSLLNESLSN |
| Ga0075421_1019945682 | 3300006845 | Populus Rhizosphere | VANGHLEDSLRREIESYLERRLSAVKQEITTLQSLLNESLTTFLERQTDVQMEGSLV |
| Ga0075431_1006965733 | 3300006847 | Populus Rhizosphere | VVNGHLEDSLRREIESYLETRLGAVKQEITTLQSLLNESLS |
| Ga0075431_1012925482 | 3300006847 | Populus Rhizosphere | MEEQPVANGHLEDSLRQEIEHYFEGRLSAIKQEIALL |
| Ga0075429_1005915953 | 3300006880 | Populus Rhizosphere | VADGHLEDNLRQEIEHYFEGRLSAIKQEISLLNSQFNESLSTLLE |
| Ga0075429_1017670071 | 3300006880 | Populus Rhizosphere | VVNEQLEDSLRREIESYLDGRLSAIRQEISTLQSLLNESLSTFLDRQ |
| Ga0079218_124441822 | 3300007004 | Agricultural Soil | VVNEQLEDSLRREIESYLDGRLSAIRQEISTLQSLLNESLSTFLD |
| Ga0105251_102702722 | 3300009011 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESYLENRLDAVRQEITTLQSLLNESLSTFL |
| Ga0105244_106056842 | 3300009036 | Miscanthus Rhizosphere | VVNGQLEDSLRREIESYLESRLSAVRQEINALQSLLN |
| Ga0105250_106280701 | 3300009092 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESYLESRLSAVKQEITTLQSLLNESLSTFL |
| Ga0105240_119484812 | 3300009093 | Corn Rhizosphere | VVNGHLEDSLRREVESYLESRMSAVKQEITTLQSLLNESLSTFLDR |
| Ga0111539_109494621 | 3300009094 | Populus Rhizosphere | VVNGHLEDSLRREIESYLESRLGAVRQEIATLQSLLNESL |
| Ga0111539_121027842 | 3300009094 | Populus Rhizosphere | MEEQPVANGHLEDSLRQEIEHYFEGRLSAIKQEIA |
| Ga0105245_116795292 | 3300009098 | Miscanthus Rhizosphere | VVNGHLEDSLRREIESYLETRLSAVRQEITTLQSLLNESLSTFLDRQGDVQME |
| Ga0075418_123298211 | 3300009100 | Populus Rhizosphere | VVNEQLEDSLRREIESYVDNRLSAVRQEIATLQSLLNESLSTFLDRQG |
| Ga0105247_112212661 | 3300009101 | Switchgrass Rhizosphere | VEEQPVANGHLEDSLRQEIEHYFEGRLSAIKQEIALLQSQFNES |
| Ga0114129_107773911 | 3300009147 | Populus Rhizosphere | VANGHLEDSLRREIESYLERRLSAVKQEITTLQSLLNESLTTFLERQTDVQMEGS |
| Ga0111538_110335821 | 3300009156 | Populus Rhizosphere | MEEQPVANGHLEDSLRQEIEHYFEGRLSAIKQEIALLQSQFN |
| Ga0111538_112540713 | 3300009156 | Populus Rhizosphere | VANGHLEDSLRQEIEHYFEGRLSAIKQEIALLQSQFNESLT |
| Ga0111538_125856841 | 3300009156 | Populus Rhizosphere | VVNEQLEESLRREIESYLDSRLSAIRQEIATLQSLLNESLST |
| Ga0105092_106303671 | 3300009157 | Freshwater Sediment | VVNGHLEDSLRREIESYLESRLSAVKQEITTLQSLLNESLSTFLDRQADVQMEGSLI |
| Ga0075423_100942494 | 3300009162 | Populus Rhizosphere | VVNGHLEDSLRREIESYLEGRLSAVKQEIITLQSLLNESLSTFLDRQTDVQMEGSL |
| Ga0075423_117112551 | 3300009162 | Populus Rhizosphere | MEERAVVNGHLEDSLRREIESHLESRLAAVKQEITTLQTLLNESLSSF |
| Ga0105241_106216551 | 3300009174 | Corn Rhizosphere | VANGHLEDSLQREIESYLESRLSAVKQEITTLQSLLNESLSTFLERQGDVQME |
| Ga0105241_110158582 | 3300009174 | Corn Rhizosphere | VVNGHLEDSLRREIESYLESRLSAVKQEITTLQSLLNESLSNFLDRQTDVQM |
| Ga0105241_124945061 | 3300009174 | Corn Rhizosphere | VVNGHLEDSLRREIESYLESRLSAVKQEITTLQSLLNESLSTFLDRQTDVQMEGSM |
| Ga0105248_106002861 | 3300009177 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESYLENRLSAVKQEITTLQSLLNESLSTFLDRQTDVQMEGSL |
| Ga0105248_116264792 | 3300009177 | Switchgrass Rhizosphere | VVNGHLEDSLRQEIENYLDSRLDAVKQEIATLQSLLNESLSNFLE |
| Ga0126305_111552441 | 3300010036 | Serpentine Soil | VVNGHLEESLRREIESYLESRLSAVKQEITTLQSLLNESLTTFLDRQTDV |
| Ga0126312_103248811 | 3300010041 | Serpentine Soil | VVNGHLEDSLRREIESHLESRLSAVKQEITTLQSLLNESLSS |
| Ga0126314_100887403 | 3300010042 | Serpentine Soil | VVNGHLEDSLRREIESYLESRLSAVKQEITTLQTLLNESLSTFLDRQADVKMEGSLIASI |
| Ga0126310_109547342 | 3300010044 | Serpentine Soil | VVNGHLEDSLRREIESYLEGRLSAVKQEIATLQTLLNESLSSFVERQGDVQL |
| Ga0126382_114504731 | 3300010047 | Tropical Forest Soil | VVNGQLEDSLRHEIESYLDGRLSAVKQEITTLQSLLNESLSTFLDRQG |
| Ga0126306_113486152 | 3300010166 | Serpentine Soil | VVNGHLEDSLRREIESYLESRLSAVKQEITTLQTL |
| Ga0126370_118245122 | 3300010358 | Tropical Forest Soil | VVNGHLEDSLRREIESYLENRLNAVKQEITTLQSLLNESLSTFVERHSDVQLEG |
| Ga0126377_134925241 | 3300010362 | Tropical Forest Soil | VVNGQLEDSLRREIESYLEGRLSAVRQEINALQSLLNES |
| Ga0134128_120302921 | 3300010373 | Terrestrial Soil | VVNGHLEDSLRREIESYLDSRLNAVKQEIATLQSLLNESLSNFLE |
| Ga0105239_127728632 | 3300010375 | Corn Rhizosphere | MEERAVVNGHLEDSLRREFESHLESRMTAVKQEITTLQSLLNE |
| Ga0134127_104647623 | 3300010399 | Terrestrial Soil | VEEQPVANGHLEDSLRQEIEHYFEGRLSAIKQEIALLQSQFNESLTTLLDRQGDVQTEGSLS |
| Ga0134122_131558591 | 3300010400 | Terrestrial Soil | VVNGHLEDSLRREIESYLETRMSAVKQEITTLQSLLNESLSSFLERQTDVQT |
| Ga0138505_1000662772 | 3300010999 | Soil | VVNGHLEDSLRREIESYLDSRLSAVKQEIASLQSLLNESLSAFLERQGDVQVEPSENATCARSP |
| Ga0157348_10072262 | 3300012479 | Unplanted Soil | MEDPAVVNGQLEDSLRHEIETYLEGRLSAIKQEIATLQSQMNESLANLLDRQGEMQMEG |
| Ga0157355_10153811 | 3300012493 | Unplanted Soil | MEDPAVVNGQLEDSLRHEIETYLEGRLSAIKQEIATLQSQMNESLANLLDRQSEMQME |
| Ga0157291_104058511 | 3300012902 | Soil | MEERAVVNGHLEDSLRREIESHLESRLSAVKQEITTLQSLLNESLSTFLERQAD |
| Ga0164303_109075852 | 3300012957 | Soil | VVNGHLEDSLRREIESYLETRLSAVKQEITTLQSLLNESLSTFLDRQTDVQME |
| Ga0157373_105849351 | 3300013100 | Corn Rhizosphere | VVNGHLEDSLRREIESHLESRLSAVKQEITTLQSLLNESLSTFLERQADVQMEG |
| Ga0157374_115809142 | 3300013296 | Miscanthus Rhizosphere | VVNGHLEDSLRREIESYLESRLSAVRQEISTLQSLL |
| Ga0157372_106890171 | 3300013307 | Corn Rhizosphere | VVNGQLEDSLRREIESYLESRLSAVRQEISALQSLLNESLSTFLERQSDVQMEGSM |
| Ga0157375_107447321 | 3300013308 | Miscanthus Rhizosphere | VVNGHLEDSLRREIESHLESRLSAVKQEITTLQSLLNESLSSFLERQADVQMEGS |
| Ga0134079_106470621 | 3300014166 | Grasslands Soil | MEERAVANGHLEDSLRREIEGYIEGRLSAVKQEITSLQNLLNES |
| Ga0163163_128466572 | 3300014325 | Switchgrass Rhizosphere | MEERAVVNGHLEDSLRREIESYLETRMGAVKQEITTLQSLLNESLSSFLERQADV |
| Ga0163163_128668502 | 3300014325 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESHLESRLSAVKQEITTLQSLLNESLSSFLERQ |
| Ga0163163_132798652 | 3300014325 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESYLENRLDAVRQEITTLQSLLNESLSTFLD |
| Ga0182008_106639272 | 3300014497 | Rhizosphere | MEERAVVNGHLEDSLRREIESYLESRMSAVKQEITTLQSLLNESLSTFLDRQ |
| Ga0157377_109415801 | 3300014745 | Miscanthus Rhizosphere | VVNGHLEESLRREIESYLENRLSAVKQEIATLQSLVNESL |
| Ga0120193_100687691 | 3300014965 | Terrestrial | VANGHLEDSLRREIESYLENRLSAVKQEITTLQNLLNESLTSFLE |
| Ga0157379_106373623 | 3300014968 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESYLETRLSAVKQEITTLQSL |
| Ga0157379_121549231 | 3300014968 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESYLEGRLSAVKQEITTLQSLLNES |
| Ga0157376_129988582 | 3300014969 | Miscanthus Rhizosphere | VVNGHLEDSLRREIESHLESRLSAVKQEITTLQSLLNESLSSFLDRQADVQMEGSLI |
| Ga0132258_111932333 | 3300015371 | Arabidopsis Rhizosphere | MEERAVVNGHLEDSLRREIESYLEGRLSAVKQEITTLQSLL |
| Ga0132255_1028834432 | 3300015374 | Arabidopsis Rhizosphere | VANGQLEDSLRREIESYLESRLSAVRQEIGALQSLLNESLSPFLERQSDVQMEGSMLAAI |
| Ga0163161_113036411 | 3300017792 | Switchgrass Rhizosphere | VVNEQLEESLRREIESYLDSRLGAIRQEIATLQSLLNESLSTFLDRQGDV |
| Ga0190265_122425531 | 3300018422 | Soil | VVNEQLEDSLRREIESYLDSRLSVIRQEISTLQSLLNESLSTFLDRQGDVQM |
| Ga0190269_119258551 | 3300018465 | Soil | VVNGHLEDSLRREIESHLESRLTAVKQEITTLQGLLNESLSSFLERQTD |
| Ga0190268_111471342 | 3300018466 | Soil | VVNGHLEESLRREIESYLESRLSAVKQEIATLQSLVNETLSAFLERQSDVQAEGSLVAAI |
| Ga0190268_123079311 | 3300018466 | Soil | VANGHLEDSLRQEIERYFDGRLSAIKQEIALLQSQFNESLSTLLDRQGD |
| Ga0190270_114163241 | 3300018469 | Soil | VVNGQLEDSLRREIESYLENRLSAVKQEITTLQSLLNESLSTFLD |
| Ga0190270_127007522 | 3300018469 | Soil | VVNGHLEDSLRREIESYLESRLTAVKQEIAALQSLLNESLSTVLDRQGDVQMEGSIVAAI |
| Ga0190274_134180132 | 3300018476 | Soil | VVNGHLEDSLRREIESYLETRMSAVKQEITTLQSLLNESLSTFLERQAD |
| Ga0182009_108542142 | 3300021445 | Soil | MEERAVVNGHLEDSLRREIESHLESRLSAVKQEITTLQSLLNESLSSFLE |
| Ga0207656_104929002 | 3300025321 | Corn Rhizosphere | MEERAVVNGHLEDSLRREIESHLESRLTAVKQEITTLQSLLNESLSSFLERQADVQTDAS |
| Ga0207682_104677142 | 3300025893 | Miscanthus Rhizosphere | VANGQLEDSLRREIESYLESRLSAVRQEIGALQSLLNESL |
| Ga0207645_110418871 | 3300025907 | Miscanthus Rhizosphere | VVNGHLEDSLRREIESYMESRLSSVKQEIATLQSLVNESLSAFLERQADVQ |
| Ga0207654_103502581 | 3300025911 | Corn Rhizosphere | VANGHLEDSLQREIESYLESRLSAVKQEITTLQSLLNESLSTFLERQGDVQM |
| Ga0207654_109360652 | 3300025911 | Corn Rhizosphere | VVNGHLEDSLRREIESYLETRLSAVRQEITTLQSLLNESLSTFLDRQGDV |
| Ga0207660_100032518 | 3300025917 | Corn Rhizosphere | VVNGHLEDSLRHEIESYLDGRLSAIKQEIASLQGQL |
| Ga0207660_101372651 | 3300025917 | Corn Rhizosphere | VVNEQLEESLRREIESYLDSRLGAIRQEIATLQSLLNESLST |
| Ga0207681_113852422 | 3300025923 | Switchgrass Rhizosphere | VANGHLEDSLQREIESYLESRLSAVKQEITTLQSLLNESLSTFL |
| Ga0207687_107577011 | 3300025927 | Miscanthus Rhizosphere | VANGQLEDSLRREIESYLESRLSAVRQEIGALQSLLNESLSTFVERQSDVQM |
| Ga0207687_116182282 | 3300025927 | Miscanthus Rhizosphere | VVNGHLEDSLRREIESYLESRLGAVRQEITTLQSLLNESL |
| Ga0207644_106652973 | 3300025931 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESYLETRMSAVKQEITTLQSLVNESLSTF |
| Ga0207706_107655762 | 3300025933 | Corn Rhizosphere | VVNEQLEESLRREIESYLDSRLSAIRQEIATLQSL |
| Ga0207670_101358561 | 3300025936 | Switchgrass Rhizosphere | VANGHLEDSLRQEIEHYFEGRLSAIKQEIALLQSQFNESLTTL |
| Ga0207670_113979952 | 3300025936 | Switchgrass Rhizosphere | VVNGHLEESLRREIESYLDSRLSAFKQEIATLQSLVNES |
| Ga0207691_101359191 | 3300025940 | Miscanthus Rhizosphere | VVNGQLEDSLRHEIESYLEGRLSAIKQEITTLQSQLNESLANLLERQGDVQMEGSLTTSI |
| Ga0207711_101656193 | 3300025941 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESYLETRMSAVKQEITTLQSLVNESLS |
| Ga0207689_113118251 | 3300025942 | Miscanthus Rhizosphere | VVNGHLEDSLRHEIESFLDGRLSAIKQEIASLQGQLNEALTSLLERQSDVQMEGS |
| Ga0207667_118954631 | 3300025949 | Corn Rhizosphere | VVNGHLEDSLRREIESYLETRLSAVRQEITTLQSLLNESLSTFLDRQGDVQMEGSLVAAI |
| Ga0207712_119595881 | 3300025961 | Switchgrass Rhizosphere | VVNGQLEDSLRHEIETYLEGRLSAIKQEIATLQSQMNESLANLHARPGEMQMEG |
| Ga0207668_103617722 | 3300025972 | Switchgrass Rhizosphere | VVNEQLEESLRREIESYLDSRLGAIRQEIATLQSLLNESLSTFLDRQGDVQMEGS |
| Ga0207668_117398661 | 3300025972 | Switchgrass Rhizosphere | VVNGQLEDSLRHEIESYLEGRLSAIKQEITALQSQLNESLANLLERQGDVDTGSRLPRIPNDTT |
| Ga0207658_110781012 | 3300025986 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESHLESRLSAVKQEITTLQSLLNESLSSFLDR |
| Ga0207658_118117261 | 3300025986 | Switchgrass Rhizosphere | VVNGQLENSLRHEIETYLESRLGSIKQDISALQSLLNESLTCLFERQSDVPMEGSLSTAI |
| Ga0207677_123007481 | 3300026023 | Miscanthus Rhizosphere | VANGQLEDSLRREIESYLESRLSAVRQEIGALQSLLNESLSTFVERQSDVQMEGS |
| Ga0207641_108306881 | 3300026088 | Switchgrass Rhizosphere | VVNGQLEDSLRHEIETYLEGRLSAIKQEIATLQSQMNESLANLLDRQ |
| Ga0207641_122090722 | 3300026088 | Switchgrass Rhizosphere | VANGQLEDSLRREIESYLESRLSAVRQEIGALQSLLNESLSTFVERQS |
| Ga0207676_107231131 | 3300026095 | Switchgrass Rhizosphere | VVNGHLEDSLQRDIESYLETRMSAVKQEITTLQSLLNESLSSFLERQADVQMEASMQASI |
| Ga0207676_109296811 | 3300026095 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESYLETRMSAVKQEITTLQSLLNES |
| Ga0207676_113288081 | 3300026095 | Switchgrass Rhizosphere | VVNGHLEDSLRREIESYLETRLSAVKQEITTLQSLLN |
| Ga0207674_118949761 | 3300026116 | Corn Rhizosphere | VVNGHLEDSLRREIESYLENRLDAVRQEITTLQSLLNESLSTF |
| Ga0209481_105009441 | 3300027880 | Populus Rhizosphere | VANGHLEDSLRREIESYLERRLSAVKQEITTLQSLLNESLTTFLERQTDVQMEGSL |
| Ga0209481_106993211 | 3300027880 | Populus Rhizosphere | VVNGHLEDSLRREIESYLESRLGAVRQEIATLQSLLNESLSTFLDRQAANTQMEGSLVAA |
| Ga0209382_119442911 | 3300027909 | Populus Rhizosphere | VVNEQLEDSLRREIESYLDSRLSVIRQEISTLQSLLNES |
| Ga0268264_104041141 | 3300028381 | Switchgrass Rhizosphere | VANGQLEDSLRREIESYLEGRLSAVKQEITTLQSLLNESLSTFLERQS |
| Ga0310888_105021921 | 3300031538 | Soil | VANGHLEDSLRQEIEHYFEGRLSAIKQEIALLQSQ |
| Ga0307408_1024077902 | 3300031548 | Rhizosphere | VVNGHLEDSLQREIESHLETRMSAVKQEITTLQSLLNESL |
| Ga0310886_105419011 | 3300031562 | Soil | VVNGHLEDSLRREIESYLESRLSAVKQEITTLQSLLNE |
| Ga0310813_106784753 | 3300031716 | Soil | VVNGHLEDSLRREIESYLESRMSAVKQEITTLQSL |
| Ga0310813_109347772 | 3300031716 | Soil | VVNGHLEDSLRREIESYLESRLSAVRQEISTLQSLLNESLSTFLDRQGDVQMEGSLVAAI |
| Ga0310813_118964041 | 3300031716 | Soil | VVNGHLEDSLRREIEDHLDDRLKAIRQEIASLQSLLNESL |
| Ga0307469_120744742 | 3300031720 | Hardwood Forest Soil | VVNGHLEDSLRREIESYLESRLSAVKQEITTLQSLLNESLSTFLERQADVQMEGSLVAS |
| Ga0307410_103711043 | 3300031852 | Rhizosphere | VVNGHLEESLRREIESYLESRLSAVKQEIATLQSLVNESLTAFLERQS |
| Ga0310904_103448511 | 3300031854 | Soil | VANGHLEDSLRQEIEHYFEGRLSAIKQEIALLQSQFNESLTTLLDRQG |
| Ga0310893_102011281 | 3300031892 | Soil | VANGHLEDSLRQEIEHYFEGRLSAIKQEIALLQSQFNESLTT |
| Ga0307411_112800021 | 3300032005 | Rhizosphere | VVNGHLEDSLRREIESYLESRLSAVKQEITTLQSL |
| Ga0310906_100356444 | 3300032013 | Soil | VANGHLEDSLRQEIEHYFEGRLSAIKQEIALLQSQFNESLTTLLDRQ |
| Ga0310810_114862861 | 3300033412 | Soil | VVNGHLEDSLRHEIESFLDGRLSAIKQEIASLQGQLN |
| Ga0310811_107740841 | 3300033475 | Soil | VVNGHLEDSLRHEIESYLEGRLSAIKQEIASLQGQLNEALTSLLERQGDVQMEGSLAT |
| ⦗Top⦘ |