| Basic Information | |
|---|---|
| Family ID | F043893 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 155 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSS |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 87.25 % |
| % of genes near scaffold ends (potentially truncated) | 95.48 % |
| % of genes from short scaffolds (< 2000 bps) | 89.03 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (75.484 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (21.936 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.871 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.161 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 22.97% Coil/Unstructured: 77.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF09723 | Zn-ribbon_8 | 19.35 |
| PF05869 | Dam | 10.97 |
| PF01844 | HNH | 1.94 |
| PF00145 | DNA_methylase | 1.29 |
| PF14445 | Prok-RING_2 | 0.65 |
| PF13508 | Acetyltransf_7 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.55 % |
| Unclassified | root | N/A | 6.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003491|JGI25924J51412_1027303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 963 | Open in IMG/M |
| 3300003499|JGI25930J51415_1035928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
| 3300004054|Ga0063232_10008825 | All Organisms → Viruses → Predicted Viral | 2163 | Open in IMG/M |
| 3300004054|Ga0063232_10156497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300004460|Ga0066222_1176555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300004771|Ga0007797_1131933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300004772|Ga0007791_10101475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
| 3300005528|Ga0068872_10227250 | All Organisms → Viruses → Predicted Viral | 1055 | Open in IMG/M |
| 3300005581|Ga0049081_10143459 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300006641|Ga0075471_10518489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300006802|Ga0070749_10364498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300006802|Ga0070749_10434731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300006805|Ga0075464_10406525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
| 3300006863|Ga0075459_1006208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1936 | Open in IMG/M |
| 3300006875|Ga0075473_10435092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300006920|Ga0070748_1155644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300006920|Ga0070748_1275342 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300006920|Ga0070748_1323195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300007540|Ga0099847_1207346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300008110|Ga0114343_1021242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3543 | Open in IMG/M |
| 3300008261|Ga0114336_1318048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300008266|Ga0114363_1046972 | All Organisms → Viruses → Predicted Viral | 1735 | Open in IMG/M |
| 3300008266|Ga0114363_1063089 | All Organisms → Viruses → Predicted Viral | 1433 | Open in IMG/M |
| 3300008266|Ga0114363_1153127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300008448|Ga0114876_1067512 | All Organisms → Viruses → Predicted Viral | 1535 | Open in IMG/M |
| 3300008448|Ga0114876_1211016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
| 3300008450|Ga0114880_1096706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1149 | Open in IMG/M |
| 3300008450|Ga0114880_1247781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300009037|Ga0105093_10483446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300009068|Ga0114973_10104685 | All Organisms → Viruses → Predicted Viral | 1605 | Open in IMG/M |
| 3300009068|Ga0114973_10376908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300009068|Ga0114973_10602350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300009081|Ga0105098_10720751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300009146|Ga0105091_10448941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300009152|Ga0114980_10107921 | All Organisms → Viruses → Predicted Viral | 1663 | Open in IMG/M |
| 3300009152|Ga0114980_10111028 | All Organisms → Viruses → Predicted Viral | 1637 | Open in IMG/M |
| 3300009152|Ga0114980_10210847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1141 | Open in IMG/M |
| 3300009155|Ga0114968_10742791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300009157|Ga0105092_10538299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300009158|Ga0114977_10173296 | All Organisms → Viruses → Predicted Viral | 1276 | Open in IMG/M |
| 3300009158|Ga0114977_10399312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300009160|Ga0114981_10161708 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
| 3300009160|Ga0114981_10272196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300009163|Ga0114970_10200759 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
| 3300009169|Ga0105097_10796363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300009180|Ga0114979_10437173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300009180|Ga0114979_10818228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300009183|Ga0114974_10195764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1237 | Open in IMG/M |
| 3300009187|Ga0114972_10280748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
| 3300009469|Ga0127401_1050872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1166 | Open in IMG/M |
| 3300010158|Ga0114960_10548571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300010374|Ga0114986_1102242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300010885|Ga0133913_11431907 | All Organisms → Viruses → Predicted Viral | 1755 | Open in IMG/M |
| 3300011268|Ga0151620_1169059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300012012|Ga0153799_1047207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
| 3300012017|Ga0153801_1025713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1043 | Open in IMG/M |
| 3300012665|Ga0157210_1027214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300013004|Ga0164293_10457904 | Not Available | 849 | Open in IMG/M |
| 3300013004|Ga0164293_10630373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300013372|Ga0177922_11081961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300014711|Ga0134314_102266 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
| 3300017716|Ga0181350_1156723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300017736|Ga0181365_1008002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2618 | Open in IMG/M |
| 3300017736|Ga0181365_1032483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1317 | Open in IMG/M |
| 3300017736|Ga0181365_1061228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
| 3300017761|Ga0181356_1168577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300017766|Ga0181343_1139745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300017774|Ga0181358_1002011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9210 | Open in IMG/M |
| 3300017774|Ga0181358_1190490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300017774|Ga0181358_1271531 | Not Available | 526 | Open in IMG/M |
| 3300017777|Ga0181357_1308745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300017778|Ga0181349_1164553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300017778|Ga0181349_1243358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300017780|Ga0181346_1108407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1073 | Open in IMG/M |
| 3300017780|Ga0181346_1212986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300017784|Ga0181348_1142651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
| 3300017784|Ga0181348_1169794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300017784|Ga0181348_1232724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300017785|Ga0181355_1270644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300019784|Ga0181359_1141399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
| 3300019784|Ga0181359_1271614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300021438|Ga0213920_1022773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1523 | Open in IMG/M |
| 3300021438|Ga0213920_1083675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300021952|Ga0213921_1015126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1358 | Open in IMG/M |
| 3300021956|Ga0213922_1110397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300022190|Ga0181354_1169245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300022407|Ga0181351_1237524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300024350|Ga0255167_1011002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1849 | Open in IMG/M |
| 3300024352|Ga0255142_1007840 | All Organisms → Viruses → Predicted Viral | 1778 | Open in IMG/M |
| 3300025075|Ga0209615_103297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
| 3300025896|Ga0208916_10038261 | All Organisms → Viruses → Predicted Viral | 1944 | Open in IMG/M |
| 3300025896|Ga0208916_10314668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300027147|Ga0255113_1086367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300027396|Ga0255146_1016395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1580 | Open in IMG/M |
| 3300027396|Ga0255146_1055872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300027467|Ga0255154_1065775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300027659|Ga0208975_1094015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300027679|Ga0209769_1185142 | Not Available | 650 | Open in IMG/M |
| 3300027721|Ga0209492_1123041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
| 3300027733|Ga0209297_1095317 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
| 3300027734|Ga0209087_1113496 | All Organisms → Viruses → Predicted Viral | 1131 | Open in IMG/M |
| 3300027734|Ga0209087_1219408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
| 3300027734|Ga0209087_1239087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
| 3300027736|Ga0209190_1219091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300027764|Ga0209134_10034837 | All Organisms → Viruses → Predicted Viral | 1641 | Open in IMG/M |
| 3300027785|Ga0209246_10226122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| 3300027798|Ga0209353_10129552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1132 | Open in IMG/M |
| 3300027892|Ga0209550_10066754 | All Organisms → Viruses → Predicted Viral | 2818 | Open in IMG/M |
| 3300027900|Ga0209253_11085693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300027963|Ga0209400_1112025 | All Organisms → Viruses → Predicted Viral | 1249 | Open in IMG/M |
| 3300027963|Ga0209400_1387708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300027971|Ga0209401_1201036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| 3300027973|Ga0209298_10010767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4883 | Open in IMG/M |
| 3300027973|Ga0209298_10172668 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300027974|Ga0209299_1117904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
| 3300028027|Ga0247722_10277117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300028286|Ga0256331_1118783 | Not Available | 597 | Open in IMG/M |
| 3300028394|Ga0304730_1109846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1178 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1124345 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
| 3300031758|Ga0315907_11260579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300031787|Ga0315900_10306856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1311 | Open in IMG/M |
| 3300031787|Ga0315900_10738709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300031787|Ga0315900_10888936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300031951|Ga0315904_10708012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
| 3300031963|Ga0315901_10671698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300032093|Ga0315902_10160049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2327 | Open in IMG/M |
| 3300032093|Ga0315902_11219319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300032116|Ga0315903_10593229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
| 3300032116|Ga0315903_11033465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300032116|Ga0315903_11170446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300033233|Ga0334722_10499494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
| 3300033233|Ga0334722_10874934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300033557|Ga0316617_102113211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300033993|Ga0334994_0359689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300034050|Ga0335023_0694533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300034061|Ga0334987_0684656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300034063|Ga0335000_0075459 | All Organisms → Viruses → Predicted Viral | 2350 | Open in IMG/M |
| 3300034064|Ga0335001_0506336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300034066|Ga0335019_0181446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1370 | Open in IMG/M |
| 3300034092|Ga0335010_0568016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300034101|Ga0335027_0783470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300034102|Ga0335029_0276070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1073 | Open in IMG/M |
| 3300034102|Ga0335029_0617294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300034104|Ga0335031_0033632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3729 | Open in IMG/M |
| 3300034104|Ga0335031_0063601 | All Organisms → Viruses → Predicted Viral | 2642 | Open in IMG/M |
| 3300034118|Ga0335053_0627581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300034122|Ga0335060_0035835 | All Organisms → Viruses → Predicted Viral | 3203 | Open in IMG/M |
| 3300034355|Ga0335039_0360520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300034356|Ga0335048_0107196 | All Organisms → Viruses → Predicted Viral | 1668 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.26% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.10% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.52% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.23% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.58% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.29% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.29% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.29% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.65% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.65% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.65% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.65% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.65% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.65% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004771 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M | Environmental | Open in IMG/M |
| 3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024350 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027147 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25924J51412_10273034 | 3300003491 | Freshwater Lake | MPIYEFXXTXDLCESNLRYDKELKINEPHDVECGFCHEPMRKIYSSFGISFKGNGFYSTDK* |
| JGI25930J51415_10359283 | 3300003499 | Freshwater Lake | MPTYEFECDNEKCESNARIEEWLSITEPHDLECPFCHSPMHKVYS |
| Ga0063232_100088251 | 3300004054 | Freshwater Lake | MPIYEFECTNDLCESNLRYDKELKINEPHDVECGFCHEPMRK |
| Ga0063232_101564972 | 3300004054 | Freshwater Lake | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGISFKGNG |
| Ga0066222_11765552 | 3300004460 | Marine | MPIYEFECNNEQCQSNSRYDQEFSIAEPHDLDCPFCGESMRKVYSSVPAVHFKGSG |
| Ga0007797_11319331 | 3300004771 | Freshwater | MPIYEFECNSESCEANARYDKELSISEPHDLDCPFCGETMRKVYSSVPAVHFKGSGFYS |
| Ga0007791_101014753 | 3300004772 | Freshwater | MPIYEFECTNEECEANLRYEKELSIHEPHTVICQFCHSSMQKIYSVPNIQFK |
| Ga0068872_102272504 | 3300005528 | Freshwater Lake | MPIYEFECTNDRCEANLRYEKEFKINEDHLVECGLCHEPMRKIYSSFGIQ |
| Ga0049081_101434591 | 3300005581 | Freshwater Lentic | TNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGISFKGTGFYSTDK* |
| Ga0075471_105184891 | 3300006641 | Aqueous | MPIYEFECNNEKCQSNSRYDQEFSIAEPHDLDCPFCGESMRKVYSSVPAVHFRGSGFYS |
| Ga0070749_103644982 | 3300006802 | Aqueous | MPIYEFECDNENCEANPRYEKELSIAEPHDLECPFCHASMRKVYSSVP |
| Ga0070749_104347313 | 3300006802 | Aqueous | MPIYEFECNNEKCEANARYDKELAISEPHDLDCPFCGETMRKVYSSVPA |
| Ga0075464_104065253 | 3300006805 | Aqueous | MPIYEFECTNDRCEANLRYEKEFKINEEHIVECGLCHEPMR |
| Ga0075459_10062087 | 3300006863 | Aqueous | MPIYEFECDNEDCEANLRYEKELSISEPHHVTCQFCGDSMRK |
| Ga0075473_104350922 | 3300006875 | Aqueous | MPIYEFECTNDKCEANLRYEKELSINEDHDVECGLCYQPMRKIYSSFGIQ |
| Ga0070748_11556443 | 3300006920 | Aqueous | MPIYEFECNSEKCQSNSRYDQEFSIAEPHDLDCPFCGESMRKVYSSVPAVHFKGS |
| Ga0070748_12753422 | 3300006920 | Aqueous | MPIYEFECNNESCEANARYDKELSISEPHDLDCPFCGETMRKVYSSVPAV |
| Ga0070748_13231951 | 3300006920 | Aqueous | MPIYEFECDNENCEANARIEKEISITKSHEIDCPFCGESMRKVY |
| Ga0099847_12073461 | 3300007540 | Aqueous | MPIYEFECNNEKCQSNSRYDQEFSIAEPHDLDCPF |
| Ga0114343_10212421 | 3300008110 | Freshwater, Plankton | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSF |
| Ga0114336_13180483 | 3300008261 | Freshwater, Plankton | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFCHEPM |
| Ga0114363_10469721 | 3300008266 | Freshwater, Plankton | MPIYEFECNNDKCASNSRYDQEFAIAEPHDLDCPFCGESMRKVY |
| Ga0114363_10630894 | 3300008266 | Freshwater, Plankton | MPIYEFECTNDLCESNLRYDKELKINEPHDVECGFCH |
| Ga0114363_11531271 | 3300008266 | Freshwater, Plankton | MPIYEFECVNEERCQSNLRYEKEYPINADHDLECPLCHEPMRKIYSSIPVIFKSGGFYS |
| Ga0114876_10675121 | 3300008448 | Freshwater Lake | MPIYEFECDNELCEANARYDKELKINEPHDVDCPFCGSSMRKIYSSVAVHFTGTGF |
| Ga0114876_11480222 | 3300008448 | Freshwater Lake | MPIYEFECNNERCEANARYDQEFSIAEPHDLDCPFCGESMRKVYSSVPAVHFKGSGFYST |
| Ga0114876_12110161 | 3300008448 | Freshwater Lake | MPIYEFECTNESCEANLRYEKELKINEPHDVECGFCHEPMRKI |
| Ga0114880_10967061 | 3300008450 | Freshwater Lake | MPIYEFECNNDKCASNSRYDQEFAIAEPHDLDCPFCGESMRKVYSSVPA |
| Ga0114880_12477811 | 3300008450 | Freshwater Lake | ECTNDLCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGIAFRVTGFYSTDK* |
| Ga0105093_104834463 | 3300009037 | Freshwater Sediment | MPTYEFECDNEDCESNSRIEHWYHINEPHDLECPFCHSPMHKVYSSVGISFK |
| Ga0114973_101046851 | 3300009068 | Freshwater Lake | MPIYEFECDNELCEANARYDKELKINEPHDVDCPFCGSTMRKIYSSVPVHFTGTGFY |
| Ga0114973_103769082 | 3300009068 | Freshwater Lake | VPIYEFECDNELCEANARYDKELKINEPHDVDCPFCGSTMRKIYSSVPV |
| Ga0114973_106023501 | 3300009068 | Freshwater Lake | MPIYEFECTNDLCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGIQ |
| Ga0105098_107207511 | 3300009081 | Freshwater Sediment | MPIYEFECTNDRCEANLRYEKEFKINEDHLVECGLCHEPMRKIYSSF |
| Ga0105091_104489412 | 3300009146 | Freshwater Sediment | MPTYEFECDNEDCESNARIEQWYSIMEPHDLECPFCHSPMHKIYSSVGISFK |
| Ga0114980_101079214 | 3300009152 | Freshwater Lake | MPIYEFECDNELCEANARYDKELSINEPHDVDCPFCSSTMRKIYSSVPVHFTGTGFY |
| Ga0114980_101110285 | 3300009152 | Freshwater Lake | MPIYEFECDNELCEANARYDKELSINEPHDVDCPFCSSTMRKIYSSVPV |
| Ga0114980_102108473 | 3300009152 | Freshwater Lake | VPIYEFECDNELCEANARYDKELKINEPHDVDCPFCGSSMRKIY |
| Ga0114968_107427911 | 3300009155 | Freshwater Lake | MPTYEFECDNENCESNARIEEWLSINEPHDLECPFCHSPMHKVYSSIGVSFKGSG |
| Ga0105092_105382992 | 3300009157 | Freshwater Sediment | MPIYEFECDNELCEANARYDKELKINEPHDVECGFCHEPMRKI |
| Ga0114977_101732964 | 3300009158 | Freshwater Lake | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYS |
| Ga0114977_103993122 | 3300009158 | Freshwater Lake | MPIYEFECDNELCEANARYDKELKINEPHDVDCPFCGSSMRKIYSSVPA |
| Ga0114981_101617084 | 3300009160 | Freshwater Lake | VPIYEFECTNDQCEANLRYEKELRINEPHDVECGFCHEPMRKIYSSFGIQFKGNGF |
| Ga0114981_102721963 | 3300009160 | Freshwater Lake | VPIYEFECDNELCEANARYDKELKINEPHDVDCPFCG |
| Ga0114970_102007591 | 3300009163 | Freshwater Lake | MPIYEFECDNELCEANARYDKELSINEPHDVDCPFCSSTMRKIYS |
| Ga0105097_107963632 | 3300009169 | Freshwater Sediment | MPIYEFECTNDLCESNLRYDKELKMNEPHDVECGFCHEPMRKIYS |
| Ga0114979_104371731 | 3300009180 | Freshwater Lake | VPIYEFECDNELCEANARYDKELKINEPHDVDCPFCGSSMRKIYSSVAVHFT |
| Ga0114979_108182282 | 3300009180 | Freshwater Lake | VPIYECECTDELCEANLGYEKEVRINEPHDVECGFCHESMR |
| Ga0114974_101957641 | 3300009183 | Freshwater Lake | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGIQF |
| Ga0114974_103294371 | 3300009183 | Freshwater Lake | NELCEANARYDKELKINEPHDVDCPFCGSSMRKIYSSVAVHFTGTGFYSTDK* |
| Ga0114972_102807481 | 3300009187 | Freshwater Lake | MPIYEFECDNELCEANARYDKELSINEPHDLDCPFCSSPMRKIYSS |
| Ga0127401_10508724 | 3300009469 | Meromictic Pond | MPIYEFECNSETCEANARYDKELSISEPHDLDCPFCGETMRKVYSSVP |
| Ga0114960_105485712 | 3300010158 | Freshwater Lake | MPIYEFECDNELCEANARYDKELKINEPHDVDCPFCGS |
| Ga0136655_11408061 | 3300010316 | Freshwater To Marine Saline Gradient | CTNDLCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGIAFKGTGFYSTDK* |
| Ga0114986_11022422 | 3300010374 | Deep Subsurface | MPIYEFECNNEKCEANARYDKELSISEPHDLDCPFCGETMRKVYS |
| Ga0133913_114319071 | 3300010885 | Freshwater Lake | MPIYEFECDNELCEANARYDKELKINEPHDVDCPFCGSSMRKI |
| Ga0151620_11690593 | 3300011268 | Freshwater | MPIYEFECNNEKCEANARYDKELSISEPHDLDCPFCGETM |
| Ga0153799_10472071 | 3300012012 | Freshwater | MPTYEFECDNEKCESNARIEEWLSLSEPHDLECPFCHSPMHKVYSSIGVSFK |
| Ga0153801_10257133 | 3300012017 | Freshwater | MPTYEFECDNEKCESNARIEEWLSITEPHDLECPFCHSPMHK |
| Ga0157210_10272144 | 3300012665 | Freshwater | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFC |
| Ga0164293_104579042 | 3300013004 | Freshwater | EFECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGISFKGTGFYSTDK* |
| Ga0164293_106303731 | 3300013004 | Freshwater | MPVYEWECTNTDRCESNTRYEKEFPINADQELECPLCH |
| Ga0177922_110819611 | 3300013372 | Freshwater | MPIYEFECVNEERCQSNLRYEKEYPINAEHDLECPLCHEPMRKIYSSV |
| Ga0134314_1022661 | 3300014711 | Surface Water | MPIYEFECDNDKCEANARIEKEISITKSQELECPFCGESMRKAY |
| Ga0181350_11567231 | 3300017716 | Freshwater Lake | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGIS |
| Ga0181347_11614921 | 3300017722 | Freshwater Lake | RSNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGISFKGTGFYSTDK |
| Ga0181365_10080027 | 3300017736 | Freshwater Lake | MPIYEFECTNDLCESNLRYDKELKINEPHDVECGFCHEPMRKIYSSFGISFKGNGFY |
| Ga0181365_10324831 | 3300017736 | Freshwater Lake | MPIYEFECDNELCEANARYDKELSINEPHDVDCPFCSSTMR |
| Ga0181365_10612283 | 3300017736 | Freshwater Lake | MPIYEFECDNELCEANARYDKELSINEPHDVDCPFCS |
| Ga0181356_11685771 | 3300017761 | Freshwater Lake | MPIYEFECTNDRCEANLRYEKEFKINEDHLVECGLCHEQMRKIYSSFGVSFK |
| Ga0181343_11397452 | 3300017766 | Freshwater Lake | MPIYEFECTNEECEANLRYEKEMSIHEPHDPKCQFCHSSM |
| Ga0181358_100201118 | 3300017774 | Freshwater Lake | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKI |
| Ga0181358_11904902 | 3300017774 | Freshwater Lake | MPIYEFECDNELCEANARYDKELSINEPHDVDCPFCSSTMRKIYSSVPVHFTGTGFYST |
| Ga0181358_12715312 | 3300017774 | Freshwater Lake | MPIYEWECTNTERCESNTRYEKEFPINAEQELECPLCHEPMRKIYSSVPVIF |
| Ga0181357_13087451 | 3300017777 | Freshwater Lake | MPIYEFECDNEKCASNSRYDQEFSIAEPHDLECPFCHASMRKVYSSVPAVHFKGSG |
| Ga0181349_11645533 | 3300017778 | Freshwater Lake | MPTYEFECDNDKCESNARIEEWLSLSEPHDLECPFCHAPMHKIYSSIGVSFKGAGF |
| Ga0181349_12433581 | 3300017778 | Freshwater Lake | MPIYEFECDNELCEANARYDKELSINEPHDVDCPFCSSTMRKIY |
| Ga0181346_11084072 | 3300017780 | Freshwater Lake | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGISFKGTGFFSTD |
| Ga0181346_12129862 | 3300017780 | Freshwater Lake | MPIYEFECTNDRCEANLRYEKEFKINEDHLVECGLCHEQMRK |
| Ga0181346_12248642 | 3300017780 | Freshwater Lake | ECDNELCEANARYDKELSINEPHDVDCPFCSSTMRKIYSSVPVHFTGTGFYSTDK |
| Ga0181348_11426514 | 3300017784 | Freshwater Lake | MPTYEFECDNEHCESNARIEKWISIHEPHDLECPFCHSSMSKVYSSVSVSFKGTGF |
| Ga0181348_11697941 | 3300017784 | Freshwater Lake | MPTYEFECDNDKCESNARIEEWLSLSEPHDLECPFCHAPMHKIYSSIGVSFKGSG |
| Ga0181348_12327241 | 3300017784 | Freshwater Lake | MPIYEFECDNELCEANARYDKELSINQPHDLDCPFCG |
| Ga0181355_12706441 | 3300017785 | Freshwater Lake | MPIYEFECTNEERCQSNLRYEKEFSINADHDLECPLCHEPMRKIYS |
| Ga0181359_11413991 | 3300019784 | Freshwater Lake | MPIYEFECDNELCEANARYDKELSINEPHDLDCPFCGSPMRKIYSSVSVHFTGT |
| Ga0181359_12716142 | 3300019784 | Freshwater Lake | MPIYEFECDNELCEANARYDKELKINEPHDVDCPFCGSSMRKIYSSVA |
| Ga0213920_10227736 | 3300021438 | Freshwater | MPIYEFECTNDQCEANLRYEKELKINEPHDVECGFCHEPMKKIYSSF |
| Ga0213920_10836751 | 3300021438 | Freshwater | MPIYEFECNNESCEANARYDKELSISEPHDLDCPFCGETMRKVYSSVPAVHFKGSGFY |
| Ga0213921_10151264 | 3300021952 | Freshwater | MPIYEFECTNDKCEANLRYEKEFSINEDHEVLCGFCNE |
| Ga0213922_11103971 | 3300021956 | Freshwater | MPIYEFECNNEQCQSNSRYDQEFSIAEPHDLDCPFCGESMRKVYSSVPAVHFKGSGFY |
| Ga0181354_11692453 | 3300022190 | Freshwater Lake | MPIYEFECDNELCEANARYDKELSINEPHDVDCPFCSSTMRKI |
| Ga0181351_12375242 | 3300022407 | Freshwater Lake | MPIYEFECDNELCEANARYDKELSINEPHDVDCPFCGSTMRKP |
| Ga0255167_10110025 | 3300024350 | Freshwater | MPIYEFECNNERCEANARYDQEFSIAEPHDLDCPFCGESMRKVYSS |
| Ga0255142_10078405 | 3300024352 | Freshwater | MPIYEFECNNERCEANARYEKEYKIAEPHDLDCPFCGESMRKVY |
| Ga0209615_1032971 | 3300025075 | Freshwater | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGILFK |
| Ga0208916_100382611 | 3300025896 | Aqueous | MPIYEFECDNELCEANARYDKELKINEPHDVDCPFC |
| Ga0208916_103146681 | 3300025896 | Aqueous | MPIYEFECTNDLCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGISFKGS |
| Ga0255113_10863672 | 3300027147 | Freshwater | MPIYEFECTNDLCEANLRYEKELKINEPHDVECGFCHEPMRKIYS |
| Ga0255146_10163955 | 3300027396 | Freshwater | MPIYEFECNNERCEANARYEKEYKIAEPHDLDCPF |
| Ga0255146_10558723 | 3300027396 | Freshwater | MPIYEFECNNERCEANARYEKEYKIAEPHDLDCPFCGE |
| Ga0255154_10657751 | 3300027467 | Freshwater | MPIYEFECNNERCEANARYEKEYKIAEPHDLDCPFCGESMSKVYSSVP |
| Ga0208975_10940151 | 3300027659 | Freshwater Lentic | TNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGISFKGTGFYSTDK |
| Ga0209769_11851422 | 3300027679 | Freshwater Lake | MPTYEFQCQNDRCESLSIYDQEYSISEPHDLDCSFCGEAMRKVYSSVPSIIFK |
| Ga0209492_11230411 | 3300027721 | Freshwater Sediment | MPIYEFECTNEECEANLRYEKELSIHEPHSVKCQFCH |
| Ga0209297_10953171 | 3300027733 | Freshwater Lake | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGI |
| Ga0209087_11134961 | 3300027734 | Freshwater Lake | MPIYEFECDNELCEANARYDKELKINEPHDVDCPFCGSS |
| Ga0209087_12194081 | 3300027734 | Freshwater Lake | MPIYEFECTNDLCEANLRYEKELKISEPHDVDCGFCHEPMRKIYSSFGIQFKG |
| Ga0209087_12390871 | 3300027734 | Freshwater Lake | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGISFKGTG |
| Ga0209190_12190913 | 3300027736 | Freshwater Lake | MPIYEFECDNELCEANARYDKELSINEPHDVDCPFCSSTMRKIYSSVP |
| Ga0209134_100348371 | 3300027764 | Freshwater Lake | MPTYEFECDNEQCESNARIEQWMSINEPHDLECPFCHSSMHKVYSSVGVS |
| Ga0209246_102261221 | 3300027785 | Freshwater Lake | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSS |
| Ga0209353_101295521 | 3300027798 | Freshwater Lake | MPTYEFECDNDKCESNARIEEWLSLSEPHDLECPFCHAPMHKIYSSIGVSFKGS |
| Ga0209550_100667541 | 3300027892 | Freshwater Lake | MPIYEFECDNELCEANARYDKELSINEPHDLDCPFCGSPMRKIYSSVS |
| Ga0209253_110856931 | 3300027900 | Freshwater Lake Sediment | MPTYEFECDNEKCESNARIEEWLSITEPHDLECPFCHSPMHKVYSSVGI |
| Ga0209400_11120251 | 3300027963 | Freshwater Lake | MPIYEFECDNELCEANARYDKELKINEPHDVDCPFCGSSMRKIYSSV |
| Ga0209400_13877082 | 3300027963 | Freshwater Lake | MPTYEFECDNENCESNARIEEWLSINEPHDLECPFCHSPMHKVYSSIGVSFKGS |
| Ga0209401_12010362 | 3300027971 | Freshwater Lake | VPIYEFECDNELCEANARYDKELKINEPHDVDCPFCGSSMRKIYSSVA |
| Ga0209298_1001076715 | 3300027973 | Freshwater Lake | VPIYEFECDNELCEANARYDKELKINEPHDVDCPFCGS |
| Ga0209298_101726683 | 3300027973 | Freshwater Lake | VPIYEFECDNELCEANARYDKELKINEPHDVDCPFCGSSMR |
| Ga0209298_101760001 | 3300027973 | Freshwater Lake | CTNDLCESNLRYDKELKINEPHDVECGFCHEPMRKIYSSFGISFKGTGFYSTDK |
| Ga0209299_11179044 | 3300027974 | Freshwater Lake | VPIYEFECTNDQCEANLRYEKELRINEPHDVECGFCHEPMRKIYSSFG |
| Ga0247722_102771172 | 3300028027 | Deep Subsurface Sediment | MPIYEFECTNEECEANLRYEKELSIHAPHTVTCNFCHSPMQKIYSVPNIQFKGE |
| Ga0256331_11187832 | 3300028286 | Freshwater | MPIYEFECNNERCEANARYDQEFSIAEPHDLDCPFCGESMRKVYSSVP |
| Ga0304730_11098463 | 3300028394 | Freshwater Lake | MPIYEFECTNDLCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGIAFKGTGFYF |
| (restricted) Ga0247844_11243454 | 3300028571 | Freshwater | MPIYEFECDNSEGCESNLRYEKEIPLAEPHLYDCPICGSAMRKIYSSVPVHFKSNGF |
| Ga0315907_112605792 | 3300031758 | Freshwater | MPIYEFECDNEKCEANARYEQEFKITEPHDMECPFCHASMHKVYSSVGVAFK |
| Ga0315900_103068561 | 3300031787 | Freshwater | MPIYEFECTNDLCESNLRYDKELKINEPHDVECGFCHEPMRKIYSSFGIQFK |
| Ga0315900_107387091 | 3300031787 | Freshwater | MPIYEFECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIY |
| Ga0315900_108889362 | 3300031787 | Freshwater | MPTYEFECDNEDCESNSRIEHWYHINEPHDLECPFCHSPMHKVYSSVGISFKSPGFYST |
| Ga0315904_107080121 | 3300031951 | Freshwater | MSHAGLARYLMPIYEFECTNEECEANLRYEKELSIHEPHDPKCQFCHSSMQKIYS |
| Ga0315901_106716981 | 3300031963 | Freshwater | MPTYEFECDNEKCESNARIEEWLSITEPHDLECPFCHSPMHKVYSSIGVSFK |
| Ga0315902_101600491 | 3300032093 | Freshwater | MPIYEFECVNEERCQSNLRYEKEYPINADHDLECPLFHEP |
| Ga0315902_112193191 | 3300032093 | Freshwater | MPIYEFECNNESCEANARYDKELSISEPHDLDCPFCGES |
| Ga0315903_105932291 | 3300032116 | Freshwater | MPIYEFECTNEDCEANLRYEKELSIHEPHDPKCQFC |
| Ga0315903_110334651 | 3300032116 | Freshwater | MPTYEFECDNEKCESNARIEEWLSITEPHDLECPFCHSPMHKVYSS |
| Ga0315903_111704461 | 3300032116 | Freshwater | MPTYEFECDNEQCESNARIEQWMSINEPHDLECPFCHSSMHKVYSSVGVSFK |
| Ga0334722_104994942 | 3300033233 | Sediment | MPTYEFECDNELCESNARIEEWLSLSEPHDLECPFCHAPMHKIYSSIGVS |
| Ga0334722_108749341 | 3300033233 | Sediment | MPIYEFECDNELCEANARYDKELSINEPHDLNCPFCDSPMRKIYS |
| Ga0316617_1021132112 | 3300033557 | Soil | MPIYEFECNNERCEANARYDQEFSIAEPHDLDCPFCGESMRKVYSSVPAVHFKGSGF |
| Ga0334994_0359689_2_148 | 3300033993 | Freshwater | MPTYEFECDNENCESNARIEEWLSINEPHDLECPFCHSPMHKVYSSVGV |
| Ga0335023_0694533_349_507 | 3300034050 | Freshwater | MPIYEFECTNDLCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGIQFKG |
| Ga0334987_0684656_477_590 | 3300034061 | Freshwater | MPIYEFECNNEKCEANARYDKELSISEPHDLDCPFCGE |
| Ga0335000_0075459_2226_2348 | 3300034063 | Freshwater | MPIYEFECTNEECEANLRYEKELSIHEPHDPKCQFCHSSMQ |
| Ga0335001_0506336_2_172 | 3300034064 | Freshwater | FECTNDRCEANLRYEKELKINEPHDVECGFCHEPMRKIYSSFGISFKGTGFYSTDK |
| Ga0335019_0181446_1198_1368 | 3300034066 | Freshwater | MPIYEFECNNDKCASNSRYDQEFAIAEPHDLDCPFCGESMRKVYSSVPSVIFKGSGF |
| Ga0335010_0568016_440_580 | 3300034092 | Freshwater | MPIYEFECTNDRCEANLRYEKELSINEPHDVECGFCHEPMRKIYSSF |
| Ga0335027_0783470_1_138 | 3300034101 | Freshwater | MPIYEFECTNDRCEANLRYEKEFKINEDHLVECGLCHEQMRKIYSS |
| Ga0335029_0276070_912_1073 | 3300034102 | Freshwater | MPIYEFECVNEERCQSNLRYEKEYPINADHDLECPLCHEPMRKIYSSVPVIFKS |
| Ga0335029_0617294_3_143 | 3300034102 | Freshwater | MPTYEFECDNEKCESNARIEEWLSITEPHDLECPFCHSPMHKVYSSI |
| Ga0335031_0033632_3614_3727 | 3300034104 | Freshwater | MPTYEFECDNEKCESNARVEEWLSINEPHDLECPFCHS |
| Ga0335031_0063601_2481_2642 | 3300034104 | Freshwater | MPTYEFECDNENCESNARIEQWYSVNEPHDLICPYCQSSMHKVYSSVGVSFKGS |
| Ga0335053_0627581_2_136 | 3300034118 | Freshwater | MPIYEFECTNDRCEANLRYEKEFKINEDHLVECGLCHEPMRKIYS |
| Ga0335060_0035835_2_154 | 3300034122 | Freshwater | MSHAGRVRYLMPIYEFECNNDQCEANARYDKELSISEPHDLDCPFCGETMR |
| Ga0335039_0360520_646_753 | 3300034355 | Freshwater | MPIYEFECTNEECEANLRYEKELSIHEPHDPKCQFC |
| Ga0335048_0107196_1_141 | 3300034356 | Freshwater | MPTYEFECDNENCESNARIEEWLSINEPHDLECPFCHSSMHKVYSSI |
| ⦗Top⦘ |