NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F043682

Metagenome Family F043682

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043682
Family Type Metagenome
Number of Sequences 156
Average Sequence Length 62 residues
Representative Sequence MTPLIFCSILAGYTITGAVEAQPGWMTVDYLDERLTADYIVIPMDAYLECYPDHAAGLTPLEE
Number of Associated Samples 64
Number of Associated Scaffolds 156

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 75.64 %
% of genes near scaffold ends (potentially truncated) 20.51 %
% of genes from short scaffolds (< 2000 bps) 76.92 %
Associated GOLD sequencing projects 58
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.590 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(40.385 % of family members)
Environment Ontology (ENVO) Unclassified
(88.462 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(79.487 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 23.08%    β-sheet: 25.27%    Coil/Unstructured: 51.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 156 Family Scaffolds
PF11753DUF3310 61.54
PF00383dCMP_cyt_deam_1 10.90
PF05272VirE 2.56
PF00476DNA_pol_A 2.56
PF01612DNA_pol_A_exo1 0.64
PF13392HNH_3 0.64
PF13482RNase_H_2 0.64
PF12705PDDEXK_1 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 156 Family Scaffolds
COG0749DNA polymerase I, 3'-5' exonuclease and polymerase domainsReplication, recombination and repair [L] 2.56
COG5545Predicted P-loop ATPase and inactivated derivativesMobilome: prophages, transposons [X] 2.56

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.36 %
UnclassifiedrootN/A0.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10002415All Organisms → cellular organisms → Bacteria10901Open in IMG/M
3300001450|JGI24006J15134_10023877All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae2770Open in IMG/M
3300001450|JGI24006J15134_10031158All Organisms → cellular organisms → Bacteria2338Open in IMG/M
3300001450|JGI24006J15134_10039296All Organisms → cellular organisms → Bacteria2013Open in IMG/M
3300001450|JGI24006J15134_10062244All Organisms → cellular organisms → Bacteria1470Open in IMG/M
3300001450|JGI24006J15134_10066167All Organisms → cellular organisms → Bacteria1405Open in IMG/M
3300001450|JGI24006J15134_10068622All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300001450|JGI24006J15134_10069450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1357Open in IMG/M
3300001450|JGI24006J15134_10079126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1235Open in IMG/M
3300001450|JGI24006J15134_10144240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium789Open in IMG/M
3300001450|JGI24006J15134_10160286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium727Open in IMG/M
3300001450|JGI24006J15134_10182927All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.655Open in IMG/M
3300001940|GOS2222_1006374All Organisms → cellular organisms → Bacteria1821Open in IMG/M
3300004448|Ga0065861_1064319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium996Open in IMG/M
3300004448|Ga0065861_1064321All Organisms → cellular organisms → Bacteria2011Open in IMG/M
3300004448|Ga0065861_1165373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium858Open in IMG/M
3300004448|Ga0065861_1218275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium586Open in IMG/M
3300004461|Ga0066223_1148244All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.859Open in IMG/M
3300005239|Ga0073579_1092012All Organisms → cellular organisms → Bacteria1887Open in IMG/M
3300005239|Ga0073579_1190873Not Available86332Open in IMG/M
3300005239|Ga0073579_1216029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium735Open in IMG/M
3300005239|Ga0073579_1674795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium905Open in IMG/M
3300006752|Ga0098048_1033096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1677Open in IMG/M
3300006789|Ga0098054_1031367All Organisms → cellular organisms → Bacteria2078Open in IMG/M
3300006789|Ga0098054_1208756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales710Open in IMG/M
3300006793|Ga0098055_1028548All Organisms → cellular organisms → Bacteria2324Open in IMG/M
3300006793|Ga0098055_1042779All Organisms → cellular organisms → Bacteria1847Open in IMG/M
3300006793|Ga0098055_1157027All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.874Open in IMG/M
3300006793|Ga0098055_1167177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium843Open in IMG/M
3300006793|Ga0098055_1227313All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.705Open in IMG/M
3300006793|Ga0098055_1230770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium698Open in IMG/M
3300006793|Ga0098055_1238283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium686Open in IMG/M
3300006793|Ga0098055_1269857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium638Open in IMG/M
3300006793|Ga0098055_1332652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium566Open in IMG/M
3300006919|Ga0070746_10097713All Organisms → Viruses → Predicted Viral1468Open in IMG/M
3300006921|Ga0098060_1060125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1110Open in IMG/M
3300006921|Ga0098060_1066818All Organisms → Viruses → Predicted Viral1043Open in IMG/M
3300006921|Ga0098060_1081317All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.929Open in IMG/M
3300006921|Ga0098060_1083842All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.912Open in IMG/M
3300006921|Ga0098060_1099141All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.826Open in IMG/M
3300006924|Ga0098051_1019224All Organisms → cellular organisms → Bacteria1988Open in IMG/M
3300006925|Ga0098050_1009535All Organisms → Viruses → Predicted Viral2871Open in IMG/M
3300006925|Ga0098050_1025607All Organisms → cellular organisms → Bacteria1621Open in IMG/M
3300006925|Ga0098050_1044554All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300007863|Ga0105744_1034392All Organisms → Viruses → Predicted Viral1259Open in IMG/M
3300009529|Ga0114919_10328314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1071Open in IMG/M
3300009593|Ga0115011_10064019All Organisms → cellular organisms → Bacteria2534Open in IMG/M
3300009593|Ga0115011_10118733All Organisms → cellular organisms → Bacteria1888Open in IMG/M
3300010150|Ga0098056_1035150All Organisms → cellular organisms → Bacteria1756Open in IMG/M
3300017708|Ga0181369_1045418All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.995Open in IMG/M
3300017714|Ga0181412_1002357All Organisms → cellular organisms → Bacteria6870Open in IMG/M
3300017714|Ga0181412_1083688All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.765Open in IMG/M
3300017724|Ga0181388_1022975All Organisms → cellular organisms → Bacteria1555Open in IMG/M
3300017724|Ga0181388_1045388All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.1066Open in IMG/M
3300017724|Ga0181388_1065080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium872Open in IMG/M
3300017724|Ga0181388_1071031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium832Open in IMG/M
3300017725|Ga0181398_1000268All Organisms → cellular organisms → Bacteria16016Open in IMG/M
3300017727|Ga0181401_1040001All Organisms → Viruses → Predicted Viral1315Open in IMG/M
3300017728|Ga0181419_1008867All Organisms → cellular organisms → Bacteria3006Open in IMG/M
3300017735|Ga0181431_1086163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium705Open in IMG/M
3300017735|Ga0181431_1090968All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.684Open in IMG/M
3300017740|Ga0181418_1059227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium946Open in IMG/M
3300017741|Ga0181421_1059045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1015Open in IMG/M
3300017741|Ga0181421_1167387All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.567Open in IMG/M
3300017742|Ga0181399_1069718All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.894Open in IMG/M
3300017742|Ga0181399_1087502All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.779Open in IMG/M
3300017744|Ga0181397_1023006All Organisms → cellular organisms → Bacteria1821Open in IMG/M
3300017744|Ga0181397_1038846All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300017744|Ga0181397_1103039All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.749Open in IMG/M
3300017744|Ga0181397_1105230All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.740Open in IMG/M
3300017752|Ga0181400_1054364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1234Open in IMG/M
3300017753|Ga0181407_1044426All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300017753|Ga0181407_1049344All Organisms → Viruses → Predicted Viral1103Open in IMG/M
3300017756|Ga0181382_1056725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1118Open in IMG/M
3300017757|Ga0181420_1041852All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300017757|Ga0181420_1079447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1025Open in IMG/M
3300017757|Ga0181420_1199113All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.582Open in IMG/M
3300017762|Ga0181422_1007733All Organisms → cellular organisms → Bacteria3608Open in IMG/M
3300017762|Ga0181422_1019865All Organisms → cellular organisms → Bacteria2207Open in IMG/M
3300017762|Ga0181422_1059730All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.1216Open in IMG/M
3300017762|Ga0181422_1072746All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300017762|Ga0181422_1148287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium720Open in IMG/M
3300017763|Ga0181410_1123340All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.739Open in IMG/M
3300017764|Ga0181385_1094566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium916Open in IMG/M
3300017770|Ga0187217_1142692All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.804Open in IMG/M
3300017771|Ga0181425_1128499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium808Open in IMG/M
3300017772|Ga0181430_1112885All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.803Open in IMG/M
3300017776|Ga0181394_1231208All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.557Open in IMG/M
3300017776|Ga0181394_1239012All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.546Open in IMG/M
3300017782|Ga0181380_1242441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium599Open in IMG/M
3300017782|Ga0181380_1244435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium596Open in IMG/M
3300017783|Ga0181379_1193174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium715Open in IMG/M
3300017786|Ga0181424_10112432All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300020462|Ga0211546_10041836All Organisms → cellular organisms → Bacteria2245Open in IMG/M
3300020462|Ga0211546_10134746All Organisms → cellular organisms → Bacteria1218Open in IMG/M
3300021347|Ga0213862_10350729All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.526Open in IMG/M
3300021373|Ga0213865_10428729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium580Open in IMG/M
(restricted) 3300024255|Ga0233438_10006550All Organisms → cellular organisms → Bacteria9335Open in IMG/M
(restricted) 3300024255|Ga0233438_10011611All Organisms → cellular organisms → Bacteria6124Open in IMG/M
(restricted) 3300024255|Ga0233438_10013935All Organisms → cellular organisms → Bacteria5358Open in IMG/M
(restricted) 3300024255|Ga0233438_10015840All Organisms → cellular organisms → Bacteria4885Open in IMG/M
(restricted) 3300024255|Ga0233438_10019475All Organisms → cellular organisms → Bacteria4212Open in IMG/M
(restricted) 3300024255|Ga0233438_10024911All Organisms → cellular organisms → Bacteria3516Open in IMG/M
(restricted) 3300024255|Ga0233438_10033500All Organisms → cellular organisms → Bacteria2834Open in IMG/M
(restricted) 3300024255|Ga0233438_10035616All Organisms → cellular organisms → Bacteria2712Open in IMG/M
(restricted) 3300024255|Ga0233438_10045764All Organisms → cellular organisms → Bacteria2274Open in IMG/M
(restricted) 3300024255|Ga0233438_10076092All Organisms → cellular organisms → Bacteria1602Open in IMG/M
(restricted) 3300024255|Ga0233438_10084994All Organisms → cellular organisms → Bacteria1485Open in IMG/M
(restricted) 3300024255|Ga0233438_10108113All Organisms → cellular organisms → Bacteria1256Open in IMG/M
(restricted) 3300024255|Ga0233438_10116406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1193Open in IMG/M
(restricted) 3300024255|Ga0233438_10122152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1154Open in IMG/M
(restricted) 3300024255|Ga0233438_10183408All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.872Open in IMG/M
(restricted) 3300024255|Ga0233438_10199471All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.823Open in IMG/M
(restricted) 3300024255|Ga0233438_10214645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium781Open in IMG/M
(restricted) 3300024255|Ga0233438_10231258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium741Open in IMG/M
(restricted) 3300024255|Ga0233438_10302041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium613Open in IMG/M
(restricted) 3300024255|Ga0233438_10334396All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.570Open in IMG/M
(restricted) 3300024518|Ga0255048_10177004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1044Open in IMG/M
(restricted) 3300024520|Ga0255047_10454781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium645Open in IMG/M
3300025071|Ga0207896_1036908All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.821Open in IMG/M
3300025079|Ga0207890_1050454All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.707Open in IMG/M
3300025084|Ga0208298_1024407All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.1309Open in IMG/M
3300025084|Ga0208298_1069854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium662Open in IMG/M
3300025085|Ga0208792_1032809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1024Open in IMG/M
3300025085|Ga0208792_1036147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium964Open in IMG/M
3300025099|Ga0208669_1003459All Organisms → cellular organisms → Bacteria5187Open in IMG/M
3300025108|Ga0208793_1018712All Organisms → cellular organisms → Bacteria2483Open in IMG/M
3300025108|Ga0208793_1098480All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.823Open in IMG/M
3300025108|Ga0208793_1127077All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.692Open in IMG/M
3300025108|Ga0208793_1196518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium507Open in IMG/M
3300025120|Ga0209535_1008290All Organisms → cellular organisms → Bacteria6070Open in IMG/M
3300025141|Ga0209756_1031200All Organisms → cellular organisms → Bacteria2860Open in IMG/M
3300025168|Ga0209337_1024740All Organisms → cellular organisms → Bacteria3426Open in IMG/M
3300025168|Ga0209337_1024896All Organisms → cellular organisms → Bacteria3412Open in IMG/M
3300025168|Ga0209337_1040568All Organisms → cellular organisms → Bacteria2494Open in IMG/M
3300025168|Ga0209337_1062006All Organisms → Viruses → Predicted Viral1883Open in IMG/M
3300025168|Ga0209337_1062016All Organisms → cellular organisms → Bacteria1883Open in IMG/M
3300025168|Ga0209337_1128775All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300025168|Ga0209337_1140601All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.1060Open in IMG/M
3300025168|Ga0209337_1144786All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300025168|Ga0209337_1146998All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.1026Open in IMG/M
3300025168|Ga0209337_1166248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium936Open in IMG/M
3300025168|Ga0209337_1204117All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.800Open in IMG/M
3300025168|Ga0209337_1242670All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.696Open in IMG/M
3300025879|Ga0209555_10220182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium756Open in IMG/M
3300027906|Ga0209404_10046973All Organisms → cellular organisms → Bacteria2435Open in IMG/M
3300028197|Ga0257110_1004151All Organisms → cellular organisms → Bacteria6660Open in IMG/M
3300031621|Ga0302114_10369766All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.543Open in IMG/M
3300032011|Ga0315316_10350656All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.1239Open in IMG/M
3300032073|Ga0315315_10073247All Organisms → Viruses → Predicted Viral3178Open in IMG/M
3300032073|Ga0315315_10110922All Organisms → cellular organisms → Bacteria2555Open in IMG/M
3300032073|Ga0315315_10212994All Organisms → cellular organisms → Bacteria1803Open in IMG/M
3300032073|Ga0315315_10389019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1297Open in IMG/M
3300032073|Ga0315315_10643380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium976Open in IMG/M
3300032073|Ga0315315_11761195All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.528Open in IMG/M
3300033742|Ga0314858_083243All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.804Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine40.38%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater27.56%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater14.10%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater4.49%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.21%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine3.21%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.28%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.28%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.28%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.64%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.64%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.64%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.64%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.64%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001940Marine microbial communities from Bay of Fundy, Nova Scotia, Canada - GS006EnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020462Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1000241563300000116MarineMTPLIFCSILAGYAITGAVENQPGWMTVNYLDKNQIAEYIVIPMDAYIECYPNHAAGLTAPEK*
JGI24006J15134_1002387753300001450MarineMTPLIFCSILAGYSITGAVESQPGWMTVDYLDEHLTADYIVIPMDAYLECYPNYAXGLTPLEE*
JGI24006J15134_1003115843300001450MarineMNTLIFCNILAAWTITGAVEAQPGWMTVDYLDERMTADYIVIPMESYLECYPNHAAGLTPLEE*
JGI24006J15134_1003929643300001450MarineMTPLIFCSILAGYTITGAVETQPGWMTVDYLDNTLTADYIVIPMDAYLECYPEDAAGLTPLEE*
JGI24006J15134_1006224433300001450MarineMNALIFCNVLAAWTITGAVEAQPGWMTVDYLDEHLTADYIVIPMDAYLECYPNEAAGLTPLEE*
JGI24006J15134_1006616713300001450MarineTPLIFCSILAGYTITGAVETQPGWMTVDYLDKTLAADYIVIPMDAYIECYPEHAALAALEE*
JGI24006J15134_1006862233300001450MarineMTPLIFCSILAGYTIVGAVETQPGWMTVDYLDKTLTADYIVIPMDAYLECYPANAAGLTALEE*
JGI24006J15134_1006945023300001450MarineMTPLIFCSILAGYTITGAVEAQPGWMTVDYLDNTLTADYIVIPMDAYLECYPADAAGLTPLEE*
JGI24006J15134_1007912633300001450MarineLAGYTITGAVEAQPGWMTVDYLDERLTADYIVIPMDAYLECYPEDAAGLTPLEE*
JGI24006J15134_1014424023300001450MarineMTPLIFCSILAGYTITGAVEAQPGWMTVDYLDERLTADYIVIPMDAYLECYPDHAAGLTPLEE*
JGI24006J15134_1016028633300001450MarineLKGERMTPLIFCSILAGYTIVGAVETQPGWMTVDYLDKTLTADYIVIPMDAYLECYPEYAVSAALEE*
JGI24006J15134_1018292713300001450MarineMNTLIFCNILAAWTITGAVESQPGWMTVDYLDERMTADYIVIPMDAYLECYPNHAAGLTPLEE*
GOS2222_100637433300001940MarineMNALIFCSILASYTITGAVESQPGWMTVNYLDKNLTADYIVIPMDQYLECYPLDAIQ*
Ga0065861_106431933300004448MarineMSALIFCSILAGYTITGAVESQPGWMTVNYLDKNLTADYIVIPMDQYLECYPLDAIQ*
Ga0065861_106432133300004448MarineMTPLIFCSILAGYTITGAVESQPGWMTVDYLDKHITADYIVIPMDAYLECYPVHAAGLTALEEE*
Ga0065861_116537313300004448MarineTWTITGAVEAQPGWMTVDYLDERMTADYIVIPMDAYLECYPNHAAGLTPLEEE*
Ga0065861_121827523300004448MarineMNELIFCSILAGYTITGAVEAQPGWMTVDYLDQVLTADYIVIPMDAYLECYPNHAAGLTPLEE*
Ga0066223_114824423300004461MarineMNALIFCEILAAWTITGAVESQPGWMTVDYLDKQMTADYIVIPMDAYLECYPNHAAGLTPLEEE*
Ga0073579_109201223300005239MarineMTPLIFCTILASYTITGAAEKQPGWITVDYLNKNLTADYIVIPLDAYLECYPHHAAGLTTPKK*
Ga0073579_11908731213300005239MarineMTPLIFCSILAGYAITGAVENQPGWMTVNYLDKNQIAEYIVIPMDAYIECYPKHAAGLTAPEK*
Ga0073579_121602923300005239MarineMTPLIFCSILAGYSITGAVEAQPGWMTVDYLDEHLTADYIVIPMDAYLECYPDYAAGLTPLEE*
Ga0073579_167479523300005239MarineMNALIFCEILAAWTITGAVEAQPGWMTVDYLDQRMTADYIVIPMDAYLECYPNHAAGLTPLEEE*
Ga0098048_103309633300006752MarineMTPLIFCSILAGYTITGAVESQPGWMTVDYLDERMTADYIVIPMDAYLECYPNHAAGLTPLEEE*
Ga0098054_103136723300006789MarineMTPLIFCSILAGYTITGAVESQPGWMTVDYLDERMTADYIVIPMDAYLECYPDNAAGLTPLEE*
Ga0098054_120875613300006789MarineMTPLIFCSILAGYTITGAVEAQPGWMTVDYLDSNLTADYIVIPMDAYLECYPDHAAGLTP
Ga0098055_102854823300006793MarineMTPLIFCSILAGYTITGAVESQPGWMTVDYLDERLTADYIVIPMDAYIECYPEHAVSAAFEE*
Ga0098055_104277933300006793MarineMTPLIFCSILAGYAITGAVESQPGWMTVDYLDERMTADYIVIPMDAYLECYPDNAAGLTPLEE*
Ga0098055_115702733300006793MarineMTPLIFCSILAGYTITGAVESQPGWMTVDYLDKRMTADYIVIPMDAYLECYPDHAIGSAPLEE*
Ga0098055_116717723300006793MarineMTPLIVCSILAGYTITGAVESQPGWMTVDYLDERLTADYIVIPMDAYIECYPEHAVSAAFEE*
Ga0098055_122731323300006793MarineMNALIFCEILAAWTITGAVETQPGWMTVDYLDERMTADYIVIPMDAYLECYPNHAAGLTPLEEE*
Ga0098055_123077023300006793MarineMNALIFCEILAAFTITGAVEAQPGWMTVDYLDERMTADYIVIPMDAYLECYPNHAAGLTALEE*
Ga0098055_123828323300006793MarineMTPLIFCSILAGYTITGAVEAQPGWMTVDYLNGTTADYIVIPMDAYLECYPGHTGDSTSLEE*
Ga0098055_126985733300006793MarineYTITGAVEAQPGWMTVDYLDSNLTADYIVIPMDAYLECYPDHAAGLTPLEE*
Ga0098055_133265223300006793MarineMTPLIFCSILAGYTITGAVEAQPGWMTVDYLNGTTADYIVIPMDAYLECYPDHAAGLTPLEE*
Ga0070746_1009771333300006919AqueousMTPLIFCSILAGYTITGAVESQPGWMTVNYLDKELTADYIVIPMDAYLECYPDDAVGSAPSKE*
Ga0098060_106012513300006921MarineNKMNALIFCEILAAWTITGAVEAQPGWMTVDYIDERMTADYIVIPMDAYLECYPDHAAGLTPLEE*
Ga0098060_106681823300006921MarineMTPLIFCSILAGYTITGAVESQPGWMTVNYLDTNLTADYIVIPMDAYLECYPSDAAGLTPLEE*
Ga0098060_108131713300006921MarineMTPLIFCSILAGYTITGAVESQPGWMTVNYLNQELTADYIVIPMDAYIECYPEQAALAALEE*
Ga0098060_108384223300006921MarineMTPLIFCSILAGYTITGAVEAQPGWMTVDYLDERLTADYIVIPMDAYLECYPAHAAGLTPLEE*
Ga0098060_109914123300006921MarineMNALIFCEILAAWTITGAVEAQPGWMTVNYLDKDLTADYIVIPMDAYLECYPDHAAGLTPLEE*
Ga0098051_101922433300006924MarineMTPLIFCSILAGYTITGAVESQPGWMTVDYLDERLTADYIVIPMDAYIECYPEHAVSAALEE*
Ga0098050_100953523300006925MarineMTPLIFCSILAGYTITGAVESQPGWMTVDYLDERLTADYIVIPINAYIECYPEHAVSAALEE*
Ga0098050_102560733300006925MarineMTPLIFCSILAGYTITGAVEAQPGWMTVDYLDSNLTADYIVIPMDAYLECYPDHAAGLTPLEE*
Ga0098050_104455423300006925MarineMTPLIFCSILAGYQITGAVESQPGWMTVDYLDERMTADYIVIPMDAYLECYPDNAAGLTPLEE*
Ga0105744_103439223300007863Estuary WaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLDGPTADYIIIPMDAYLECYPDHAAGLTPLEE*
Ga0114919_1032831423300009529Deep SubsurfaceSILASYTITGAVESEPGWMTVDYLDNRLTADYIVIPMDAYLECYPNHAAGLTPLKKQEPVPLF*
Ga0115011_1006401953300009593MarineMNALIFCNILAAYTITGAVEAQPGWMTVNYLDQTNTPDYLVIPMDAYLECYPQQVIQ*
Ga0115011_1011873323300009593MarineMNELIFCNLLAAVTITGAVESQPGWMTINYIDDTATADYMTIPMAAYLQCYPAAAITSATLEE*
Ga0098056_103515033300010150MarineMTPLIFCSILAGYTITGAVESQPGWMTVDYLDEHLTADYIVIPMDAYIECYPEHAVSAAFEE*
Ga0181369_104541833300017708MarineMTPLIFCSILAGYTITGAVESQPGWMTVNYLDTNLTADYIVIPMDAYLECYP
Ga0181412_100235773300017714SeawaterMTPLIFCSILAGYTITGAVEKQPGWMTVNYLDEHLTADYIVIPMDAYIECYPNYASGLTAPKE
Ga0181412_108368813300017714SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVDYLDERATADYIVIPMDAYLECYPAN
Ga0181388_102297523300017724SeawaterMNPLIFCNILAAWTITGAVETQPGWMTVDYLDEHLTADYIVIPMDAYLECYPNEAAGLTPLEE
Ga0181388_104538823300017724SeawaterMNALIFCEILAAWTITGAVEAQPGWMTVDYLDERMTADYIVIPMDAYLECYPDHAAGLTPLEE
Ga0181388_106508033300017724SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLDGPTADYIIIPMDAYLECYPDHAAGLTPLEE
Ga0181388_107103133300017724SeawaterMTPLIFCSILAGYTITGAVEAQPGWMTVDYLDNDLTADYIVIPMDAYIECYPDHAAGLTPLEE
Ga0181398_1000268213300017725SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVDYLDQRMTADYIVIPMDAYLECYPNHAAGLTPLEE
Ga0181401_104000133300017727SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLDERMTADYIVIPMDAYLECYPSDAAGLTPLEE
Ga0181419_100886753300017728SeawaterMTPLIFCSILAGYTITGAVESEPGWMTVDYLDNTLTADYIVIPMDAYLECYPSEAAGLTPLIKE
Ga0181431_108616323300017735SeawaterMTPLIFCSILAGYSITCAVESQPGWMTVNYLDERLTADYIVIPMDAYLECYPSDAAGLTPLEE
Ga0181431_109096823300017735SeawaterMNALIFCEILAAWTITGAVEAQPGWMTVDYIDERMTADYIVIPMDAYLECYPDHAAGLTPLEE
Ga0181418_105922723300017740SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLNKDLTADYIVIPMDAYIECYPEQAVLATLEE
Ga0181421_105904523300017741SeawaterMNALIFCEILAAWTITGAVESQPGWMTVDYIDERMTADYIVIPMDAYLECYPNHAAGLTPLEE
Ga0181421_116738723300017741SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLNKDLTADYIVIPMDAYIECYPDHAAGLAPLEE
Ga0181399_106971823300017742SeawaterMTPLIFCSILAGYTITGAVEAQPGWMTVDYLDNDLTADYIVIPMDAYIECYPDHAAGLAPLEE
Ga0181399_108750223300017742SeawaterMTPLIFCSILAGYTITGAVEKQPGWITVNYLDEYLTADYIVIPMDAYIECYPNYASGLTAPKE
Ga0181397_102300613300017744SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLNKDLTADYIVIPMDAYIECYPEHA
Ga0181397_103884633300017744SeawaterMTPLIFCNILAAWTITGAVESQPGWMTVNYLDKNLTADYIVIPMDAYLECYPVSAAGLTALEE
Ga0181397_110303923300017744SeawaterMTPLIFCSILAGYTITGAVETQPGWMTVDYLDKRMTADYIVIPMDAYLECYP
Ga0181397_110523033300017744SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVDYLDERMTADYIVIPMDAYLECYPGQAAGLTPLEE
Ga0181400_105436423300017752SeawaterMTPLIFCSILAGYSITGAVESQPGWMTVNYLDERLTADYIVIPMDAYLECYPSDAAGLTPLEE
Ga0181407_104442613300017753SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLNKDLTADYIVIPMDAYIECYPEHP
Ga0181407_104934433300017753SeawaterCSILAGYTITGAVESQPGWMTVNYLDKELTADYIVIPMDAYIECYPEHASSTTLEE
Ga0181382_105672533300017756SeawaterMTPLIFCSILAGYTITGAVESEPGWMTVGYLDNTLTADYIVIPMDAYLECYPSEAAGLTPLIKE
Ga0181420_104185233300017757SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVDYLNERMTADYIVIPMDAYLECYPDHASGLTPLEE
Ga0181420_107944713300017757SeawaterGTLVFESINSTLKGDRMTPLIFCSILAGYTITGAVESQPGWMTVNYLNKNLTADYIVIPMDAYIECYPEHAASTTLEE
Ga0181420_119911323300017757SeawaterMTPLIFCHIIAAYTITGVVESQPGWVTVDYLDEKLTADYIIIPTDAYLECYPDHAAGLTPLEE
Ga0181422_100773333300017762SeawaterMTPLIFCSILAGYTITGAVEAQPGWMTVNYLDKDLTADYIVIPMDAYIECYPDHAAGLAPLEE
Ga0181422_101986543300017762SeawaterMNALIFCSVLAGYTITGSVESEPGWMTVNYLDKNLTADYIVIPMDQYLECYPEEAIQ
Ga0181422_105973033300017762SeawaterMTPLIFCSILAGYTITGAVEKQPGWMTVDYLNGATADYIVIPMDAYLECYPDHASGLTPLEE
Ga0181422_107274633300017762SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLDKELTADYIVIPMDAYLECYPEEAIQY
Ga0181422_114828723300017762SeawaterMTPLIFCSILAGYSITGAVESQPGWMTVNYLDERLTADYIVIPMDAYLECYPSNAAGLTPLEE
Ga0181410_112334013300017763SeawaterMTPLIFCSILAGYTITGAVEKQPGWMTVNYLDEHLTADYIVIPMDAYIECYPNYASGLTA
Ga0181385_109456623300017764SeawaterMTPLIFCSILAGYSITGAVESQPGWMTVNYLDERMTADYIVIPMDAYLECYPGDAAGLTPLEE
Ga0187217_114269223300017770SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLNKDLTADYIVIPMDAYIECYPEQAALAAFEE
Ga0181425_112849923300017771SeawaterMTPLIFCSILAGYSITGAVESQPGWMTVNYLDEHLTADYIVIPMDAYLKCYPNHAAGLTPLEE
Ga0181430_111288523300017772SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVDYLDERATADYIVIPMDAYLECYPAHAAGLAPLEE
Ga0181394_123120823300017776SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVDYLDERMTADYIVIPMDAYLECYPDHASGL
Ga0181394_123901223300017776SeawaterMNALIFCEILAAWTITGAVEAQPGWMTVDYIDERMTADYIVIPMDAYLECYPDHAAG
Ga0181380_124244113300017782SeawaterILAGYTITGAVESQPGWMTVNYLDERLTADYIVIPMDAYLECYPSDAAGLTPLEE
Ga0181380_124443513300017782SeawaterINSTLEGDKMTPLIFCSILAGYTITGAVESQPGWMTVNYLDKELTADYIVIPMDAYIECYPEQAVLATLEE
Ga0181379_119317423300017783SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVDYLNGATADYIVIPMDAYLECYPGHAAGLTSLEE
Ga0181424_1011243233300017786SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLNKDLTADYIVITMDAYIECYPEHAAP
Ga0211546_1004183643300020462MarineMTPLIFCSILAGYTITGAVESQPGWMTVDYLDNTLTADYIVIPMDAYLECYPEEAIQ
Ga0211546_1013474623300020462MarineMNELIFCNLLAAVTITGAVESQPGWMTINYIDDTATADYMTIPMAAYLQCYPTDAITSAPLEE
Ga0213862_1035072913300021347SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLDKELTADYIVIPMDAYLECYPDDAVG
Ga0213865_1042872913300021373SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLDKELTADYIVIPMDAYLECYPDDAVGSAPSKE
(restricted) Ga0233438_1000655043300024255SeawaterMNALIFCEILAAWTITGAVESQPGWMTVDYIDERMTADYIVIPMDAYLECYPDHAAGLTPLEE
(restricted) Ga0233438_1001161163300024255SeawaterMTPLIFCSILAGYTITGAVESEPGWMTVNYLDERMTADYIVIPMDAYLECYPSDAAGLTPLEE
(restricted) Ga0233438_1001393583300024255SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVDYLDSTLTADYIVIPMDAYLECYPNHAAGLAPLEE
(restricted) Ga0233438_1001584053300024255SeawaterMTPLIFCSILAGYTITGAVEAQPGWMTVNYLDKDLTADYIVIPMDAYVECYPDHAAGLTPLEE
(restricted) Ga0233438_1001947553300024255SeawaterMTPLIFCSILASYTITGAVEKQPGWVTVDYLNKNLTADYIVIPMDAYLECYPYHAAGLTPLKE
(restricted) Ga0233438_1002491133300024255SeawaterMNPLIFCSILASYTITGAVESEPGWMTVDYLDNKLTADYIVIPMDAYLECYPNHAAELTSLKKQEFISEL
(restricted) Ga0233438_1003350053300024255SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLDKELTADYIVIPMDAYLECYPDQAAGLTPLEK
(restricted) Ga0233438_1003561633300024255SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVDYLDQRMTADYIVIPMDAYLECYPDHAAGLTPLKE
(restricted) Ga0233438_1004576433300024255SeawaterMTPLIFCGILAGYTITGAVESQPGWMTVDYLDERMTADYIVIPMDAYLECYPGHAAGLTTLEE
(restricted) Ga0233438_1007609243300024255SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLDKELTADYIVIPMDAYLECYPDQAAGLT
(restricted) Ga0233438_1008499433300024255SeawaterMTPLIFCSILAGYTITGAVNSQPGWMRVNYLDKNLQADYIVIPMDAYLECYPEHAVSATLEE
(restricted) Ga0233438_1010811323300024255SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVDYLDERMTADYIVIPMDAYLECYPDHAAGLTPLEE
(restricted) Ga0233438_1011640633300024255SeawaterGYTITGAVEAQPGWMTVDYLDERMTADYIVIPMDAYLECYPNHAAGLAPLEE
(restricted) Ga0233438_1012215233300024255SeawaterMNELIFCNVLAAMTITGAVETQPGWMTVDYLSDDLTADYIVIPMDAYLECYPDHAAGLTTLEE
(restricted) Ga0233438_1018340823300024255SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVDYLNERMTADYIVIPMDAYLECYPNHAAGLTPLEE
(restricted) Ga0233438_1019947123300024255SeawaterMNALIFCEILAAWTITGAVEAQPGWMTVDYLDERMTADYIVIPMDAYLECYPNHAAGLTPLEE
(restricted) Ga0233438_1021464523300024255SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVDYLDQGLTADYIVIPMDAYIECYPEHAASAALEE
(restricted) Ga0233438_1023125823300024255SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLGKDLTADYIVIPMDAYIQCYPEHATSTAFEE
(restricted) Ga0233438_1030204113300024255SeawaterFCSILAGYTITGAVESQPGWMTVDYLDRTMTADYIVIPMDAYLECYPNHAAGLTPLEE
(restricted) Ga0233438_1033439623300024255SeawaterMNTLIFCNMLAAWTITGAVEAQPGWMTVNYLDERLTADYIVIPMDAYLECYPNHAAGLTPLEE
(restricted) Ga0255048_1017700423300024518SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLDKELTADYIVIPMDAYLECYPDQAAGLTPLEE
(restricted) Ga0255047_1045478123300024520SeawaterMNALIFCEILAAWTITGAVETQPGWMKVDYLDERMTADYIVIPMDAYLECYPNHAAGLTPLEE
Ga0207896_103690823300025071MarineMNTLIFCNILAAWTITGAVEAQPGWMTVDYLDERMTADYIVIPMESYLECYPNHAAGLTPLEE
Ga0207890_105045433300025079MarineMTPLIFCSILAGYSITGAVESQPGWMTVDYLDEHLTADYIVIPMDAYLECYPEDAAGLTPLEE
Ga0208298_102440723300025084MarineMTPLIFCSILAGYAITGAVESQPGWMTVDYLDERMTADYIVIPMDAYLECYPDNAAGLTPLEE
Ga0208298_106985423300025084MarineMTPLIFCSILAGYTITGAVEAQPGWMTVDYLDSNLTADYIVIPMDAYLECYPDHAAGLTPLEE
Ga0208792_103280933300025085MarineLRGYKMTPLIFCSILAGYTITGAVEAQPGWMTVDYLDSNLTADYIVIPMDAYLECYPDHAAGLTPLEE
Ga0208792_103614723300025085MarineMTPLIFCSILAGYTITGAVEAQPGWMTVDYLNGTTADYIVIPMDAYLECYPDHAAGLTPLEE
Ga0208669_100345953300025099MarineMTPLIFCSILAGYTITGAVESQPGWMTVNYLDTNLTADYIVIPMDAYLECYPSDAAGLTPLEE
Ga0208793_101871233300025108MarineMTPLIFCSILAGYTITGAVESQPGWMTVDYLDSNLTADYIVIPMDAYLECYPDHAAGLTPLEE
Ga0208793_109848023300025108MarineMNALIFCEILAAWTITGAVETQPGWMTVDYLDERMTADYIVIPMDAYLECYPNHAAGLTPLEEE
Ga0208793_112707723300025108MarineMTPLIFCSILAGYTITGAVESQPGWMTVDYLDERLTADYIVIPMDAYIECYPEHAVSAAFEE
Ga0208793_119651813300025108MarineNALIFCEILAAFTITGAVEAQPGWMTVDYLDERMTADYIVIPMDAYLECYPNHAAGLTALEE
Ga0209535_100829073300025120MarineMNPLIFCSILAGYTITGAVEKQPGWMTVNYLDEHLTSDYIVIPMDAYIECYPNYASGLTAPKE
Ga0209756_103120053300025141MarineMNPLIFCSVLASYTITGAVETQPGWMTVDYLNSDMTADYIVIPMDAYLECYPDHASGLTPLKE
Ga0209337_102474073300025168MarineMTPLIFCSILAGYTIVGAVETQPGWITVDYLDKTLAADFIVIPMDAYIECYPEHAALAALEE
Ga0209337_102489633300025168MarineMTPLIFCSILAGYSITGAVESQPGWMTVDYLDEHLTADYIVIPMDAYLECYPNYAGGLTPLEE
Ga0209337_104056833300025168MarineMNALIFCNVLAAWTITGAVEAQPGWMTVDYLDEHLTADYIVIPMDAYLECYPNEAAGLTPLEE
Ga0209337_106200653300025168MarineMTPLIFCSILAGYTITGAVEAQPGWMTVDYLDNTLTADYIVIPMDAYLECYPGHAAGLTPLEE
Ga0209337_106201623300025168MarineMTPLIFCSILAGYTITGAVEAQPGWMTVDYLDNTLTADYIVIPMDAYLECYPSDAAGLTPLEE
Ga0209337_112877523300025168MarineMTPLIFCSILAGYTIVGAVETQPGWMTVDYLDKTLTADYIVIPMDAYLECYPANAAGLTALEE
Ga0209337_114060123300025168MarineMTPLIFCSILAGYTITGAVEAQPGWMTVDYLDERMTADYIVIPMDAYLECYSDHAANLTPLEE
Ga0209337_114478633300025168MarineMTPLIFCSILAGYTITGAVEAQPGWMTVDYLDERLTADYIVIPMDAYLECYPDHAAGLTPLEE
Ga0209337_114699813300025168MarineMNPLIFCNILAAWTITGAVEAQPGWMTVDYLDEHLTADYIVIPMDAYLECYPNEAAGLTPLEE
Ga0209337_116624833300025168MarineMNTLIFCNILAAWTITGAVESQPGWMTVDYLDERMTADYIVIPMESYLECYPNHAAGLTPLEE
Ga0209337_120411723300025168MarineMTPLIFCSILAGYTITGAVETQPGWMTVDYLDNTLTADYIVIPMDAYLECYPEDAAGLTPLEE
Ga0209337_124267023300025168MarineMNELIFCNILAAFTITGAVEAQPGWMIVDYLDERMTADYIVIPMDAYLECYPDHAAGLTPLEE
Ga0209555_1022018223300025879MarineMTPLIFCSILAGYTITGAVESQPGWMTVDYLDRTMTADYIVIPMDAYLECYPDHAAGLTPLEE
Ga0209404_1004697363300027906MarineMNELIFCNLLAAVTITGAVESQPGWMTINYIDDTATADYMTIPMAAYLQCYPAAAITSATLEE
Ga0257110_100415153300028197MarineMTPLIFCSILAGYTITGAVEKQPGWMTVNYLDGHLTADYIVIPMDAYIECYPNYASGLTAPKE
Ga0302114_1036976613300031621MarineMTPLIFCSILAGYTITGAVESQPGWMTVDYLDPTLTADYIVIPMDSYLECYPNHAAGLTPLK
Ga0315316_1035065633300032011SeawaterMTPLIFCSILASYTITGAVEKQPGWVTVDYLNKNLTADYIVIPMDAYLECYPAHAAGLTPLKE
Ga0315315_1007324713300032073SeawaterAGYTITGAVESQPGWMTVDYLDERATADYIVIPMDAYLECYPAHAAGLTPLEE
Ga0315315_1011092243300032073SeawaterMTSLIFCHIIAAYTITGVVESQPGWVTVDYLDEKLTADYIIIPTDAYLECYPDHAAGLTPLEE
Ga0315315_1021299433300032073SeawaterMTPLIFCSILAGYTITGAVETQPGWMTVDYLDEQLTADYIVIPMDAYLECYPAAAAGLTSFEE
Ga0315315_1038901923300032073SeawaterMTPLIFCSILAGYTITGAVESQPGWMTVNYLNKDLTADYIVIPMDAYIECYPEHAASTTLEE
Ga0315315_1064338023300032073SeawaterMNPLIFCSILASYTITGAVESQPGWMTVDYLDQRMTADYIVIPMDAYLECYPSHAAGLTPLKE
Ga0315315_1176119523300032073SeawaterMNALIFCGVLAGYQITGAVESQPGWMTVNYLDEHLTADYIVIPMDQYLECYPQDAIQ
Ga0314858_083243_27_2183300033742Sea-Ice BrineMTPLIFCGILAGYSITGAVESQPGWMTVDYLDEGLTADYIVIPMDAYLECYPNHAAGLTPLEE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.