| Basic Information | |
|---|---|
| Family ID | F043568 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 156 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAVSSLR |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 156 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.29 % |
| % of genes near scaffold ends (potentially truncated) | 18.59 % |
| % of genes from short scaffolds (< 2000 bps) | 70.51 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.077 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (8.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.179 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (64.744 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 156 Family Scaffolds |
|---|---|---|
| PF12779 | WXXGXW | 26.28 |
| PF01557 | FAA_hydrolase | 8.33 |
| PF00005 | ABC_tran | 7.69 |
| PF00202 | Aminotran_3 | 2.56 |
| PF12848 | ABC_tran_Xtn | 1.92 |
| PF03401 | TctC | 1.28 |
| PF00106 | adh_short | 1.28 |
| PF08521 | 2CSK_N | 0.64 |
| PF03631 | Virul_fac_BrkB | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.28 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.64 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.08 % |
| Unclassified | root | N/A | 26.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps_contig30078.19311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1769 | Open in IMG/M |
| 2199352024|deeps_contig69310.42111 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1713 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100540837 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1808 | Open in IMG/M |
| 3300002906|JGI25614J43888_10032134 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1652 | Open in IMG/M |
| 3300002907|JGI25613J43889_10008589 | All Organisms → cellular organisms → Bacteria | 2810 | Open in IMG/M |
| 3300003315|P22013IDBA_10008534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 5295 | Open in IMG/M |
| 3300003319|soilL2_10064543 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1292 | Open in IMG/M |
| 3300004114|Ga0062593_100074445 | All Organisms → cellular organisms → Bacteria | 2265 | Open in IMG/M |
| 3300004156|Ga0062589_101448106 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 672 | Open in IMG/M |
| 3300004463|Ga0063356_101618448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 965 | Open in IMG/M |
| 3300004463|Ga0063356_102329679 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 817 | Open in IMG/M |
| 3300004778|Ga0062383_10216065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 891 | Open in IMG/M |
| 3300005171|Ga0066677_10205541 | Not Available | 1104 | Open in IMG/M |
| 3300005175|Ga0066673_10045966 | Not Available | 2180 | Open in IMG/M |
| 3300005178|Ga0066688_10980564 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 516 | Open in IMG/M |
| 3300005181|Ga0066678_10211796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1241 | Open in IMG/M |
| 3300005290|Ga0065712_10118150 | Not Available | 1710 | Open in IMG/M |
| 3300005327|Ga0070658_10033927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4107 | Open in IMG/M |
| 3300005327|Ga0070658_10320368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1324 | Open in IMG/M |
| 3300005329|Ga0070683_101254311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 712 | Open in IMG/M |
| 3300005330|Ga0070690_100242016 | Not Available | 1273 | Open in IMG/M |
| 3300005330|Ga0070690_100270666 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1208 | Open in IMG/M |
| 3300005330|Ga0070690_100590393 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 842 | Open in IMG/M |
| 3300005337|Ga0070682_100455206 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300005339|Ga0070660_101631681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300005345|Ga0070692_10498608 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 788 | Open in IMG/M |
| 3300005355|Ga0070671_100940790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300005356|Ga0070674_100201707 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300005441|Ga0070700_101930146 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 511 | Open in IMG/M |
| 3300005444|Ga0070694_100225786 | Not Available | 1407 | Open in IMG/M |
| 3300005445|Ga0070708_100785532 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 895 | Open in IMG/M |
| 3300005445|Ga0070708_100822254 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 873 | Open in IMG/M |
| 3300005459|Ga0068867_100043678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 3281 | Open in IMG/M |
| 3300005471|Ga0070698_100601406 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1040 | Open in IMG/M |
| 3300005518|Ga0070699_100770404 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 880 | Open in IMG/M |
| 3300005536|Ga0070697_101470112 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 609 | Open in IMG/M |
| 3300005537|Ga0070730_10095576 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
| 3300005537|Ga0070730_10911343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300005539|Ga0068853_100838710 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 881 | Open in IMG/M |
| 3300005544|Ga0070686_100547997 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 904 | Open in IMG/M |
| 3300005547|Ga0070693_100827423 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 688 | Open in IMG/M |
| 3300005617|Ga0068859_100927861 | Not Available | 955 | Open in IMG/M |
| 3300005834|Ga0068851_10021391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3140 | Open in IMG/M |
| 3300005834|Ga0068851_10643491 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 648 | Open in IMG/M |
| 3300005842|Ga0068858_101187393 | Not Available | 750 | Open in IMG/M |
| 3300005896|Ga0075282_1029552 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 735 | Open in IMG/M |
| 3300006058|Ga0075432_10076599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1208 | Open in IMG/M |
| 3300006058|Ga0075432_10558646 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 518 | Open in IMG/M |
| 3300006173|Ga0070716_100280252 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1150 | Open in IMG/M |
| 3300006178|Ga0075367_10439828 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300006237|Ga0097621_100056075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3218 | Open in IMG/M |
| 3300006237|Ga0097621_101725266 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 596 | Open in IMG/M |
| 3300006358|Ga0068871_102366924 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 506 | Open in IMG/M |
| 3300006638|Ga0075522_10030413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3286 | Open in IMG/M |
| 3300006804|Ga0079221_11814037 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 500 | Open in IMG/M |
| 3300006806|Ga0079220_11573019 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 568 | Open in IMG/M |
| 3300006854|Ga0075425_100260952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1993 | Open in IMG/M |
| 3300006903|Ga0075426_11202880 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 575 | Open in IMG/M |
| 3300006954|Ga0079219_10115267 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1355 | Open in IMG/M |
| 3300006954|Ga0079219_10701400 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 770 | Open in IMG/M |
| 3300007004|Ga0079218_10310556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1287 | Open in IMG/M |
| 3300009078|Ga0105106_10817798 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 664 | Open in IMG/M |
| 3300009098|Ga0105245_10446361 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1301 | Open in IMG/M |
| 3300009098|Ga0105245_13082055 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 516 | Open in IMG/M |
| 3300009176|Ga0105242_10623237 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1045 | Open in IMG/M |
| 3300009176|Ga0105242_12568668 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 558 | Open in IMG/M |
| 3300009177|Ga0105248_10961598 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 964 | Open in IMG/M |
| 3300010397|Ga0134124_10111111 | Not Available | 2398 | Open in IMG/M |
| 3300010403|Ga0134123_12420110 | Not Available | 590 | Open in IMG/M |
| 3300012212|Ga0150985_100712734 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1239 | Open in IMG/M |
| 3300012212|Ga0150985_102028239 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1142 | Open in IMG/M |
| 3300012212|Ga0150985_106769147 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 755 | Open in IMG/M |
| 3300012212|Ga0150985_107140515 | Not Available | 506 | Open in IMG/M |
| 3300012212|Ga0150985_118267987 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 937 | Open in IMG/M |
| 3300012212|Ga0150985_119556866 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1316 | Open in IMG/M |
| 3300012212|Ga0150985_121001648 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 761 | Open in IMG/M |
| 3300012212|Ga0150985_122233593 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 509 | Open in IMG/M |
| 3300012469|Ga0150984_108071270 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 825 | Open in IMG/M |
| 3300012469|Ga0150984_110263776 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 897 | Open in IMG/M |
| 3300012469|Ga0150984_118327735 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 918 | Open in IMG/M |
| 3300012469|Ga0150984_123063687 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1308 | Open in IMG/M |
| 3300012958|Ga0164299_11435932 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 535 | Open in IMG/M |
| 3300013306|Ga0163162_10209104 | Not Available | 2081 | Open in IMG/M |
| 3300015079|Ga0167657_1000314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13483 | Open in IMG/M |
| 3300015171|Ga0167648_1003996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3789 | Open in IMG/M |
| 3300015245|Ga0137409_10315090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1372 | Open in IMG/M |
| 3300015371|Ga0132258_10317106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3841 | Open in IMG/M |
| 3300015371|Ga0132258_11227560 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
| 3300015373|Ga0132257_100205434 | Not Available | 2336 | Open in IMG/M |
| 3300015373|Ga0132257_104498199 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 507 | Open in IMG/M |
| 3300017792|Ga0163161_11696876 | Not Available | 559 | Open in IMG/M |
| 3300017927|Ga0187824_10035894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1502 | Open in IMG/M |
| 3300018064|Ga0187773_10194951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1074 | Open in IMG/M |
| 3300018465|Ga0190269_11507143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300020069|Ga0197907_10624860 | Not Available | 725 | Open in IMG/M |
| 3300021151|Ga0179584_1189632 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 676 | Open in IMG/M |
| 3300021372|Ga0213877_10134895 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 772 | Open in IMG/M |
| 3300021384|Ga0213876_10364141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
| 3300021445|Ga0182009_10312034 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 795 | Open in IMG/M |
| 3300021953|Ga0213880_10164954 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 610 | Open in IMG/M |
| 3300024245|Ga0247677_1000479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4251 | Open in IMG/M |
| 3300025862|Ga0209483_1103397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1241 | Open in IMG/M |
| 3300025909|Ga0207705_10244804 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1366 | Open in IMG/M |
| 3300025909|Ga0207705_10732841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 768 | Open in IMG/M |
| 3300025911|Ga0207654_10404537 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 950 | Open in IMG/M |
| 3300025918|Ga0207662_10147045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1496 | Open in IMG/M |
| 3300025923|Ga0207681_10547264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 952 | Open in IMG/M |
| 3300025924|Ga0207694_11419593 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 586 | Open in IMG/M |
| 3300025944|Ga0207661_10531810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1076 | Open in IMG/M |
| 3300025945|Ga0207679_11233984 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 686 | Open in IMG/M |
| 3300025960|Ga0207651_10646103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 928 | Open in IMG/M |
| 3300026089|Ga0207648_10067297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3123 | Open in IMG/M |
| 3300026142|Ga0207698_10224708 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1700 | Open in IMG/M |
| 3300026320|Ga0209131_1001824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 14625 | Open in IMG/M |
| 3300026331|Ga0209267_1284158 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 555 | Open in IMG/M |
| 3300027843|Ga0209798_10184241 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300027857|Ga0209166_10495013 | Not Available | 628 | Open in IMG/M |
| 3300027907|Ga0207428_10373933 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1046 | Open in IMG/M |
| 3300028379|Ga0268266_11615659 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 624 | Open in IMG/M |
| 3300028792|Ga0307504_10012906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1930 | Open in IMG/M |
| 3300031058|Ga0308189_10338109 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 602 | Open in IMG/M |
| 3300031091|Ga0308201_10078530 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 904 | Open in IMG/M |
| 3300031548|Ga0307408_100412944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1162 | Open in IMG/M |
| 3300031740|Ga0307468_100567359 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 918 | Open in IMG/M |
| 3300031938|Ga0308175_100553367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1232 | Open in IMG/M |
| 3300032174|Ga0307470_10469524 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 910 | Open in IMG/M |
| 3300032828|Ga0335080_12418620 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 500 | Open in IMG/M |
| 3300032829|Ga0335070_10592094 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1044 | Open in IMG/M |
| 3300033407|Ga0214472_10333637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1436 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 8.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.69% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 7.05% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.21% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.21% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.92% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.28% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.28% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.28% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.28% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.28% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.28% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.28% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.28% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.28% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.28% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.28% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.64% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.64% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.64% |
| Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.64% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.64% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.64% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.64% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300003315 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P2 sample | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015079 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015171 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_03682210 | 2199352024 | Soil | MWTRRVLLATMVAACAMTLPRHVPASWNAGNANTNVAISSLR |
| deeps_00451230 | 2199352024 | Soil | MWTRRLLLATMVAAAAMSLPRHVPASWNVGLDNTNVAISSLR |
| INPhiseqgaiiFebDRAFT_1005408373 | 3300000364 | Soil | MWTRRLLLATMVAACAMSLPRHVPDSSSSGLGTTQVAVSSLR* |
| JGI25614J43888_100321343 | 3300002906 | Grasslands Soil | MWTRRLLLATLVAACAMSLPRHAPSTWNVGLGPTPVAVTSR* |
| JGI25613J43889_100085893 | 3300002907 | Grasslands Soil | MWTRRVLLATMVAACAMSLPRHVPASWGAGLGTTQVAISSPR* |
| P22013IDBA_100085341 | 3300003315 | Ore Pile And Mine Drainage Contaminated Soil | MWTRRLLLATMVAAAAMTLPRHVPASWNSGLAAQGVSLSALR* |
| soilL2_100645433 | 3300003319 | Sugarcane Root And Bulk Soil | MWTRRLLLATMVAAAAMSLPRHVPASWSAGFGNSQIAVSSLR* |
| soilH2_100666093 | 3300003324 | Sugarcane Root And Bulk Soil | MWTRRVLLATLVAAAAMSLPRHVPASWNSGLGLASSSEVSALR* |
| Ga0062593_1000744452 | 3300004114 | Soil | MWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAVSSLR* |
| Ga0062589_1014481061 | 3300004156 | Soil | VVQLPQEANMWTRRVLLATMIAAAAMSLPRHVPASWVSAEGVQAVAVSSFR* |
| Ga0063356_1016184482 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MWTRRLLLATMVAACAMSLPRHVPASWNVGLGTTQVAVSSLR* |
| Ga0063356_1023296792 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MWTRRVLLATMVAACAMSLPRHVSSSWNTGLGTTQVAVSSSR* |
| Ga0062383_102160652 | 3300004778 | Wetland Sediment | MWTRRLLLATMVAAAAMSLPRHVPASWSAALGAPGTTVALSSLR* |
| Ga0066677_102055411 | 3300005171 | Soil | MWTRRLLLATMVAACALSLPRHAPSSWNLFGTSQVAVTSLR* |
| Ga0066673_100459661 | 3300005175 | Soil | MWTRRLLLATMVAACALSLPKHAPSSWNVFGTSHVAVTSMR* |
| Ga0066688_109805642 | 3300005178 | Soil | MRRSIFLEDAIMWTRRVLLATMVAACAMSLPRHVPASWNVGFGGTTNVAITSMR* |
| Ga0066678_102117962 | 3300005181 | Soil | DAIMWTRRVLLATMVAACAMSLPRHVPASWNVGFGGTTNVAITSMR* |
| Ga0065712_101181503 | 3300005290 | Miscanthus Rhizosphere | MWTRRVLLATMVAACAMSLPRHVPASWGAGLGTTQVAVTSLR* |
| Ga0070658_100193185 | 3300005327 | Corn Rhizosphere | MWTRRVLLATLVAAAAMSLPRHVPASWGGAGLGLAASEISALR* |
| Ga0070658_100339273 | 3300005327 | Corn Rhizosphere | MWTRRLLLATMVAAAAMSLPRHVPASWNVGLDNTNVAISSLR* |
| Ga0070658_100706985 | 3300005327 | Corn Rhizosphere | MWTRRVLLATLVAAAAMSLPRHVPASFGSGLGLASSGEVSALR* |
| Ga0070658_101938091 | 3300005327 | Corn Rhizosphere | MWTRRLLLATLVAAAAMSLPRHVPASWGGATNLGLAASEIGSLR* |
| Ga0070658_103203683 | 3300005327 | Corn Rhizosphere | MWTRRVLLATMVAAAAMSLPRHVPASWNVSLGDPNVNVSSLR* |
| Ga0070658_115658381 | 3300005327 | Corn Rhizosphere | MWTRRLLLATLVAAAAMSLPRHVPASWGGGLGLASSGSIELGALR* |
| Ga0070683_1012543112 | 3300005329 | Corn Rhizosphere | MWTRRVLLATMVAACAMSLPRHVPASWNVGMGTTQVAVSSLR* |
| Ga0070690_1002420163 | 3300005330 | Switchgrass Rhizosphere | MWTRRVLLATMVAACAMSLPRHVPASWGSGPGTTQVAVSSLR* |
| Ga0070690_1002706661 | 3300005330 | Switchgrass Rhizosphere | MWARRLLLLTMVAAAAMSLPRHVPASWNVGFGSSQVASNSIR* |
| Ga0070690_1005903931 | 3300005330 | Switchgrass Rhizosphere | EEMTEMWARRLLLLTMVAAAAMTLPRHVPASWNVGFTSSQVASNSVR* |
| Ga0070682_1004552062 | 3300005337 | Corn Rhizosphere | MWARRLLLLTMVAAAAMSLPRHVPASWNVGFNSSQVASNSVR* |
| Ga0070660_1016316811 | 3300005339 | Corn Rhizosphere | WTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAVSSLR* |
| Ga0070692_104986082 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRVLLATMVAACALSLPKHAPSSWNVFGTSQIAVSSLR* |
| Ga0070671_1009407901 | 3300005355 | Switchgrass Rhizosphere | MWTRRVLLATMVAACAMTIPRHVPASWNVALPGATAMVATSMR* |
| Ga0070674_1002017073 | 3300005356 | Miscanthus Rhizosphere | MWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAITSLR* |
| Ga0070713_1022995732 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRVLLATLVAAAAMSLPRHVPASFGSGPGLASSSEMSALR* |
| Ga0070700_1019301461 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAISSLR* |
| Ga0070694_1002257861 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRLLLATMVAACALSLPKHAPSSWNVFGTSQIAVSSLR* |
| Ga0070708_1007855321 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRVLLATMVAACAMTLPRHVPASWNVSLGGATNVAVGSLR* |
| Ga0070708_1008222542 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRLLLVTMVAACALSLPRHAPSSWNVFGTSQVAVTSLR* |
| Ga0068867_1000436784 | 3300005459 | Miscanthus Rhizosphere | MEETIMWTRRLLLATMVAAAAMSLPRHVPASWNVGFGNSQVAASTLR* |
| Ga0070698_1006014061 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRVLLATMVAACAMSLPRHVPASWNVGIGSANVAVSSIR* |
| Ga0070699_1007704043 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRLLLATMVAACALSLPKHAPSSWNLFGTSQVAVTSMR* |
| Ga0070697_1014701121 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRLLLVTMVAACALSLPRHAPSSWNIFGTSQVAVTSLR* |
| Ga0070730_100955763 | 3300005537 | Surface Soil | MWTRRLLLATMVAACALSLPKHAPSSLNLFGTTQVAVTSLR* |
| Ga0070730_109113431 | 3300005537 | Surface Soil | KRIEEATMWTRRLLLATLVAAAAMSLPRHLPASWSSGMGSSPVTLTSLR* |
| Ga0068853_1008387102 | 3300005539 | Corn Rhizosphere | MWARRLLLLTMVAAAAMTLPRHVPASWNVGFTSSQVASNSVR* |
| Ga0070686_1005479972 | 3300005544 | Switchgrass Rhizosphere | MWARRLLLLTIVAAAAMSLPRHVPASWNVGFNSSQVASNSVR* |
| Ga0070693_1008274231 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRVLLATMVAAAAMSLPRHVPASWNVSLGDTGISSSSLR* |
| Ga0068855_1001896441 | 3300005563 | Corn Rhizosphere | MWTRRVLLATLVAAAAMSLPRHVPASWGSGLGLASSEVSALR* |
| Ga0068859_1009278613 | 3300005617 | Switchgrass Rhizosphere | HVDETVLLATMVAACAMSLPRHVPASWGAGLGTTQVAVTSLR* |
| Ga0068851_100213915 | 3300005834 | Corn Rhizosphere | VLLATIVAAAAMSLPRHVPASWNSGLGASDLTISALR* |
| Ga0068851_106434912 | 3300005834 | Corn Rhizosphere | VLLATMVAACAMSLPRHVPASWGAGLGTTQVAVTSLR* |
| Ga0068858_1011873932 | 3300005842 | Switchgrass Rhizosphere | MWTRRVLLATIVAACAMSLPRHAPSSWGAGLGTTQVAVSSLR* |
| Ga0075282_10295521 | 3300005896 | Rice Paddy Soil | FMWTRRVLLATLVAAAAMSLPRHVPASWGAAFGAPNVTVGSLR* |
| Ga0075432_100765992 | 3300006058 | Populus Rhizosphere | MWTRRVLLATMVAACAMSLPRHVSSSWNVGLGTTQVAVSSLR* |
| Ga0075432_105586461 | 3300006058 | Populus Rhizosphere | MWTRRVLLATMVAACAMSLPRHVPASWGSGLGTTQVATSSLR* |
| Ga0070716_1002802522 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLATIVAAAAMSLPRHVPASWNSGLGASNLTISALR* |
| Ga0075367_104398282 | 3300006178 | Populus Endosphere | MWTRRVLLATMVAAAAMSLPRHVPASWNVGVSASTVAANSIR* |
| Ga0097621_1000560752 | 3300006237 | Miscanthus Rhizosphere | MWTRRVLLATIVAAAAMSLPRHVPASWNSGLGASDLTISALR* |
| Ga0097621_1017252662 | 3300006237 | Miscanthus Rhizosphere | WARRLLLLTMVAAAAMSLPRHVPASWNVGFNSSQVASNSVR* |
| Ga0068871_1023669242 | 3300006358 | Miscanthus Rhizosphere | KLDPGNEEADMWTRRLLLATMVAACALSLPKHAPSSWNVFGTSQIAVSSLR* |
| Ga0075522_100304133 | 3300006638 | Arctic Peat Soil | MWTRRVLLATIVAAAAMSLPRHIPASWNAGASSSDVAVVSLR* |
| Ga0079221_118140372 | 3300006804 | Agricultural Soil | MWARRLLLLTMVAAAAMSLPRHVPASWNVGFNSSQVASN |
| Ga0079220_115730192 | 3300006806 | Agricultural Soil | LLTMVAAAAMSLPRHVPASWNVGFNSSQVASNSVR* |
| Ga0075425_1002609522 | 3300006854 | Populus Rhizosphere | MWTRRVLLATMVAAAAMSLPKHVPAQWNVGLGNTNVAVSSIR* |
| Ga0075426_112028801 | 3300006903 | Populus Rhizosphere | EEANMWTRRLLLATMVAACALSLPKHAPSSWNLFGTSQVAVTSMR* |
| Ga0079219_101152672 | 3300006954 | Agricultural Soil | MWTRRLLLATIVAACAMSLPRHAPQGWGHGFGMTQVAAQSLR* |
| Ga0079219_107014001 | 3300006954 | Agricultural Soil | MWARRLLLLTIVAAAAMSLPRHVPASWNVGFGSSQVASNSIR* |
| Ga0079218_103105562 | 3300007004 | Agricultural Soil | MWTRRVLLATMVAAAAMSLPRHVPASWNAGFSAATNVAMNTSFR* |
| Ga0105106_108177981 | 3300009078 | Freshwater Sediment | MWTRRLLLATMIAAAAMSLPRHVPASWNAGLAAQGVSISALR* |
| Ga0105245_104463612 | 3300009098 | Miscanthus Rhizosphere | MTEMWARRLLLLTMVAAAAMTLPRHVPASWNVGFTSSQVASNSVR* |
| Ga0105245_130820552 | 3300009098 | Miscanthus Rhizosphere | WARRLLLLTMVAAAAMSLPRHVPASWNVGFGSSEVASNSIR* |
| Ga0105242_106232372 | 3300009176 | Miscanthus Rhizosphere | MWTRRVLLATMVAVCAMSLPRHVPASWGAGLGTTQVAVTSLR* |
| Ga0105242_125686682 | 3300009176 | Miscanthus Rhizosphere | LGVPIMWARRLLLLTMVAAAAMSLPRHVPASWNVGFGSSQVASNSIR* |
| Ga0105248_109615981 | 3300009177 | Switchgrass Rhizosphere | RKGGENMWTRRVLLATMVAACAMSLPRHVPASWGSGPGTTQVAVSSLR* |
| Ga0105238_117118512 | 3300009551 | Corn Rhizosphere | MWTRRLLLATLVAAAAMSLPRHVPASFGGLGLATAEIGTLR* |
| Ga0126318_101677481 | 3300010152 | Soil | NMWTRRVLLATLVAAAAMSLPRHVPASWGGGLGLASSEMSALR* |
| Ga0126318_108958734 | 3300010152 | Soil | MWTRRVLLATLVAAAAMSLPRHVPASFGSGLGLASSSEVSALR* |
| Ga0134124_101111112 | 3300010397 | Terrestrial Soil | MWTRRLLLATMVAACALSLPKHAPSSWIVFGTSQIAVSSLR* |
| Ga0134123_124201102 | 3300010403 | Terrestrial Soil | MWTRRLLLATMVAACALSLPKHTPSSWNVLGTSNVAVT |
| Ga0150985_1000356482 | 3300012212 | Avena Fatua Rhizosphere | MWTRRVLLATLVAAAAMSLPRHVPASWGGGLGLAASDMGEVSALR* |
| Ga0150985_1007127341 | 3300012212 | Avena Fatua Rhizosphere | MWTRRLLLATMVAAAAMSLPRHVPASWNVGLGTTQGAISSLR* |
| Ga0150985_1020282391 | 3300012212 | Avena Fatua Rhizosphere | MWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTNVAVSSLR* |
| Ga0150985_1066425452 | 3300012212 | Avena Fatua Rhizosphere | RRVLLATLVAAAAMSLPRHVPASWGGIGLASSEMSALR* |
| Ga0150985_1067691471 | 3300012212 | Avena Fatua Rhizosphere | LEATETIEEANMWTRRLLLATMVAAAAMSLPRHVPAAWNVSLLDASVNTSSLR* |
| Ga0150985_1071405151 | 3300012212 | Avena Fatua Rhizosphere | MWTRRLLLATMVAACALSLPKHAPSNWNAFGTSQIAVSSLR* |
| Ga0150985_1172042881 | 3300012212 | Avena Fatua Rhizosphere | MWTRRVLLATLVAAAAMSLPRHVPASWGGIGLASSEMSALR* |
| Ga0150985_1182679872 | 3300012212 | Avena Fatua Rhizosphere | MWTRRVLLATMVAAAAMSLPRHVPASWNVTLGGPNVNVSSLR* |
| Ga0150985_1195568663 | 3300012212 | Avena Fatua Rhizosphere | MEVTELAFEEADMWTRRLLLATMIAAAAMSLPRHVPASWNVSLGGPNINVSSLR* |
| Ga0150985_1210016482 | 3300012212 | Avena Fatua Rhizosphere | MWTRRVLLATMVAAAAMSLPRHVPASWNVSLGDSNVNVSSLR* |
| Ga0150985_1222335932 | 3300012212 | Avena Fatua Rhizosphere | MWTRRVLLATMVAACAMSLPRHVPASWNVGIGTTQVAVSSLR* |
| Ga0150984_1019993502 | 3300012469 | Avena Fatua Rhizosphere | MWTRRVLLATLVAAAAMSLPRHVPASWGGIGLASSEISALR* |
| Ga0150984_1080712702 | 3300012469 | Avena Fatua Rhizosphere | MLLVTMVAAAAMTLPKHVPASWNVGMGNSNVAISSLR* |
| Ga0150984_1102637763 | 3300012469 | Avena Fatua Rhizosphere | MWARRLLLLTIVAAAAMSLPRHVPASWNVGFGSSQ |
| Ga0150984_1179928132 | 3300012469 | Avena Fatua Rhizosphere | MWTRRLLLATLVAAAAMSLPRHVPASFGGGLGLAASQMSALR* |
| Ga0150984_1183277352 | 3300012469 | Avena Fatua Rhizosphere | MWTRRLLLATMVAAAAMSLPRHVPASWNVSLGDTGVNSSSFR* |
| Ga0150984_1230636873 | 3300012469 | Avena Fatua Rhizosphere | MWTRRLLLATMVAAAAMSLPRHVPASWNVGLDNTNLAISSLR* |
| Ga0164299_114359322 | 3300012958 | Soil | MWTRRVLLATMVAACAMSLPRHVPASWGAGLGTTQ |
| Ga0157371_101849751 | 3300013102 | Corn Rhizosphere | LVARVTEPEETTMWTRRVLLATLVAAAAMSLPRHVPASFGSGLGLASSGEVSALR* |
| Ga0163162_102091041 | 3300013306 | Switchgrass Rhizosphere | RRRTMWTRRVLLATIVAACAMSLPRHAPSSWGAGLGTTQVAVSSLR* |
| Ga0167657_100031412 | 3300015079 | Glacier Forefield Soil | MWTRRVLLATMVAACAMSLPRHVPASWNVSNGTTSVVSQTLR* |
| Ga0167648_10039966 | 3300015171 | Glacier Forefield Soil | MPNLEEAIMWTRRVLLATVVAACAMSLPRHVPASWQSGSGNASVAISSVR* |
| Ga0137409_103150902 | 3300015245 | Vadose Zone Soil | MIMWTRRLLLATMVAACAMSLPRHVPASWNVGPGASSGASNIAISSLR* |
| Ga0132258_103171063 | 3300015371 | Arabidopsis Rhizosphere | MWTRRLLLATMVAACAMSLPKHAPQGWNAGFGTTQVAVQSLR* |
| Ga0132258_112275602 | 3300015371 | Arabidopsis Rhizosphere | MWTRRVLLATMVAAAAMSLPRHVPASWNVGVSSSTVASNSIR* |
| Ga0132257_1002054343 | 3300015373 | Arabidopsis Rhizosphere | LEEAIMWTRRVLLATMVAAAAMSLPRHVPASWNVGMGTSNIAVSSLR* |
| Ga0132257_1044981992 | 3300015373 | Arabidopsis Rhizosphere | MWTRRVLLATMVAACAMSLPRHVPASWGGFGTTQVAVSSFR* |
| Ga0163161_116968761 | 3300017792 | Switchgrass Rhizosphere | MWTRRLLLATMVAACALSLPKHAPSSWNVFGTSQIAVSSLR |
| Ga0187824_100358943 | 3300017927 | Freshwater Sediment | MWTRRVLLATLVAAAAMSLPRHVPASWGAAFGAPNVTVGSLR |
| Ga0187773_101949512 | 3300018064 | Tropical Peatland | MWTRRLLLATLVAAAAMSLPRHLPASWGSGMGSAPVTLSALR |
| Ga0190269_115071431 | 3300018465 | Soil | VLLATMVAAAAMSLPRHVPASFSAGFGPSNVAISSLR |
| Ga0197907_106248602 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRVLLATLVAAAAMSLPRHLPASWGSSSGAPMVTVGSLR |
| Ga0206356_118660232 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRVLLATLVAAAAMSLPRHVPASFGSGLGLASSGEVSALR |
| Ga0206354_107796282 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRLLLATLVAAAAMSLPRHVPASFGGLGLATAEIGTLR |
| Ga0206353_106753763 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRVLLATLVAAAAMSLPRHVPASFGSGLGLASSG |
| Ga0179584_11896322 | 3300021151 | Vadose Zone Soil | VTCLEVAIMWARRVLLATMVAVCAMSLPRHVPASWNAGGANANVAISSGR |
| Ga0213877_101348951 | 3300021372 | Bulk Soil | MWTRRVLLATMVAACAMSLPRHVPASFGAMTGNTQVAVQSLR |
| Ga0213876_103641412 | 3300021384 | Plant Roots | MWTRRVLLATMVAACAMSLPRHVPASWNAGFGTTQVAVTSFR |
| Ga0182009_103120341 | 3300021445 | Soil | MWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAISSLR |
| Ga0213880_101649541 | 3300021953 | Exposed Rock | MWTRRVLLATMVAACAMSLPRHVPSAWGTGLGTTQVAVNGL |
| Ga0247677_10004793 | 3300024245 | Soil | MWTRRVLLATIVAAAAMSLPRHVPASWNSGMGASDLTISALR |
| Ga0209483_11033972 | 3300025862 | Arctic Peat Soil | MWTRRVLLATIVAAAAMSLPRHIPASWNAGASSSDVAVVSLR |
| Ga0207705_100343155 | 3300025909 | Corn Rhizosphere | MWTRRVLLATLVAAAAMSLPRHVPASWGGAGLGLAASEISALR |
| Ga0207705_101694061 | 3300025909 | Corn Rhizosphere | MWTRRLLLATLVAAAAMSLPRHVPASWGGATNLGLAASEIGSLR |
| Ga0207705_102448043 | 3300025909 | Corn Rhizosphere | MWTRRVLLATMVAAAAMSLPRHVPASWNVSLGDPNVNVSSLR |
| Ga0207705_107328411 | 3300025909 | Corn Rhizosphere | GSNETRSEEATMWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAISSLR |
| Ga0207705_115314101 | 3300025909 | Corn Rhizosphere | MWTRRLLLATLVAAAAMSLPRHVPASWGGGLGLASSGSIELGALR |
| Ga0207654_104045372 | 3300025911 | Corn Rhizosphere | MWARRLLLLTMVAAAAMSLPRHVPASWNVGFNSSQVASNSVR |
| Ga0207695_101552173 | 3300025913 | Corn Rhizosphere | LLATLVAAAAMSLPRHVPASFGSGLGLASSGEVSALR |
| Ga0207662_101470453 | 3300025918 | Switchgrass Rhizosphere | MWTRRVLLATMVAACAMSLPRHVPASWGSGPGTTQVAVSSLR |
| Ga0207681_105472642 | 3300025923 | Switchgrass Rhizosphere | MWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAVSSLR |
| Ga0207694_114195931 | 3300025924 | Corn Rhizosphere | MTEMWARRLLLLTMVAAAAMTLPRHVPASWNVGFTSSQVASNSVR |
| Ga0207700_104488812 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTRRVLLATLVAAAAMSLPRHVPASFGSGPGLASSSEMSALR |
| Ga0207661_105318102 | 3300025944 | Corn Rhizosphere | MWTRRVLLATMVAACAMSLPRHVPASWNVGMGTTQVAVSSLR |
| Ga0207679_112339842 | 3300025945 | Corn Rhizosphere | LKEAIMWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAVSSLR |
| Ga0207651_106461032 | 3300025960 | Switchgrass Rhizosphere | NETRLEEAIMWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAVSSLR |
| Ga0207648_100672973 | 3300026089 | Miscanthus Rhizosphere | MEETIMWTRRLLLATMVAAAAMSLPRHVPASWNVGFVNSQVAASSLR |
| Ga0207675_1014250651 | 3300026118 | Switchgrass Rhizosphere | LATIVAAAAMSLPRHVPASWSAGLGVASSSVAMSALR |
| Ga0207698_102247083 | 3300026142 | Corn Rhizosphere | MWTRRVLLATMVAACAMSLPRHVPASWNVGMGTTQVA |
| Ga0209131_100182415 | 3300026320 | Grasslands Soil | MWTRRVLLATMVAACAMSLPRHVPASWGAGLGTTQVAISSPR |
| Ga0209267_12841582 | 3300026331 | Soil | MRRSIFLEDAIMWTRRVLLATMVAACAMSLPRHVPASWNVGFGGTTNVAITSMR |
| Ga0209798_101842412 | 3300027843 | Wetland Sediment | MWTRRLLLATMVAAAAMSLPRHVPASWSAALGAPGTTVALSSLR |
| Ga0209166_104950131 | 3300027857 | Surface Soil | MWTRRLLLATMVAACALSLPKHAPSSLNLFGTTQVAVTSLR |
| Ga0207428_103739332 | 3300027907 | Populus Rhizosphere | MWTRRVLLATMVAACAMSLPRHVSSSWNVGLGTTQVAVSSLR |
| Ga0268266_116156592 | 3300028379 | Switchgrass Rhizosphere | MWARRLLLLTMVAAAAMSLPRHVPASWNVGFGSSQVASNSIR |
| Ga0307504_100129062 | 3300028792 | Soil | MWARRVLLATVVAACAMSLPRHVPASWNAGLGAGNVAISSLR |
| Ga0308189_103381092 | 3300031058 | Soil | MWTRRVLLATMVAACAMSLPRHVSSSWNVGLGTTQVSVSSLR |
| Ga0308201_100785301 | 3300031091 | Soil | MWTRRLLLATMVAAAAMSLPRHVPASWNVGLDNANVAISSFR |
| Ga0307408_1004129441 | 3300031548 | Rhizosphere | VLLATMVAAAAMSLPRHVPASWNVGFGSTNVAVSSFR |
| Ga0307468_1005673592 | 3300031740 | Hardwood Forest Soil | MWTRRVLLATMVAACAMTLPRHVPASWNVSLGGATNVAVGSLR |
| Ga0308175_1005533671 | 3300031938 | Soil | MWTRRVLLATMVAAAAMSLPRHVPASWNVSLGDSNVNVSSLR |
| Ga0308175_1032895971 | 3300031938 | Soil | NEPEETNMWTRRVLLATLVAAAAMSLPRHVPASWGGSGLASSSEISALR |
| Ga0307470_104695242 | 3300032174 | Hardwood Forest Soil | MWTRRVLLATMVAACAMSLPRHVPASWGSGLGTTQVAISSMR |
| Ga0335080_124186202 | 3300032828 | Soil | FEEASMWTRRVLLATMVAACAMSLPRHVPASWGSATGTTQVAVQSLH |
| Ga0335070_105920941 | 3300032829 | Soil | MWTRRVLLATLVAAAAMSLPRHVPASWGAAFGATHVTVGSLR |
| Ga0214472_103336371 | 3300033407 | Soil | TRRLLLATMVAAAAMSLPRHVPASWNAGLAAQGVSISALR |
| Ga0372943_0813800_512_619 | 3300034268 | Soil | LATLVAAAAMSLPRHVPASWGGGGFASNAEIASLR |
| ⦗Top⦘ |