Metagenome / Metatranscriptome Family F043568

Overview

Basic Information

• Family ID: F043568
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 156
• Average Sequence Length: 43 residues
• Representative Sequence: MWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAVSSLR
• Number of Associated Samples: 116
• Number of Associated Scaffolds: 156

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 78.29 %
• % of genes near scaffold ends (potentially truncated): 18.59 %
• % of genes from short scaffolds (< 2000 bps): 70.51 %
• Associated GOLD sequencing projects: 104
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (73.077 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (8.333 % of family members)
• Environment Ontology (ENVO): Unclassified (37.179 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (64.744 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: Yes
• Secondary Structure distribution:
  α-helix: 42.86%
  β-sheet: 0.00%
  Coil/Unstructured: 57.14%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 156 Family Scaffolds
PF12779	WXXGXW	26.28
PF01557	FAA_hydrolase	8.33
PF00005	ABC_tran	7.69
PF00202	Aminotran_3	2.56
PF12848	ABC_tran_Xtn	1.92
PF03401	TctC	1.28
PF00106	adh_short	1.28
PF08521	2CSK_N	0.64
PF03631	Virul_fac_BrkB	0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 156 Family Scaffolds
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	1.28
COG0642	Signal transduction histidine kinase	Signal transduction mechanisms [T]	0.64
COG1295	Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)	Function unknown [S]	0.64

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	73.08 %
Unclassified	root	N/A	26.92 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	73.08 %
Unclassified	root	N/A	26.92 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	73.08 %
Unclassified	root	N/A	26.92 %

Level 4

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	42.31 %
Unclassified	root	N/A	26.92 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	25.64 %

Level 5

Name	Rank	Taxonomy	Distribution
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	42.31 %
Unclassified	root	N/A	26.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	8.97 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.64 %

Level 6

Name	Rank	Taxonomy	Distribution
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	42.31 %
Unclassified	root	N/A	26.92 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.77 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.64 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.64 %

Level 7

Name	Rank	Taxonomy	Distribution
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	42.31 %
Unclassified	root	N/A	26.92 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1.28 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.64 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.64 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2199352024|deeps_contig30078.19311	All Organisms → cellular organisms → Bacteria → Proteobacteria	1769
2199352024|deeps_contig69310.42111	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1713
3300000364|INPhiseqgaiiFebDRAFT_100540837	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1808
3300002906|JGI25614J43888_10032134	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1652
3300002907|JGI25613J43889_10008589	All Organisms → cellular organisms → Bacteria	2810
3300003315|P22013IDBA_10008534	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	5295
3300003319|soilL2_10064543	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1292
3300004114|Ga0062593_100074445	All Organisms → cellular organisms → Bacteria	2265
3300004156|Ga0062589_101448106	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	672
3300004463|Ga0063356_101618448	All Organisms → cellular organisms → Bacteria → Proteobacteria	965
3300004463|Ga0063356_102329679	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	817
3300004778|Ga0062383_10216065	All Organisms → cellular organisms → Bacteria → Proteobacteria	891
3300005171|Ga0066677_10205541	Not Available	1104
3300005175|Ga0066673_10045966	Not Available	2180
3300005178|Ga0066688_10980564	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	516
3300005181|Ga0066678_10211796	All Organisms → cellular organisms → Bacteria → Proteobacteria	1241
3300005290|Ga0065712_10118150	Not Available	1710
3300005327|Ga0070658_10033927	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4107
3300005327|Ga0070658_10320368	All Organisms → cellular organisms → Bacteria → Proteobacteria	1324
3300005329|Ga0070683_101254311	All Organisms → cellular organisms → Bacteria → Proteobacteria	712
3300005330|Ga0070690_100242016	Not Available	1273
3300005330|Ga0070690_100270666	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1208
3300005330|Ga0070690_100590393	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	842
3300005337|Ga0070682_100455206	All Organisms → cellular organisms → Bacteria	981
3300005339|Ga0070660_101631681	All Organisms → cellular organisms → Bacteria → Proteobacteria	549
3300005345|Ga0070692_10498608	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	788
3300005355|Ga0070671_100940790	All Organisms → cellular organisms → Bacteria → Proteobacteria	756
3300005356|Ga0070674_100201707	All Organisms → cellular organisms → Bacteria	1536
3300005441|Ga0070700_101930146	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	511
3300005444|Ga0070694_100225786	Not Available	1407
3300005445|Ga0070708_100785532	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	895
3300005445|Ga0070708_100822254	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	873
3300005459|Ga0068867_100043678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	3281
3300005471|Ga0070698_100601406	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1040
3300005518|Ga0070699_100770404	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	880
3300005536|Ga0070697_101470112	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	609
3300005537|Ga0070730_10095576	All Organisms → cellular organisms → Bacteria	2062
3300005537|Ga0070730_10911343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	550
3300005539|Ga0068853_100838710	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	881
3300005544|Ga0070686_100547997	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	904
3300005547|Ga0070693_100827423	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	688
3300005617|Ga0068859_100927861	Not Available	955
3300005834|Ga0068851_10021391	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3140
3300005834|Ga0068851_10643491	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	648
3300005842|Ga0068858_101187393	Not Available	750
3300005896|Ga0075282_1029552	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	735
3300006058|Ga0075432_10076599	All Organisms → cellular organisms → Bacteria → Proteobacteria	1208
3300006058|Ga0075432_10558646	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	518
3300006173|Ga0070716_100280252	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1150
3300006178|Ga0075367_10439828	All Organisms → cellular organisms → Bacteria	826
3300006237|Ga0097621_100056075	All Organisms → cellular organisms → Bacteria → Proteobacteria	3218
3300006237|Ga0097621_101725266	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	596
3300006358|Ga0068871_102366924	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	506
3300006638|Ga0075522_10030413	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3286
3300006804|Ga0079221_11814037	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	500
3300006806|Ga0079220_11573019	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	568
3300006854|Ga0075425_100260952	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1993
3300006903|Ga0075426_11202880	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	575
3300006954|Ga0079219_10115267	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1355
3300006954|Ga0079219_10701400	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	770
3300007004|Ga0079218_10310556	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1287
3300009078|Ga0105106_10817798	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	664
3300009098|Ga0105245_10446361	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1301
3300009098|Ga0105245_13082055	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	516
3300009176|Ga0105242_10623237	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1045
3300009176|Ga0105242_12568668	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	558
3300009177|Ga0105248_10961598	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	964
3300010397|Ga0134124_10111111	Not Available	2398
3300010403|Ga0134123_12420110	Not Available	590
3300012212|Ga0150985_100712734	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1239
3300012212|Ga0150985_102028239	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1142
3300012212|Ga0150985_106769147	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	755
3300012212|Ga0150985_107140515	Not Available	506
3300012212|Ga0150985_118267987	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	937
3300012212|Ga0150985_119556866	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1316
3300012212|Ga0150985_121001648	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	761
3300012212|Ga0150985_122233593	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	509
3300012469|Ga0150984_108071270	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	825
3300012469|Ga0150984_110263776	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	897
3300012469|Ga0150984_118327735	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	918
3300012469|Ga0150984_123063687	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1308
3300012958|Ga0164299_11435932	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	535
3300013306|Ga0163162_10209104	Not Available	2081
3300015079|Ga0167657_1000314	All Organisms → cellular organisms → Bacteria → Proteobacteria	13483
3300015171|Ga0167648_1003996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3789
3300015245|Ga0137409_10315090	All Organisms → cellular organisms → Bacteria → Proteobacteria	1372
3300015371|Ga0132258_10317106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3841
3300015371|Ga0132258_11227560	All Organisms → cellular organisms → Bacteria	1895
3300015373|Ga0132257_100205434	Not Available	2336
3300015373|Ga0132257_104498199	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	507
3300017792|Ga0163161_11696876	Not Available	559
3300017927|Ga0187824_10035894	All Organisms → cellular organisms → Bacteria → Proteobacteria	1502
3300018064|Ga0187773_10194951	All Organisms → cellular organisms → Bacteria → Proteobacteria	1074
3300018465|Ga0190269_11507143	All Organisms → cellular organisms → Bacteria → Proteobacteria	554
3300020069|Ga0197907_10624860	Not Available	725
3300021151|Ga0179584_1189632	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	676
3300021372|Ga0213877_10134895	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	772
3300021384|Ga0213876_10364141	All Organisms → cellular organisms → Bacteria → Proteobacteria	769
3300021445|Ga0182009_10312034	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	795
3300021953|Ga0213880_10164954	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	610
3300024245|Ga0247677_1000479	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4251
3300025862|Ga0209483_1103397	All Organisms → cellular organisms → Bacteria → Proteobacteria	1241
3300025909|Ga0207705_10244804	All Organisms → cellular organisms → Bacteria → Proteobacteria	1366
3300025909|Ga0207705_10732841	All Organisms → cellular organisms → Bacteria → Proteobacteria	768
3300025911|Ga0207654_10404537	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	950
3300025918|Ga0207662_10147045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1496
3300025923|Ga0207681_10547264	All Organisms → cellular organisms → Bacteria → Proteobacteria	952
3300025924|Ga0207694_11419593	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	586
3300025944|Ga0207661_10531810	All Organisms → cellular organisms → Bacteria → Proteobacteria	1076
3300025945|Ga0207679_11233984	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	686
3300025960|Ga0207651_10646103	All Organisms → cellular organisms → Bacteria → Proteobacteria	928
3300026089|Ga0207648_10067297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3123
3300026142|Ga0207698_10224708	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1700
3300026320|Ga0209131_1001824	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	14625
3300026331|Ga0209267_1284158	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	555
3300027843|Ga0209798_10184241	All Organisms → cellular organisms → Bacteria	1035
3300027857|Ga0209166_10495013	Not Available	628
3300027907|Ga0207428_10373933	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1046
3300028379|Ga0268266_11615659	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	624
3300028792|Ga0307504_10012906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1930
3300031058|Ga0308189_10338109	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	602
3300031091|Ga0308201_10078530	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	904
3300031548|Ga0307408_100412944	All Organisms → cellular organisms → Bacteria → Proteobacteria	1162
3300031740|Ga0307468_100567359	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	918
3300031938|Ga0308175_100553367	All Organisms → cellular organisms → Bacteria → Proteobacteria	1232
3300032174|Ga0307470_10469524	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	910
3300032828|Ga0335080_12418620	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	500
3300032829|Ga0335070_10592094	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1044
3300033407|Ga0214472_10333637	All Organisms → cellular organisms → Bacteria → Proteobacteria	1436

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	51.92%
Host-Associated	Host-Associated	48.08%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	48.08%
Plants	Host-Associated → Plants	48.08%
Aquatic	Environmental → Aquatic	3.85%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	47.44%
Rhizosphere	Host-Associated → Plants → Rhizosphere	25.64%
Rhizoplane	Host-Associated → Plants → Rhizoplane	19.23%
Freshwater	Environmental → Aquatic → Freshwater	3.85%
Roots	Host-Associated → Plants → Roots	3.21%
Rock-Dwelling (Subaerial Biofilms)	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms)	0.64%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	30.77%
Soil	Host-Associated → Plants → Rhizosphere → Soil	15.38%
Loam	Environmental → Terrestrial → Soil → Loam	14.10%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	10.26%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.26%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.97%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.56%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.92%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.92%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.28%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.64%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified	0.64%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.64%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.64%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	15.38%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	14.10%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	12.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	10.26%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.26%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.97%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.77%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.49%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.56%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.56%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.92%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.28%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.28%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.28%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.28%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.28%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.64%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.64%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.64%
Mine Drainage	Environmental → Terrestrial → Soil → Unclassified → Mine Drainage	0.64%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified	0.64%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.64%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.64%

Habitat

Habitat	Taxonomy	Distribution
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	8.33%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	7.69%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	7.05%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	3.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.21%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	3.21%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.21%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.21%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.21%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	2.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.56%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.92%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.92%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.92%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.92%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.92%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	1.28%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	1.28%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.28%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.28%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.28%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.28%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	1.28%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.28%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.28%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.28%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.28%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.28%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.28%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.28%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.28%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.28%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.64%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.64%
Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil	0.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.64%
Ore Pile And Mine Drainage Contaminated Soil	Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil	0.64%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.64%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.64%
Exposed Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock	0.64%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.64%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.64%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.64%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.64%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.64%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.64%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.64%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2199352024	Bare-fallow DEEP SOIL	Environmental
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300002906	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm	Environmental
3300002907	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm	Environmental
3300003315	Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P2 sample	Environmental
3300003319	Sugarcane bulk soil Sample L2	Environmental
3300003324	Sugarcane bulk soil Sample H2	Environmental
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated
3300004778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh	Environmental
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300005896	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204	Environmental
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated
3300006638	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A	Environmental
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated
3300010152	Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated
3300015079	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface)	Environmental
3300015171	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine)	Environmental
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300017927	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4	Environmental
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental
3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)	Environmental
3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)	Environmental
3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)	Environmental
3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)	Environmental
3300021151	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome)	Environmental
3300021372	Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01	Environmental
3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Host-Associated
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental
3300021953	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07	Environmental
3300024245	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18	Environmental
3300025862	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)	Environmental
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental
3300026331	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)	Environmental
3300027843	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)	Environmental
3300027857	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)	Environmental
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental
3300031091	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)	Environmental
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental
3300033407	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175	Environmental
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
deeps_03682210	2199352024	Soil	MWTRRVLLATMVAACAMTLPRHVPASWNAGNANTNVAISSLR
deeps_00451230	2199352024	Soil	MWTRRLLLATMVAAAAMSLPRHVPASWNVGLDNTNVAISSLR
INPhiseqgaiiFebDRAFT_1005408373	3300000364	Soil	MWTRRLLLATMVAACAMSLPRHVPDSSSSGLGTTQVAVSSLR*
JGI25614J43888_100321343	3300002906	Grasslands Soil	MWTRRLLLATLVAACAMSLPRHAPSTWNVGLGPTPVAVTSR*
JGI25613J43889_100085893	3300002907	Grasslands Soil	MWTRRVLLATMVAACAMSLPRHVPASWGAGLGTTQVAISSPR*
P22013IDBA_100085341	3300003315	Ore Pile And Mine Drainage Contaminated Soil	MWTRRLLLATMVAAAAMTLPRHVPASWNSGLAAQGVSLSALR*
soilL2_100645433	3300003319	Sugarcane Root And Bulk Soil	MWTRRLLLATMVAAAAMSLPRHVPASWSAGFGNSQIAVSSLR*
soilH2_100666093	3300003324	Sugarcane Root And Bulk Soil	MWTRRVLLATLVAAAAMSLPRHVPASWNSGLGLASSSEVSALR*
Ga0062593_1000744452	3300004114	Soil	MWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAVSSLR*
Ga0062589_1014481061	3300004156	Soil	VVQLPQEANMWTRRVLLATMIAAAAMSLPRHVPASWVSAEGVQAVAVSSFR*
Ga0063356_1016184482	3300004463	Arabidopsis Thaliana Rhizosphere	MWTRRLLLATMVAACAMSLPRHVPASWNVGLGTTQVAVSSLR*
Ga0063356_1023296792	3300004463	Arabidopsis Thaliana Rhizosphere	MWTRRVLLATMVAACAMSLPRHVSSSWNTGLGTTQVAVSSSR*
Ga0062383_102160652	3300004778	Wetland Sediment	MWTRRLLLATMVAAAAMSLPRHVPASWSAALGAPGTTVALSSLR*
Ga0066677_102055411	3300005171	Soil	MWTRRLLLATMVAACALSLPRHAPSSWNLFGTSQVAVTSLR*
Ga0066673_100459661	3300005175	Soil	MWTRRLLLATMVAACALSLPKHAPSSWNVFGTSHVAVTSMR*
Ga0066688_109805642	3300005178	Soil	MRRSIFLEDAIMWTRRVLLATMVAACAMSLPRHVPASWNVGFGGTTNVAITSMR*
Ga0066678_102117962	3300005181	Soil	DAIMWTRRVLLATMVAACAMSLPRHVPASWNVGFGGTTNVAITSMR*
Ga0065712_101181503	3300005290	Miscanthus Rhizosphere	MWTRRVLLATMVAACAMSLPRHVPASWGAGLGTTQVAVTSLR*
Ga0070658_100193185	3300005327	Corn Rhizosphere	MWTRRVLLATLVAAAAMSLPRHVPASWGGAGLGLAASEISALR*
Ga0070658_100339273	3300005327	Corn Rhizosphere	MWTRRLLLATMVAAAAMSLPRHVPASWNVGLDNTNVAISSLR*
Ga0070658_100706985	3300005327	Corn Rhizosphere	MWTRRVLLATLVAAAAMSLPRHVPASFGSGLGLASSGEVSALR*
Ga0070658_101938091	3300005327	Corn Rhizosphere	MWTRRLLLATLVAAAAMSLPRHVPASWGGATNLGLAASEIGSLR*
Ga0070658_103203683	3300005327	Corn Rhizosphere	MWTRRVLLATMVAAAAMSLPRHVPASWNVSLGDPNVNVSSLR*
Ga0070658_115658381	3300005327	Corn Rhizosphere	MWTRRLLLATLVAAAAMSLPRHVPASWGGGLGLASSGSIELGALR*
Ga0070683_1012543112	3300005329	Corn Rhizosphere	MWTRRVLLATMVAACAMSLPRHVPASWNVGMGTTQVAVSSLR*
Ga0070690_1002420163	3300005330	Switchgrass Rhizosphere	MWTRRVLLATMVAACAMSLPRHVPASWGSGPGTTQVAVSSLR*
Ga0070690_1002706661	3300005330	Switchgrass Rhizosphere	MWARRLLLLTMVAAAAMSLPRHVPASWNVGFGSSQVASNSIR*
Ga0070690_1005903931	3300005330	Switchgrass Rhizosphere	EEMTEMWARRLLLLTMVAAAAMTLPRHVPASWNVGFTSSQVASNSVR*
Ga0070682_1004552062	3300005337	Corn Rhizosphere	MWARRLLLLTMVAAAAMSLPRHVPASWNVGFNSSQVASNSVR*
Ga0070660_1016316811	3300005339	Corn Rhizosphere	WTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAVSSLR*
Ga0070692_104986082	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRVLLATMVAACALSLPKHAPSSWNVFGTSQIAVSSLR*
Ga0070671_1009407901	3300005355	Switchgrass Rhizosphere	MWTRRVLLATMVAACAMTIPRHVPASWNVALPGATAMVATSMR*
Ga0070674_1002017073	3300005356	Miscanthus Rhizosphere	MWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAITSLR*
Ga0070713_1022995732	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRVLLATLVAAAAMSLPRHVPASFGSGPGLASSSEMSALR*
Ga0070700_1019301461	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAISSLR*
Ga0070694_1002257861	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRLLLATMVAACALSLPKHAPSSWNVFGTSQIAVSSLR*
Ga0070708_1007855321	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRVLLATMVAACAMTLPRHVPASWNVSLGGATNVAVGSLR*
Ga0070708_1008222542	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRLLLVTMVAACALSLPRHAPSSWNVFGTSQVAVTSLR*
Ga0068867_1000436784	3300005459	Miscanthus Rhizosphere	MEETIMWTRRLLLATMVAAAAMSLPRHVPASWNVGFGNSQVAASTLR*
Ga0070698_1006014061	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRVLLATMVAACAMSLPRHVPASWNVGIGSANVAVSSIR*
Ga0070699_1007704043	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRLLLATMVAACALSLPKHAPSSWNLFGTSQVAVTSMR*
Ga0070697_1014701121	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRLLLVTMVAACALSLPRHAPSSWNIFGTSQVAVTSLR*
Ga0070730_100955763	3300005537	Surface Soil	MWTRRLLLATMVAACALSLPKHAPSSLNLFGTTQVAVTSLR*
Ga0070730_109113431	3300005537	Surface Soil	KRIEEATMWTRRLLLATLVAAAAMSLPRHLPASWSSGMGSSPVTLTSLR*
Ga0068853_1008387102	3300005539	Corn Rhizosphere	MWARRLLLLTMVAAAAMTLPRHVPASWNVGFTSSQVASNSVR*
Ga0070686_1005479972	3300005544	Switchgrass Rhizosphere	MWARRLLLLTIVAAAAMSLPRHVPASWNVGFNSSQVASNSVR*
Ga0070693_1008274231	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRVLLATMVAAAAMSLPRHVPASWNVSLGDTGISSSSLR*
Ga0068855_1001896441	3300005563	Corn Rhizosphere	MWTRRVLLATLVAAAAMSLPRHVPASWGSGLGLASSEVSALR*
Ga0068859_1009278613	3300005617	Switchgrass Rhizosphere	HVDETVLLATMVAACAMSLPRHVPASWGAGLGTTQVAVTSLR*
Ga0068851_100213915	3300005834	Corn Rhizosphere	VLLATIVAAAAMSLPRHVPASWNSGLGASDLTISALR*
Ga0068851_106434912	3300005834	Corn Rhizosphere	VLLATMVAACAMSLPRHVPASWGAGLGTTQVAVTSLR*
Ga0068858_1011873932	3300005842	Switchgrass Rhizosphere	MWTRRVLLATIVAACAMSLPRHAPSSWGAGLGTTQVAVSSLR*
Ga0075282_10295521	3300005896	Rice Paddy Soil	FMWTRRVLLATLVAAAAMSLPRHVPASWGAAFGAPNVTVGSLR*
Ga0075432_100765992	3300006058	Populus Rhizosphere	MWTRRVLLATMVAACAMSLPRHVSSSWNVGLGTTQVAVSSLR*
Ga0075432_105586461	3300006058	Populus Rhizosphere	MWTRRVLLATMVAACAMSLPRHVPASWGSGLGTTQVATSSLR*
Ga0070716_1002802522	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	VLLATIVAAAAMSLPRHVPASWNSGLGASNLTISALR*
Ga0075367_104398282	3300006178	Populus Endosphere	MWTRRVLLATMVAAAAMSLPRHVPASWNVGVSASTVAANSIR*
Ga0097621_1000560752	3300006237	Miscanthus Rhizosphere	MWTRRVLLATIVAAAAMSLPRHVPASWNSGLGASDLTISALR*
Ga0097621_1017252662	3300006237	Miscanthus Rhizosphere	WARRLLLLTMVAAAAMSLPRHVPASWNVGFNSSQVASNSVR*
Ga0068871_1023669242	3300006358	Miscanthus Rhizosphere	KLDPGNEEADMWTRRLLLATMVAACALSLPKHAPSSWNVFGTSQIAVSSLR*
Ga0075522_100304133	3300006638	Arctic Peat Soil	MWTRRVLLATIVAAAAMSLPRHIPASWNAGASSSDVAVVSLR*
Ga0079221_118140372	3300006804	Agricultural Soil	MWARRLLLLTMVAAAAMSLPRHVPASWNVGFNSSQVASN
Ga0079220_115730192	3300006806	Agricultural Soil	LLTMVAAAAMSLPRHVPASWNVGFNSSQVASNSVR*
Ga0075425_1002609522	3300006854	Populus Rhizosphere	MWTRRVLLATMVAAAAMSLPKHVPAQWNVGLGNTNVAVSSIR*
Ga0075426_112028801	3300006903	Populus Rhizosphere	EEANMWTRRLLLATMVAACALSLPKHAPSSWNLFGTSQVAVTSMR*
Ga0079219_101152672	3300006954	Agricultural Soil	MWTRRLLLATIVAACAMSLPRHAPQGWGHGFGMTQVAAQSLR*
Ga0079219_107014001	3300006954	Agricultural Soil	MWARRLLLLTIVAAAAMSLPRHVPASWNVGFGSSQVASNSIR*
Ga0079218_103105562	3300007004	Agricultural Soil	MWTRRVLLATMVAAAAMSLPRHVPASWNAGFSAATNVAMNTSFR*
Ga0105106_108177981	3300009078	Freshwater Sediment	MWTRRLLLATMIAAAAMSLPRHVPASWNAGLAAQGVSISALR*
Ga0105245_104463612	3300009098	Miscanthus Rhizosphere	MTEMWARRLLLLTMVAAAAMTLPRHVPASWNVGFTSSQVASNSVR*
Ga0105245_130820552	3300009098	Miscanthus Rhizosphere	WARRLLLLTMVAAAAMSLPRHVPASWNVGFGSSEVASNSIR*
Ga0105242_106232372	3300009176	Miscanthus Rhizosphere	MWTRRVLLATMVAVCAMSLPRHVPASWGAGLGTTQVAVTSLR*
Ga0105242_125686682	3300009176	Miscanthus Rhizosphere	LGVPIMWARRLLLLTMVAAAAMSLPRHVPASWNVGFGSSQVASNSIR*
Ga0105248_109615981	3300009177	Switchgrass Rhizosphere	RKGGENMWTRRVLLATMVAACAMSLPRHVPASWGSGPGTTQVAVSSLR*
Ga0105238_117118512	3300009551	Corn Rhizosphere	MWTRRLLLATLVAAAAMSLPRHVPASFGGLGLATAEIGTLR*
Ga0126318_101677481	3300010152	Soil	NMWTRRVLLATLVAAAAMSLPRHVPASWGGGLGLASSEMSALR*
Ga0126318_108958734	3300010152	Soil	MWTRRVLLATLVAAAAMSLPRHVPASFGSGLGLASSSEVSALR*
Ga0134124_101111112	3300010397	Terrestrial Soil	MWTRRLLLATMVAACALSLPKHAPSSWIVFGTSQIAVSSLR*
Ga0134123_124201102	3300010403	Terrestrial Soil	MWTRRLLLATMVAACALSLPKHTPSSWNVLGTSNVAVT
Ga0150985_1000356482	3300012212	Avena Fatua Rhizosphere	MWTRRVLLATLVAAAAMSLPRHVPASWGGGLGLAASDMGEVSALR*
Ga0150985_1007127341	3300012212	Avena Fatua Rhizosphere	MWTRRLLLATMVAAAAMSLPRHVPASWNVGLGTTQGAISSLR*
Ga0150985_1020282391	3300012212	Avena Fatua Rhizosphere	MWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTNVAVSSLR*
Ga0150985_1066425452	3300012212	Avena Fatua Rhizosphere	RRVLLATLVAAAAMSLPRHVPASWGGIGLASSEMSALR*
Ga0150985_1067691471	3300012212	Avena Fatua Rhizosphere	LEATETIEEANMWTRRLLLATMVAAAAMSLPRHVPAAWNVSLLDASVNTSSLR*
Ga0150985_1071405151	3300012212	Avena Fatua Rhizosphere	MWTRRLLLATMVAACALSLPKHAPSNWNAFGTSQIAVSSLR*
Ga0150985_1172042881	3300012212	Avena Fatua Rhizosphere	MWTRRVLLATLVAAAAMSLPRHVPASWGGIGLASSEMSALR*
Ga0150985_1182679872	3300012212	Avena Fatua Rhizosphere	MWTRRVLLATMVAAAAMSLPRHVPASWNVTLGGPNVNVSSLR*
Ga0150985_1195568663	3300012212	Avena Fatua Rhizosphere	MEVTELAFEEADMWTRRLLLATMIAAAAMSLPRHVPASWNVSLGGPNINVSSLR*
Ga0150985_1210016482	3300012212	Avena Fatua Rhizosphere	MWTRRVLLATMVAAAAMSLPRHVPASWNVSLGDSNVNVSSLR*
Ga0150985_1222335932	3300012212	Avena Fatua Rhizosphere	MWTRRVLLATMVAACAMSLPRHVPASWNVGIGTTQVAVSSLR*
Ga0150984_1019993502	3300012469	Avena Fatua Rhizosphere	MWTRRVLLATLVAAAAMSLPRHVPASWGGIGLASSEISALR*
Ga0150984_1080712702	3300012469	Avena Fatua Rhizosphere	MLLVTMVAAAAMTLPKHVPASWNVGMGNSNVAISSLR*
Ga0150984_1102637763	3300012469	Avena Fatua Rhizosphere	MWARRLLLLTIVAAAAMSLPRHVPASWNVGFGSSQ
Ga0150984_1179928132	3300012469	Avena Fatua Rhizosphere	MWTRRLLLATLVAAAAMSLPRHVPASFGGGLGLAASQMSALR*
Ga0150984_1183277352	3300012469	Avena Fatua Rhizosphere	MWTRRLLLATMVAAAAMSLPRHVPASWNVSLGDTGVNSSSFR*
Ga0150984_1230636873	3300012469	Avena Fatua Rhizosphere	MWTRRLLLATMVAAAAMSLPRHVPASWNVGLDNTNLAISSLR*
Ga0164299_114359322	3300012958	Soil	MWTRRVLLATMVAACAMSLPRHVPASWGAGLGTTQ
Ga0157371_101849751	3300013102	Corn Rhizosphere	LVARVTEPEETTMWTRRVLLATLVAAAAMSLPRHVPASFGSGLGLASSGEVSALR*
Ga0163162_102091041	3300013306	Switchgrass Rhizosphere	RRRTMWTRRVLLATIVAACAMSLPRHAPSSWGAGLGTTQVAVSSLR*
Ga0167657_100031412	3300015079	Glacier Forefield Soil	MWTRRVLLATMVAACAMSLPRHVPASWNVSNGTTSVVSQTLR*
Ga0167648_10039966	3300015171	Glacier Forefield Soil	MPNLEEAIMWTRRVLLATVVAACAMSLPRHVPASWQSGSGNASVAISSVR*
Ga0137409_103150902	3300015245	Vadose Zone Soil	MIMWTRRLLLATMVAACAMSLPRHVPASWNVGPGASSGASNIAISSLR*
Ga0132258_103171063	3300015371	Arabidopsis Rhizosphere	MWTRRLLLATMVAACAMSLPKHAPQGWNAGFGTTQVAVQSLR*
Ga0132258_112275602	3300015371	Arabidopsis Rhizosphere	MWTRRVLLATMVAAAAMSLPRHVPASWNVGVSSSTVASNSIR*
Ga0132257_1002054343	3300015373	Arabidopsis Rhizosphere	LEEAIMWTRRVLLATMVAAAAMSLPRHVPASWNVGMGTSNIAVSSLR*
Ga0132257_1044981992	3300015373	Arabidopsis Rhizosphere	MWTRRVLLATMVAACAMSLPRHVPASWGGFGTTQVAVSSFR*
Ga0163161_116968761	3300017792	Switchgrass Rhizosphere	MWTRRLLLATMVAACALSLPKHAPSSWNVFGTSQIAVSSLR
Ga0187824_100358943	3300017927	Freshwater Sediment	MWTRRVLLATLVAAAAMSLPRHVPASWGAAFGAPNVTVGSLR
Ga0187773_101949512	3300018064	Tropical Peatland	MWTRRLLLATLVAAAAMSLPRHLPASWGSGMGSAPVTLSALR
Ga0190269_115071431	3300018465	Soil	VLLATMVAAAAMSLPRHVPASFSAGFGPSNVAISSLR
Ga0197907_106248602	3300020069	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRVLLATLVAAAAMSLPRHLPASWGSSSGAPMVTVGSLR
Ga0206356_118660232	3300020070	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRVLLATLVAAAAMSLPRHVPASFGSGLGLASSGEVSALR
Ga0206354_107796282	3300020081	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRLLLATLVAAAAMSLPRHVPASFGGLGLATAEIGTLR
Ga0206353_106753763	3300020082	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRVLLATLVAAAAMSLPRHVPASFGSGLGLASSG
Ga0179584_11896322	3300021151	Vadose Zone Soil	VTCLEVAIMWARRVLLATMVAVCAMSLPRHVPASWNAGGANANVAISSGR
Ga0213877_101348951	3300021372	Bulk Soil	MWTRRVLLATMVAACAMSLPRHVPASFGAMTGNTQVAVQSLR
Ga0213876_103641412	3300021384	Plant Roots	MWTRRVLLATMVAACAMSLPRHVPASWNAGFGTTQVAVTSFR
Ga0182009_103120341	3300021445	Soil	MWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAISSLR
Ga0213880_101649541	3300021953	Exposed Rock	MWTRRVLLATMVAACAMSLPRHVPSAWGTGLGTTQVAVNGL
Ga0247677_10004793	3300024245	Soil	MWTRRVLLATIVAAAAMSLPRHVPASWNSGMGASDLTISALR
Ga0209483_11033972	3300025862	Arctic Peat Soil	MWTRRVLLATIVAAAAMSLPRHIPASWNAGASSSDVAVVSLR
Ga0207705_100343155	3300025909	Corn Rhizosphere	MWTRRVLLATLVAAAAMSLPRHVPASWGGAGLGLAASEISALR
Ga0207705_101694061	3300025909	Corn Rhizosphere	MWTRRLLLATLVAAAAMSLPRHVPASWGGATNLGLAASEIGSLR
Ga0207705_102448043	3300025909	Corn Rhizosphere	MWTRRVLLATMVAAAAMSLPRHVPASWNVSLGDPNVNVSSLR
Ga0207705_107328411	3300025909	Corn Rhizosphere	GSNETRSEEATMWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAISSLR
Ga0207705_115314101	3300025909	Corn Rhizosphere	MWTRRLLLATLVAAAAMSLPRHVPASWGGGLGLASSGSIELGALR
Ga0207654_104045372	3300025911	Corn Rhizosphere	MWARRLLLLTMVAAAAMSLPRHVPASWNVGFNSSQVASNSVR
Ga0207695_101552173	3300025913	Corn Rhizosphere	LLATLVAAAAMSLPRHVPASFGSGLGLASSGEVSALR
Ga0207662_101470453	3300025918	Switchgrass Rhizosphere	MWTRRVLLATMVAACAMSLPRHVPASWGSGPGTTQVAVSSLR
Ga0207681_105472642	3300025923	Switchgrass Rhizosphere	MWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAVSSLR
Ga0207694_114195931	3300025924	Corn Rhizosphere	MTEMWARRLLLLTMVAAAAMTLPRHVPASWNVGFTSSQVASNSVR
Ga0207700_104488812	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MWTRRVLLATLVAAAAMSLPRHVPASFGSGPGLASSSEMSALR
Ga0207661_105318102	3300025944	Corn Rhizosphere	MWTRRVLLATMVAACAMSLPRHVPASWNVGMGTTQVAVSSLR
Ga0207679_112339842	3300025945	Corn Rhizosphere	LKEAIMWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAVSSLR
Ga0207651_106461032	3300025960	Switchgrass Rhizosphere	NETRLEEAIMWTRRVLLATMVAACAMSLPRHVPASWNVGLGTTQVAVSSLR
Ga0207648_100672973	3300026089	Miscanthus Rhizosphere	MEETIMWTRRLLLATMVAAAAMSLPRHVPASWNVGFVNSQVAASSLR
Ga0207675_1014250651	3300026118	Switchgrass Rhizosphere	LATIVAAAAMSLPRHVPASWSAGLGVASSSVAMSALR
Ga0207698_102247083	3300026142	Corn Rhizosphere	MWTRRVLLATMVAACAMSLPRHVPASWNVGMGTTQVA
Ga0209131_100182415	3300026320	Grasslands Soil	MWTRRVLLATMVAACAMSLPRHVPASWGAGLGTTQVAISSPR
Ga0209267_12841582	3300026331	Soil	MRRSIFLEDAIMWTRRVLLATMVAACAMSLPRHVPASWNVGFGGTTNVAITSMR
Ga0209798_101842412	3300027843	Wetland Sediment	MWTRRLLLATMVAAAAMSLPRHVPASWSAALGAPGTTVALSSLR
Ga0209166_104950131	3300027857	Surface Soil	MWTRRLLLATMVAACALSLPKHAPSSLNLFGTTQVAVTSLR
Ga0207428_103739332	3300027907	Populus Rhizosphere	MWTRRVLLATMVAACAMSLPRHVSSSWNVGLGTTQVAVSSLR
Ga0268266_116156592	3300028379	Switchgrass Rhizosphere	MWARRLLLLTMVAAAAMSLPRHVPASWNVGFGSSQVASNSIR
Ga0307504_100129062	3300028792	Soil	MWARRVLLATVVAACAMSLPRHVPASWNAGLGAGNVAISSLR
Ga0308189_103381092	3300031058	Soil	MWTRRVLLATMVAACAMSLPRHVSSSWNVGLGTTQVSVSSLR
Ga0308201_100785301	3300031091	Soil	MWTRRLLLATMVAAAAMSLPRHVPASWNVGLDNANVAISSFR
Ga0307408_1004129441	3300031548	Rhizosphere	VLLATMVAAAAMSLPRHVPASWNVGFGSTNVAVSSFR
Ga0307468_1005673592	3300031740	Hardwood Forest Soil	MWTRRVLLATMVAACAMTLPRHVPASWNVSLGGATNVAVGSLR
Ga0308175_1005533671	3300031938	Soil	MWTRRVLLATMVAAAAMSLPRHVPASWNVSLGDSNVNVSSLR
Ga0308175_1032895971	3300031938	Soil	NEPEETNMWTRRVLLATLVAAAAMSLPRHVPASWGGSGLASSSEISALR
Ga0307470_104695242	3300032174	Hardwood Forest Soil	MWTRRVLLATMVAACAMSLPRHVPASWGSGLGTTQVAISSMR
Ga0335080_124186202	3300032828	Soil	FEEASMWTRRVLLATMVAACAMSLPRHVPASWGSATGTTQVAVQSLH
Ga0335070_105920941	3300032829	Soil	MWTRRVLLATLVAAAAMSLPRHVPASWGAAFGATHVTVGSLR
Ga0214472_103336371	3300033407	Soil	TRRLLLATMVAAAAMSLPRHVPASWNAGLAAQGVSISALR
Ga0372943_0813800_512_619	3300034268	Soil	LATLVAAAAMSLPRHVPASWGGGGFASNAEIASLR