Basic Information | |
---|---|
Family ID | F043555 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 156 |
Average Sequence Length | 37 residues |
Representative Sequence | ALTVLSFAVHVLFSPWLLVAIAILAWIKFRPRRSHR |
Number of Associated Samples | 127 |
Number of Associated Scaffolds | 156 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.71 % |
% of genes near scaffold ends (potentially truncated) | 78.21 % |
% of genes from short scaffolds (< 2000 bps) | 84.62 % |
Associated GOLD sequencing projects | 121 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (60.256 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.436 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.718 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.282 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.19% β-sheet: 0.00% Coil/Unstructured: 57.81% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 156 Family Scaffolds |
---|---|---|
PF04024 | PspC | 5.13 |
PF01904 | DUF72 | 2.56 |
PF01039 | Carboxyl_trans | 2.56 |
PF13191 | AAA_16 | 1.92 |
PF13474 | SnoaL_3 | 1.92 |
PF00903 | Glyoxalase | 1.92 |
PF00440 | TetR_N | 1.92 |
PF13160 | DUF3995 | 1.92 |
PF00406 | ADK | 1.28 |
PF13365 | Trypsin_2 | 1.28 |
PF00291 | PALP | 1.28 |
PF13649 | Methyltransf_25 | 1.28 |
PF05096 | Glu_cyclase_2 | 1.28 |
PF01565 | FAD_binding_4 | 1.28 |
PF07045 | DUF1330 | 1.28 |
PF00027 | cNMP_binding | 1.28 |
PF01243 | Putative_PNPOx | 1.28 |
PF06224 | HTH_42 | 1.28 |
PF00248 | Aldo_ket_red | 0.64 |
PF13460 | NAD_binding_10 | 0.64 |
PF01381 | HTH_3 | 0.64 |
PF06769 | YoeB_toxin | 0.64 |
PF04672 | Methyltransf_19 | 0.64 |
PF05638 | T6SS_HCP | 0.64 |
PF09286 | Pro-kuma_activ | 0.64 |
PF11139 | SfLAP | 0.64 |
PF00999 | Na_H_Exchanger | 0.64 |
PF01872 | RibD_C | 0.64 |
PF09594 | GT87 | 0.64 |
PF08241 | Methyltransf_11 | 0.64 |
PF02781 | G6PD_C | 0.64 |
PF02589 | LUD_dom | 0.64 |
PF01513 | NAD_kinase | 0.64 |
PF03466 | LysR_substrate | 0.64 |
PF05685 | Uma2 | 0.64 |
PF00561 | Abhydrolase_1 | 0.64 |
PF03364 | Polyketide_cyc | 0.64 |
PF00501 | AMP-binding | 0.64 |
PF06441 | EHN | 0.64 |
PF00196 | GerE | 0.64 |
PF00582 | Usp | 0.64 |
PF04471 | Mrr_cat | 0.64 |
PF03795 | YCII | 0.64 |
PF14833 | NAD_binding_11 | 0.64 |
PF01520 | Amidase_3 | 0.64 |
PF13377 | Peripla_BP_3 | 0.64 |
PF00583 | Acetyltransf_1 | 0.64 |
PF12680 | SnoaL_2 | 0.64 |
PF12441 | CopG_antitoxin | 0.64 |
PF00805 | Pentapeptide | 0.64 |
PF13549 | ATP-grasp_5 | 0.64 |
PF13565 | HTH_32 | 0.64 |
PF13714 | PEP_mutase | 0.64 |
PF03176 | MMPL | 0.64 |
COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
---|---|---|---|
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 2.56 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 2.56 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 2.56 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 2.56 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.28 |
COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 1.28 |
COG3823 | Glutamine cyclotransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.28 |
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 1.28 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.64 |
COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.64 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.64 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.64 |
COG4115 | Toxin component of the Txe-Axe toxin-antitoxin module, Txe/YoeB family | Defense mechanisms [V] | 0.64 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.64 |
COG3157 | Type VI protein secretion system component Hcp (secreted cytotoxin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.64 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.64 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.64 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.64 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.64 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.64 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.64 |
COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.64 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.64 |
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.64 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.64 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.26 % |
Unclassified | root | N/A | 39.74 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459023|GZGNO2B01D46RU | Not Available | 537 | Open in IMG/M |
3300005555|Ga0066692_10742954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 606 | Open in IMG/M |
3300005614|Ga0068856_100835091 | Not Available | 940 | Open in IMG/M |
3300005618|Ga0068864_102179697 | Not Available | 560 | Open in IMG/M |
3300005764|Ga0066903_108974779 | Not Available | 506 | Open in IMG/M |
3300005994|Ga0066789_10134476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Ea1.12 | 1054 | Open in IMG/M |
3300005994|Ga0066789_10210673 | Not Available | 818 | Open in IMG/M |
3300006028|Ga0070717_10230818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1629 | Open in IMG/M |
3300006028|Ga0070717_10412328 | Not Available | 1214 | Open in IMG/M |
3300006755|Ga0079222_12194772 | All Organisms → cellular organisms → Bacteria → PVC group | 549 | Open in IMG/M |
3300006914|Ga0075436_100130555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1762 | Open in IMG/M |
3300006914|Ga0075436_100424513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
3300006954|Ga0079219_11808763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 572 | Open in IMG/M |
3300007258|Ga0099793_10497189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
3300009520|Ga0116214_1114356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 995 | Open in IMG/M |
3300009522|Ga0116218_1085238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Allocatelliglobosispora → Allocatelliglobosispora scoriae | 1439 | Open in IMG/M |
3300009522|Ga0116218_1485946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
3300009672|Ga0116215_1034262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2332 | Open in IMG/M |
3300009683|Ga0116224_10198213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
3300009698|Ga0116216_10549509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 697 | Open in IMG/M |
3300009700|Ga0116217_10682430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 636 | Open in IMG/M |
3300010043|Ga0126380_10654909 | Not Available | 837 | Open in IMG/M |
3300010043|Ga0126380_11512396 | Not Available | 595 | Open in IMG/M |
3300010046|Ga0126384_10993400 | Not Available | 764 | Open in IMG/M |
3300010047|Ga0126382_10825559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola | 793 | Open in IMG/M |
3300010358|Ga0126370_10116769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1882 | Open in IMG/M |
3300010358|Ga0126370_11277427 | Not Available | 687 | Open in IMG/M |
3300010358|Ga0126370_12539601 | Not Available | 511 | Open in IMG/M |
3300010360|Ga0126372_13050504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum | 520 | Open in IMG/M |
3300010361|Ga0126378_10303833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1699 | Open in IMG/M |
3300010361|Ga0126378_11576412 | Not Available | 745 | Open in IMG/M |
3300010361|Ga0126378_13431079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 503 | Open in IMG/M |
3300010362|Ga0126377_11719604 | Not Available | 702 | Open in IMG/M |
3300010371|Ga0134125_10369169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1592 | Open in IMG/M |
3300010373|Ga0134128_11374542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
3300010375|Ga0105239_12734563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 576 | Open in IMG/M |
3300010376|Ga0126381_102406629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 755 | Open in IMG/M |
3300010376|Ga0126381_104113314 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300010379|Ga0136449_100749788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1625 | Open in IMG/M |
3300010379|Ga0136449_102055876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea | 841 | Open in IMG/M |
3300010379|Ga0136449_103237559 | Not Available | 628 | Open in IMG/M |
3300010396|Ga0134126_12793162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 529 | Open in IMG/M |
3300010876|Ga0126361_11107818 | Not Available | 973 | Open in IMG/M |
3300010880|Ga0126350_12000517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 794 | Open in IMG/M |
3300011270|Ga0137391_10980510 | Not Available | 688 | Open in IMG/M |
3300012349|Ga0137387_10798677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
3300012350|Ga0137372_10058766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3358 | Open in IMG/M |
3300012350|Ga0137372_10153996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1875 | Open in IMG/M |
3300012359|Ga0137385_10569246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 954 | Open in IMG/M |
3300012917|Ga0137395_10899805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 640 | Open in IMG/M |
3300012971|Ga0126369_11348044 | Not Available | 803 | Open in IMG/M |
3300014654|Ga0181525_10328943 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300015371|Ga0132258_11113478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1996 | Open in IMG/M |
3300016270|Ga0182036_10269485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1283 | Open in IMG/M |
3300016270|Ga0182036_10885645 | Not Available | 731 | Open in IMG/M |
3300016319|Ga0182033_10068676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2487 | Open in IMG/M |
3300016319|Ga0182033_12174924 | Not Available | 506 | Open in IMG/M |
3300016422|Ga0182039_10575514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 982 | Open in IMG/M |
3300017937|Ga0187809_10210556 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300017955|Ga0187817_10271704 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
3300017959|Ga0187779_10340693 | Not Available | 967 | Open in IMG/M |
3300018017|Ga0187872_10341061 | Not Available | 645 | Open in IMG/M |
3300020081|Ga0206354_11160321 | Not Available | 512 | Open in IMG/M |
3300020582|Ga0210395_10038672 | Not Available | 3497 | Open in IMG/M |
3300021181|Ga0210388_10768992 | Not Available | 836 | Open in IMG/M |
3300021377|Ga0213874_10241968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 662 | Open in IMG/M |
3300021401|Ga0210393_11257005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
3300021402|Ga0210385_10119011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1862 | Open in IMG/M |
3300021405|Ga0210387_11477743 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300021407|Ga0210383_10955561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 728 | Open in IMG/M |
3300021432|Ga0210384_11479398 | Not Available | 584 | Open in IMG/M |
3300021433|Ga0210391_10154335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1808 | Open in IMG/M |
3300021475|Ga0210392_10294136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → Curtobacterium flaccumfaciens | 1162 | Open in IMG/M |
3300021559|Ga0210409_11250468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
3300021560|Ga0126371_11630654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
3300021560|Ga0126371_13132603 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300021560|Ga0126371_13513232 | Not Available | 529 | Open in IMG/M |
3300025910|Ga0207684_11033026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 686 | Open in IMG/M |
3300025910|Ga0207684_11516944 | Not Available | 545 | Open in IMG/M |
3300025916|Ga0207663_10493950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 950 | Open in IMG/M |
3300025919|Ga0207657_10523549 | Not Available | 928 | Open in IMG/M |
3300025920|Ga0207649_10304702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1166 | Open in IMG/M |
3300025929|Ga0207664_10209458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1686 | Open in IMG/M |
3300025929|Ga0207664_10631726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 962 | Open in IMG/M |
3300025932|Ga0207690_11425219 | Not Available | 579 | Open in IMG/M |
3300025961|Ga0207712_10943139 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300026078|Ga0207702_10350446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1413 | Open in IMG/M |
3300026214|Ga0209838_1007722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1489 | Open in IMG/M |
3300026310|Ga0209239_1191587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300026557|Ga0179587_10301323 | Not Available | 1033 | Open in IMG/M |
3300027497|Ga0208199_1059191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 812 | Open in IMG/M |
3300027505|Ga0209218_1093860 | Not Available | 625 | Open in IMG/M |
3300027768|Ga0209772_10051251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1228 | Open in IMG/M |
3300027824|Ga0209040_10064879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2152 | Open in IMG/M |
3300027855|Ga0209693_10276628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 821 | Open in IMG/M |
3300027855|Ga0209693_10408712 | Not Available | 655 | Open in IMG/M |
3300027910|Ga0209583_10108481 | Not Available | 1081 | Open in IMG/M |
3300029882|Ga0311368_10672852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
3300029922|Ga0311363_10716580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 944 | Open in IMG/M |
3300029951|Ga0311371_12470756 | Not Available | 530 | Open in IMG/M |
3300030007|Ga0311338_10929835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 851 | Open in IMG/M |
3300030013|Ga0302178_10324983 | Not Available | 702 | Open in IMG/M |
3300030056|Ga0302181_10025961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3284 | Open in IMG/M |
3300030494|Ga0310037_10026017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2823 | Open in IMG/M |
3300030503|Ga0311370_10620308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium roseum | 1291 | Open in IMG/M |
3300030580|Ga0311355_10494062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1175 | Open in IMG/M |
3300030969|Ga0075394_11575697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 697 | Open in IMG/M |
3300031231|Ga0170824_120594174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L2C089B000 | 685 | Open in IMG/M |
3300031231|Ga0170824_126605612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 734 | Open in IMG/M |
3300031236|Ga0302324_101782971 | Not Available | 783 | Open in IMG/M |
3300031261|Ga0302140_10074851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3534 | Open in IMG/M |
3300031545|Ga0318541_10679873 | Not Available | 575 | Open in IMG/M |
3300031564|Ga0318573_10748870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
3300031572|Ga0318515_10172415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1156 | Open in IMG/M |
3300031572|Ga0318515_10666305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 551 | Open in IMG/M |
3300031640|Ga0318555_10612844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
3300031640|Ga0318555_10762737 | Not Available | 522 | Open in IMG/M |
3300031681|Ga0318572_10098831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1645 | Open in IMG/M |
3300031682|Ga0318560_10341806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 808 | Open in IMG/M |
3300031719|Ga0306917_11081996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
3300031719|Ga0306917_11238956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 578 | Open in IMG/M |
3300031751|Ga0318494_10684863 | Not Available | 600 | Open in IMG/M |
3300031765|Ga0318554_10776384 | Not Available | 536 | Open in IMG/M |
3300031778|Ga0318498_10244890 | Not Available | 809 | Open in IMG/M |
3300031778|Ga0318498_10555592 | Not Available | 503 | Open in IMG/M |
3300031796|Ga0318576_10404529 | Not Available | 645 | Open in IMG/M |
3300031846|Ga0318512_10690467 | Not Available | 523 | Open in IMG/M |
3300031912|Ga0306921_11636703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
3300031945|Ga0310913_10784958 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300031954|Ga0306926_10374302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1760 | Open in IMG/M |
3300031959|Ga0318530_10303978 | Not Available | 659 | Open in IMG/M |
3300032043|Ga0318556_10471805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 656 | Open in IMG/M |
3300032044|Ga0318558_10423162 | Not Available | 663 | Open in IMG/M |
3300032060|Ga0318505_10233143 | Not Available | 865 | Open in IMG/M |
3300032065|Ga0318513_10460377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 622 | Open in IMG/M |
3300032160|Ga0311301_10978432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1123 | Open in IMG/M |
3300032515|Ga0348332_14551775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 735 | Open in IMG/M |
3300032782|Ga0335082_10708700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 868 | Open in IMG/M |
3300032805|Ga0335078_10218347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Alicyclobacillaceae → Alicyclobacillus | 2629 | Open in IMG/M |
3300032892|Ga0335081_11719704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 683 | Open in IMG/M |
3300034124|Ga0370483_0050362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1311 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.82% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.41% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.13% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.13% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.49% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.56% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.92% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.28% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.28% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.28% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.28% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.28% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.28% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.28% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.28% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.64% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.64% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.64% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.64% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.64% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.64% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.64% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.64% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.64% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.64% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.64% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.64% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.64% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.64% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.64% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.64% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.64% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.64% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FA3_01718940 | 2170459023 | Grass Soil | LPSWPSIVLSVAVHVLFSPWVLLVGIAILAWIKFRPGRSHR |
Ga0066692_107429542 | 3300005555 | Soil | IVAIAVLSFAVHLLFSPLLLVAVAVLAWIKFRPRRSRQ* |
Ga0068856_1008350912 | 3300005614 | Corn Rhizosphere | ALIVLSVAVHILFSPWVLLVGIGILAWIKFRPRRSHR* |
Ga0068864_1021796971 | 3300005618 | Switchgrass Rhizosphere | VALIVLSAAVHILFSPWILLVGIGILAWIKFRPRRSHR* |
Ga0066903_1089747792 | 3300005764 | Tropical Forest Soil | LAVLGFAVHLLFSPWLLVAAIAILAWIKFRPRRSDR* |
Ga0066789_101344761 | 3300005994 | Soil | LTVLSFAVHVLFSPWLLVAIAILAWIKFRPRRSYR* |
Ga0066789_102106731 | 3300005994 | Soil | LTVLSFAVHVLFSPWLLVAIAILAWIKFRPRHSHR* |
Ga0070717_102308185 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AVAVLGFVLHILFSPWLLVAVAIVAWIKFRPRGSRQ* |
Ga0070717_104123284 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AVAVLGFVLHILFSPWLLVAVAIVAWIKLRPRGSRQ* |
Ga0070717_115053452 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AIVALAIFGFVAHILFSPWLLLVAVGILAWLMFSRRRSRR* |
Ga0070716_1011447351 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LAIFGFVAHILFSPWLLLVAVGILAWLMFSRRRSRQ* |
Ga0079222_121947721 | 3300006755 | Agricultural Soil | VALSIIGFAVHLLFSPWLLVAVAIVAWIKFRPRGAGR* |
Ga0079221_114700061 | 3300006804 | Agricultural Soil | ALAIFGFVAHILFSPWLLLVAVGILAWLMFSRRRSRR* |
Ga0075436_1001305551 | 3300006914 | Populus Rhizosphere | AVLGFVLHILFSPWLLVAIAILAFIKFRPRRSRP* |
Ga0075436_1004245131 | 3300006914 | Populus Rhizosphere | TVLGFALHILFSPWILVAIAIVAWIKFRPRGSRQ* |
Ga0079219_118087633 | 3300006954 | Agricultural Soil | SILGFALHILFSPWILLAIAILAFIKFRPRRSRQ* |
Ga0099793_104971892 | 3300007258 | Vadose Zone Soil | VAFAVLGFALHILFSPWLLVAIAILAFIKFRPRRSRQ* |
Ga0116214_11143562 | 3300009520 | Peatlands Soil | VALTVLSFAVHVLFSPWLLVAIAILTWIKFRPRRSRR* |
Ga0116218_10852382 | 3300009522 | Peatlands Soil | VALIVLSFALHVLFSPWLLVAVAVLAWIKFRPHRSHR* |
Ga0116218_14859462 | 3300009522 | Peatlands Soil | VALTVLGFVLHVLFSPWLLVAVAIVAWIKFRPSRSRQ* |
Ga0116215_10342621 | 3300009672 | Peatlands Soil | AIVALTVLGFVLHVLFSPWLLVAVAIVAWIKFRPSRSRQ* |
Ga0116224_101982133 | 3300009683 | Peatlands Soil | LVALMVFGFAIHVLFSPWLLLAAVAIVAWIKFRPSRSRR* |
Ga0116216_105495091 | 3300009698 | Peatlands Soil | LTVLGFALHILFSPWLLVVIAIVAWIKFRPSRSRR* |
Ga0116217_106824301 | 3300009700 | Peatlands Soil | ALVVVGLVVHLLFSPWLLVAAVAILAWIQFGPRRSVQ* |
Ga0126380_106549093 | 3300010043 | Tropical Forest Soil | TVLSFTVHVLFSPWLLLVLIGILVWIKFRPGRSRQ* |
Ga0126380_115123962 | 3300010043 | Tropical Forest Soil | AVLGFAVHILFSPWLLLVVIAVLAWVKFRPRRSQR* |
Ga0126384_106672871 | 3300010046 | Tropical Forest Soil | SFAVHLLFSPLFLLLAAVGVLAWIKFRPRRSSRY* |
Ga0126384_109934002 | 3300010046 | Tropical Forest Soil | ALAVLSFTVHILFSPWLLVVAIAALAWIKFRPRRSQR* |
Ga0126382_108255591 | 3300010047 | Tropical Forest Soil | IVALTVLGFVLHVLFSPWLLLVAVAIVAWIKFRPSRSRQ* |
Ga0074044_107361282 | 3300010343 | Bog Forest Soil | MPDHVHLLFSPWLLLLAGVGILAWIKLRPRRSHQ* |
Ga0126370_101167693 | 3300010358 | Tropical Forest Soil | LTVVGFAVHLLFSPWLLVAIAILAWIKFRPRRSHQ* |
Ga0126370_112774272 | 3300010358 | Tropical Forest Soil | ALTVLGIAAHILFSPWLLLVAIGVLVWIKFRPRRSRQ* |
Ga0126370_125396011 | 3300010358 | Tropical Forest Soil | AVIVALIILSFAVHVLFSPWLLLVAIGVLAWIKFRPRRSVH* |
Ga0126372_130505041 | 3300010360 | Tropical Forest Soil | LTVLGFAVHILFSPWLLLAVIGILAWVKFRPRRSRQ* |
Ga0126378_103038331 | 3300010361 | Tropical Forest Soil | VILTVLSFTVHLLFSPWLLVAVAILALIKFWPRRSRQ* |
Ga0126378_115764122 | 3300010361 | Tropical Forest Soil | VLSFAVHILFSPWLLLVAIGVLAWIGFRPRRSQR* |
Ga0126378_134310792 | 3300010361 | Tropical Forest Soil | TVLGFAVHLLFSPWLLVAIAVLAWIKFRPGRSRQ* |
Ga0126377_117196041 | 3300010362 | Tropical Forest Soil | LTVLSFTVHVLFSPWLLLVLIGILVWIKFRPGRSRQ* |
Ga0134125_103691692 | 3300010371 | Terrestrial Soil | IVLSVAVHILFSPWVLLVGIGILAWIKFGPRRSHR* |
Ga0134128_113745421 | 3300010373 | Terrestrial Soil | LSILGCALHILFSPWILLAIAIVALIKFRPRRSRQ* |
Ga0105239_127345633 | 3300010375 | Corn Rhizosphere | VLSAAVHILFSPWILLVGIGILAWIKFRPRRSHR* |
Ga0126381_1006056251 | 3300010376 | Tropical Forest Soil | IAAVAILGFALHALFSPLVLVAIAILAWIKFRPRHTNR* |
Ga0126381_1024066291 | 3300010376 | Tropical Forest Soil | ALTVLGFAVHLLFSPWLLVAIAILAWIKFRPRRSRQ* |
Ga0126381_1041133142 | 3300010376 | Tropical Forest Soil | VAMTVVGFTLHLLFSPWLLVAIGVLVLIKFRPRRSRP* |
Ga0136449_1007497882 | 3300010379 | Peatlands Soil | VALIIVSFAVHVLFSPWLLVAVAIVAWIKFRPCRSQR* |
Ga0136449_1020344894 | 3300010379 | Peatlands Soil | AAIVALTVLGFALHILFSPWLLVVIAIVAWIKFRPSRSRQ* |
Ga0136449_1020558763 | 3300010379 | Peatlands Soil | AIVALTVLGFALHILFSPWLLVVIAIVAWIKFRPSRSRQ* |
Ga0136449_1032375591 | 3300010379 | Peatlands Soil | ALTVLGFALHILFSPWLLVVIAIVAWIKFRPSRSRQ* |
Ga0134126_127931621 | 3300010396 | Terrestrial Soil | ALIVLSFAVHLLFTPWILVPLAIVAWVKFRPGRSRR* |
Ga0126361_111078181 | 3300010876 | Boreal Forest Soil | IVLSFVVHVLFSPWLLVLAIGAIAWVKFRPRRSHR* |
Ga0126350_120005171 | 3300010880 | Boreal Forest Soil | IVVSVLGFALHFLFSPWLLVAIAILAWIKFRPRRTRQ* |
Ga0137391_109805102 | 3300011270 | Vadose Zone Soil | VALIVLSFAVHFLFSPWLLVALVILALIKFRPRRSHR* |
Ga0137387_107986771 | 3300012349 | Vadose Zone Soil | AVLSFTVHFLFSPWLLVAIAVLVWIRFRPRRSRQ* |
Ga0137372_100587661 | 3300012350 | Vadose Zone Soil | VALTVLSFTVHLLFSPWLLVALAILAWIKFRPRRSHR* |
Ga0137372_101539963 | 3300012350 | Vadose Zone Soil | VALSVLSFTAHILFSPWLLLAIGILLWIKFRPRRSRQ* |
Ga0137385_105692463 | 3300012359 | Vadose Zone Soil | LTVLSFAVHVLFSPWLLLVAIGILAWIKFRPRHSHQ* |
Ga0137395_108998052 | 3300012917 | Vadose Zone Soil | VVALIVLSFAVHFLFSPWLLVALVVLALIKFRPRRSHR* |
Ga0126369_113480441 | 3300012971 | Tropical Forest Soil | TVISFTVHFLLSPWLLVAIAILAWIRFRPRHSRR* |
Ga0181525_103289432 | 3300014654 | Bog | VWILSFAVHFLFSPWLLVVAVAVVAWIKLRPRHSQR* |
Ga0132258_111134783 | 3300015371 | Arabidopsis Rhizosphere | LSAAVPILFPPWILVVGIGLLAWIKFRPRRSHRY* |
Ga0182036_102694853 | 3300016270 | Soil | AALAVLGAAVHLLFSPWLLAAIAVLAWIKFRPRRSQR |
Ga0182036_108856452 | 3300016270 | Soil | ALTVLGFAVHVLFSPWLLLAVIGVLAWVKFGPRRSRR |
Ga0182033_100686761 | 3300016319 | Soil | LVALVVLSFVGHFLFSPWLLVAAIGVLAWIKFRPRRSRQ |
Ga0182033_121749241 | 3300016319 | Soil | ALTVLGFAVHVLFSPWLLLAVIGILAWVKFRPGRSHDRR |
Ga0182035_108492071 | 3300016341 | Soil | AVAVLSFAAHILFSPLVLVALGILVWLKVRPRRSHQ |
Ga0182039_105755143 | 3300016422 | Soil | ALALLGFAAHILFSPWLLLAAAGILLWIKFRPRRSRQ |
Ga0187809_102105562 | 3300017937 | Freshwater Sediment | AIVALIVLSAAVHILFSPWILLVGIGVLAWVKFRPGRSHR |
Ga0187817_102717042 | 3300017955 | Freshwater Sediment | VALTILGFAVHVLFSPWLLLAVIGILAWVKFRPRRSRQ |
Ga0187779_103406931 | 3300017959 | Tropical Peatland | ALAVLGFAVHFLFSPWLLVAAIAVLAWVKFRPRRSHR |
Ga0187872_103410611 | 3300018017 | Peatland | MVFGFAIHVLFSPWLLLAAVAIVAWIKFRPGRSPR |
Ga0206354_111603211 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | LVIIALTVLGFAVHFLFSPWLLVAIAIVAWIKFRPRRTHQ |
Ga0210395_100386723 | 3300020582 | Soil | VALTVLSVAVHVLVSPGLLVAVAILAWIKFRPRRSHR |
Ga0210405_105888712 | 3300021171 | Soil | AIVALTVLGFAVHLLFSPLLLLAVIAVVAWIKFGPRRSRR |
Ga0210388_107689922 | 3300021181 | Soil | FVALTVLGFALHILFSPWLLVVIAIVAWIKFRPSRSRQ |
Ga0213874_102419682 | 3300021377 | Plant Roots | IVALIVVGFVVHFLFSPWLLVAVAIVAWIKFRPRRSRR |
Ga0210393_112570051 | 3300021401 | Soil | VALTVLSLTMHFLFSPWLLVAVVILAWIRFRPRRSRQ |
Ga0210385_101190113 | 3300021402 | Soil | VALTVLSVAVHVLVSPWLLAAVAILAWIKFRPRRSHR |
Ga0210387_114777431 | 3300021405 | Soil | IIGLIVVSVVGFALHFLFSPWLLVAIAILAWIKFRPRRTRQ |
Ga0210383_109555611 | 3300021407 | Soil | VSVLGFALHFLFSPWLLVAIAILAWIKFRPRRTRQ |
Ga0210384_114793981 | 3300021432 | Soil | VALTVLGLAVHVLFSPWLLLAVIGILAWVKFRPRHSRQ |
Ga0210391_101543353 | 3300021433 | Soil | VALAVLSFTVHVLFSPWLLAAIAIVAWIKFRPRRSRQ |
Ga0210392_102941363 | 3300021475 | Soil | PDAIEQALTIVSFAVHILFSPWLLLAIGILIWLKFCPRRSQQ |
Ga0210409_112504681 | 3300021559 | Soil | LTVLGVAVHVLFSPWLLVAVAILAWIKFRPRRSPR |
Ga0126371_116306542 | 3300021560 | Tropical Forest Soil | ALAAVSTAVHILFSPWLLLVAVGVFAWIKLRPRRSQR |
Ga0126371_131326031 | 3300021560 | Tropical Forest Soil | VAMTVVGFTLHLLFSPWLLVAIGVLVLIKFRPRRSRP |
Ga0126371_135132322 | 3300021560 | Tropical Forest Soil | VIVALVVLSIAVHILFSPWLLVAIAVLAWIKFRPRRSHQ |
Ga0207684_110330262 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VALAVLTFTVHVLFSPWLLVAIAIVAWIKFRARRFRR |
Ga0207684_115169441 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | IVALTVVGFVMHFIFSPWLLVAIGILVWIKFRPRRSRQ |
Ga0207663_104939502 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | IVAPAVPSVTVHVLFSSWLLVAIAILAWIKFRPRRSRR |
Ga0207657_105235492 | 3300025919 | Corn Rhizosphere | IVLSAAVHILFSPWILLVGIGILAWIKFRPRRSHR |
Ga0207649_103047022 | 3300025920 | Corn Rhizosphere | LTIVGFALHFLFSPWLLVAIAIVAWIKFRPRRSHQ |
Ga0207664_102094581 | 3300025929 | Agricultural Soil | VAFAVLGFVLHILFSPWLLVAIAILAFIKFRPRRSHR |
Ga0207664_106317262 | 3300025929 | Agricultural Soil | VIAALAVAGFALHFLFSPWLLVAVAIVAWIKFRPRGSRQ |
Ga0207690_114252191 | 3300025932 | Corn Rhizosphere | VALIVLSAAVHILFSPWILLVGIGILAWIKFRPRRSHR |
Ga0207712_109431391 | 3300025961 | Switchgrass Rhizosphere | VALTVLSFTVHILFSPWLLVALIAILAWIKFRPRRSHR |
Ga0207702_103504461 | 3300026078 | Corn Rhizosphere | LIVLSFAVHLLFTPWILVPLAIVAWVKFRPGRSRR |
Ga0209838_10077221 | 3300026214 | Soil | ALIIVSFAVHFLFSPWLLVAVAIVAWIKFRPRRSQR |
Ga0209239_11915871 | 3300026310 | Grasslands Soil | LGVLGFALHILFSPWLLVAIAILAWIKFRPRRSRP |
Ga0179587_103013232 | 3300026557 | Vadose Zone Soil | VALTILSFTVHFLFSPWLLVVIGILAWIKFRPRRSHQ |
Ga0208199_10591912 | 3300027497 | Peatlands Soil | VALTVLSFAVHVLFSPWLLVAIAILTWIKFRPRRSRR |
Ga0209218_10938601 | 3300027505 | Forest Soil | LVALTVLSFTAHLLFSPWVLVAIGILVWIKFRPRRSHQ |
Ga0209772_100512512 | 3300027768 | Bog Forest Soil | VALAVLSFAVHFLFSPWLLVAIAILAWIKFWPCRSRR |
Ga0209040_100648795 | 3300027824 | Bog Forest Soil | VALTVLGFVLHVLFSPWLLVAVAIVAWIKFRPSRSRQ |
Ga0209693_102766282 | 3300027855 | Soil | VALTVLSVAVHVLVSPWLLVAVAILAWIKFRPRRSHR |
Ga0209693_104087121 | 3300027855 | Soil | ALIVISFAVHVLFSPWLLVAIAILAWVKFRPHRSHR |
Ga0209583_101084811 | 3300027910 | Watersheds | ALTIFGLAVHLLFSPWLLLVVIAVLAWIKFRPRQSRR |
Ga0311368_106728521 | 3300029882 | Palsa | LIIVSFAVHFLFSPWLLVVVAIVAWIKFRPRHSQR |
Ga0311363_107165801 | 3300029922 | Fen | VALTVLSFAVHILFSPWLLVAIAILAWVKFRPRHSHR |
Ga0311371_124707561 | 3300029951 | Palsa | LVALMVFGFVVHVLFSPWLLLAAVGIVAWIKFRPSRSRR |
Ga0311338_109298352 | 3300030007 | Palsa | LIIVSFAVHLLFSPWLLLAVAIVALIKFRPRRSRR |
Ga0302178_103249832 | 3300030013 | Palsa | AIVALTVLSFAVHVLFSPWLLVAIAILAWIKFRPRHSHR |
Ga0302181_100259615 | 3300030056 | Palsa | VALSILSFSLHILFSPWLLLPAIGVLLWIKLRPRRSHQ |
Ga0310037_100260176 | 3300030494 | Peatlands Soil | AIVALTVLGFVLHVLFSPWLLVAVAIVAWIKFRPSRSRQ |
Ga0311370_106203081 | 3300030503 | Palsa | VALMVFGFVVHVLFSPWLLLAAVGIVAWIKFRPSRSRR |
Ga0311355_104940622 | 3300030580 | Palsa | IVALIIVSFALHLLISPWLLVAVAIVAWIKFGPRRARR |
Ga0075394_115756972 | 3300030969 | Soil | AIVALTVLSFAVHVLFSPWLLVAIAILAWIKFRPGRSHR |
Ga0170824_1205941742 | 3300031231 | Forest Soil | ALTVLSFAVHVLFSPWLLVAIAILAWIKFRPRRSHR |
Ga0170824_1266056122 | 3300031231 | Forest Soil | VALAVLSFAVHFLFTPWLLVPLAILAWVKFRPGRSRR |
Ga0302324_1017829712 | 3300031236 | Palsa | SIVIGAAVHLLFSPWLLLAVAIVALIKFWPRRSRR |
Ga0302140_100748511 | 3300031261 | Bog | LTVLSFAVHVLFSPWLLVAIAILAWVKFRPRHSHR |
Ga0318541_106798732 | 3300031545 | Soil | ALAVLGLAVHLLFSPWLLVAAIAVLAWVKFRPRRSER |
Ga0318573_107488702 | 3300031564 | Soil | LTILGFAVHFLFSPWLLVAIAVLAWLQFRTRRSHR |
Ga0318515_101724151 | 3300031572 | Soil | VAVAVLGFAVHLLFSPWLWLVAIAILAWVKFRPGRSHDRR |
Ga0318515_106663051 | 3300031572 | Soil | LAVLGFAVHLLFSPWLLVAAIAILAWIKFRPRRSSNGR |
Ga0318555_106128442 | 3300031640 | Soil | VVLSFVGHFLFSPWLLVAAIGVLAWIKFRPRRSRQ |
Ga0318555_107627372 | 3300031640 | Soil | ALAVVGFAVHLLFSPWLLVAIAVLAWIKFRPRRSQR |
Ga0318572_100988311 | 3300031681 | Soil | VLALAVLGLAVHLLFSPWLLVAAIAVLAWVKFRPRRSER |
Ga0318560_103418062 | 3300031682 | Soil | MAIVALVMVSFAVHFLVSPWLMVAAAIVVWIKFRPRRSQR |
Ga0306917_110819962 | 3300031719 | Soil | ALAVLSITVHVLFSPWLLVAVAVLAWIKFRPRRSHR |
Ga0306917_112389561 | 3300031719 | Soil | AIVALAVLGFAVHLLFSPWLLVAAIAILAWIKFRPRRSSNGR |
Ga0318502_100380031 | 3300031747 | Soil | ALVVLSFVAHFLFSPWLLLAAVGVLAWVKFRPRRSRQ |
Ga0318494_106848631 | 3300031751 | Soil | ALAILGAIVHILFSPWLLLVAVAVLAWIKFRPSRSHR |
Ga0318554_107763841 | 3300031765 | Soil | LVALTILSIAVHVLFSPWLLLAVVGILAWVAFRPRRSRR |
Ga0318546_110166811 | 3300031771 | Soil | AIVALAVLGFAAHLLFSPWLLVAAIAVLAWVKFRPRRSNNGR |
Ga0318498_102448901 | 3300031778 | Soil | LVVLTITVHFLFSPWLLVVIAVLAWIKFRPRRSHQ |
Ga0318498_105555921 | 3300031778 | Soil | AIAIVALVALSFAVHILFSPWLLVAVAILAWIKFRPRRSRL |
Ga0318557_102536422 | 3300031795 | Soil | AIVALTVLGFAVHVLFSPWLLLAVIGVLAWVKFGPRRSRR |
Ga0318576_104045291 | 3300031796 | Soil | VALAVLSATVHFLFSPWLLVVIAVLAWIKFRPRRSRR |
Ga0318512_106904671 | 3300031846 | Soil | AIVALTVLSVTVHVLFSPWLLVAIAIVAWIKFRPRRSHR |
Ga0306921_116367032 | 3300031912 | Soil | AVVALTILGFAVHFLFSPWLLVAIAVLAWLQFRTRRSHR |
Ga0310913_107849582 | 3300031945 | Soil | TVLGFAVHVLFSPWLLLAVIGVLAWVKFGPRRSRQ |
Ga0306926_103743024 | 3300031954 | Soil | LTVLGFAVHVLFSPWLLLAVIGVLAWVKFGPRRSRQ |
Ga0318530_103039782 | 3300031959 | Soil | ALFVLSITVHFLFSPWLLVVIAVLAWIKFRPRRSHE |
Ga0318556_104718052 | 3300032043 | Soil | ALVALVVLSFVAHFLFSPWLLLAAVGVLAWVKFRPRRSRQ |
Ga0318558_104231621 | 3300032044 | Soil | AIVALAILGAVVHILFSPWLLLVAIAVLAWIKFRPSRSHR |
Ga0318505_102331431 | 3300032060 | Soil | AILGAVAHILFSPWLLLVAIAVLAWIKFRPSRSHR |
Ga0318513_104603771 | 3300032065 | Soil | LALLGFAAHILFSPWLLLAAAGILLWIKFRPRRSRQ |
Ga0311301_109784321 | 3300032160 | Peatlands Soil | AAIVALTVLGFVLHVLFSPWLLVAVAIVAWIKFRPSRSRQ |
Ga0307471_1012558361 | 3300032180 | Hardwood Forest Soil | LVALIVVSFAVHLLFSPWLLLVAVAVLAWVALRPRRSRR |
Ga0348332_145517751 | 3300032515 | Plant Litter | VVALIVISFAVHVLFSPWLLVAIAILAWVKFRPHRSHR |
Ga0335082_107087002 | 3300032782 | Soil | VALIIIVGFAVHFLFSPGLLVAVAIVAWITFRPRRSRR |
Ga0335078_102183471 | 3300032805 | Soil | LAIVGAALHLLFSPWLLVAAVAIVAWIKFRPRRSRQ |
Ga0335081_117197041 | 3300032892 | Soil | AIVALVVLSFAVHILFSPWLLVAVAILAWIKFRPRRSRL |
Ga0335072_111184492 | 3300032898 | Soil | AAIVAFAVLGFVLHVLFSPWLLVAVAIVAFIKFRPRRARQ |
Ga0370483_0050362_1187_1294 | 3300034124 | Untreated Peat Soil | MVFGFAIHVLFSPWLLLAAVAIVAWIKFRPSRSRR |
Ga0373959_0123314_3_110 | 3300034820 | Rhizosphere Soil | AIFGFVAHILFSPWLLLVAVGILAWLMFSRRRSRQ |
⦗Top⦘ |