Basic Information | |
---|---|
Family ID | F043554 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 156 |
Average Sequence Length | 45 residues |
Representative Sequence | NNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTKT |
Number of Associated Samples | 126 |
Number of Associated Scaffolds | 156 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.28 % |
% of genes near scaffold ends (potentially truncated) | 98.08 % |
% of genes from short scaffolds (< 2000 bps) | 96.79 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.949 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.769 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.872 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.03% Coil/Unstructured: 73.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 156 Family Scaffolds |
---|---|---|
PF01638 | HxlR | 12.82 |
PF00903 | Glyoxalase | 4.49 |
PF09922 | DUF2154 | 3.85 |
PF08818 | DUF1801 | 3.21 |
PF01479 | S4 | 3.21 |
PF01810 | LysE | 3.21 |
PF03724 | META | 2.56 |
PF00892 | EamA | 2.56 |
PF05988 | DUF899 | 1.92 |
PF08002 | DUF1697 | 1.92 |
PF00753 | Lactamase_B | 1.92 |
PF02738 | MoCoBD_1 | 1.92 |
PF13419 | HAD_2 | 1.92 |
PF00296 | Bac_luciferase | 1.28 |
PF08241 | Methyltransf_11 | 1.28 |
PF01872 | RibD_C | 1.28 |
PF02016 | Peptidase_S66 | 1.28 |
PF03243 | MerB | 1.28 |
PF16177 | ACAS_N | 1.28 |
PF01814 | Hemerythrin | 0.64 |
PF13365 | Trypsin_2 | 0.64 |
PF11695 | DUF3291 | 0.64 |
PF04014 | MazE_antitoxin | 0.64 |
PF01432 | Peptidase_M3 | 0.64 |
PF06006 | DUF905 | 0.64 |
PF07883 | Cupin_2 | 0.64 |
PF00246 | Peptidase_M14 | 0.64 |
PF02687 | FtsX | 0.64 |
PF13416 | SBP_bac_8 | 0.64 |
PF00144 | Beta-lactamase | 0.64 |
PF04294 | VanW | 0.64 |
PF00356 | LacI | 0.64 |
PF12728 | HTH_17 | 0.64 |
PF01909 | NTP_transf_2 | 0.64 |
PF04434 | SWIM | 0.64 |
PF00909 | Ammonium_transp | 0.64 |
PF00127 | Copper-bind | 0.64 |
PF12680 | SnoaL_2 | 0.64 |
PF01343 | Peptidase_S49 | 0.64 |
PF00201 | UDPGT | 0.64 |
PF02604 | PhdYeFM_antitox | 0.64 |
PF00756 | Esterase | 0.64 |
COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
---|---|---|---|
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 12.82 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 3.21 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 3.21 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 3.21 |
COG3187 | Heat shock protein HslJ | Posttranslational modification, protein turnover, chaperones [O] | 2.56 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.92 |
COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 1.92 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.28 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.28 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.28 |
COG1819 | UDP:flavonoid glycosyltransferase YjiC, YdhE family | Carbohydrate transport and metabolism [G] | 1.28 |
COG1619 | Muramoyltetrapeptide carboxypeptidase LdcA (peptidoglycan recycling) | Cell wall/membrane/envelope biogenesis [M] | 1.28 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.28 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.64 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.64 |
COG2720 | Vancomycin resistance protein YoaR (function unknown), contains peptidoglycan-binding and VanW domains | Defense mechanisms [V] | 0.64 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.64 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.64 |
COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.64 |
COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.64 |
COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.64 |
COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.64 |
COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.64 |
COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.64 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.00 % |
Unclassified | root | N/A | 25.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459012|GOYVCMS02F2MQB | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 506 | Open in IMG/M |
2189573004|GZGWRS402IOMAV | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 519 | Open in IMG/M |
3300000955|JGI1027J12803_106591079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 599 | Open in IMG/M |
3300000956|JGI10216J12902_100194225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 809 | Open in IMG/M |
3300000956|JGI10216J12902_102454193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 780 | Open in IMG/M |
3300000956|JGI10216J12902_104811401 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300000956|JGI10216J12902_107432183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2034 | Open in IMG/M |
3300000956|JGI10216J12902_108096256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1689 | Open in IMG/M |
3300000956|JGI10216J12902_110770909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1624 | Open in IMG/M |
3300001871|JGI24133J20442_1095394 | Not Available | 512 | Open in IMG/M |
3300002549|JGI24130J36418_10019441 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
3300002568|C688J35102_119888243 | Not Available | 804 | Open in IMG/M |
3300002568|C688J35102_120306541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 980 | Open in IMG/M |
3300004025|Ga0055433_10134204 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300004051|Ga0055492_10188397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
3300004145|Ga0055489_10263005 | Not Available | 549 | Open in IMG/M |
3300004156|Ga0062589_101164997 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300004156|Ga0062589_101884071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 603 | Open in IMG/M |
3300004157|Ga0062590_102602178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 538 | Open in IMG/M |
3300004479|Ga0062595_101107787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 693 | Open in IMG/M |
3300004643|Ga0062591_101321994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 710 | Open in IMG/M |
3300004643|Ga0062591_102061267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 590 | Open in IMG/M |
3300005329|Ga0070683_100795534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 906 | Open in IMG/M |
3300005329|Ga0070683_102141929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 537 | Open in IMG/M |
3300005338|Ga0068868_100699192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 907 | Open in IMG/M |
3300005347|Ga0070668_100220920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1563 | Open in IMG/M |
3300005354|Ga0070675_101674718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 587 | Open in IMG/M |
3300005356|Ga0070674_101880072 | Not Available | 544 | Open in IMG/M |
3300005441|Ga0070700_101658079 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005450|Ga0066682_10649504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 655 | Open in IMG/M |
3300005457|Ga0070662_101625623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 558 | Open in IMG/M |
3300005457|Ga0070662_101724757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
3300005546|Ga0070696_100117786 | All Organisms → cellular organisms → Bacteria | 1919 | Open in IMG/M |
3300005559|Ga0066700_10268010 | Not Available | 1198 | Open in IMG/M |
3300005564|Ga0070664_100991346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 789 | Open in IMG/M |
3300005614|Ga0068856_101096196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 814 | Open in IMG/M |
3300005615|Ga0070702_101664548 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005618|Ga0068864_100215589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1769 | Open in IMG/M |
3300005764|Ga0066903_100866985 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
3300005764|Ga0066903_105846145 | Not Available | 646 | Open in IMG/M |
3300005833|Ga0074472_10597842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 810 | Open in IMG/M |
3300005834|Ga0068851_10970215 | Not Available | 535 | Open in IMG/M |
3300005842|Ga0068858_101975526 | Not Available | 576 | Open in IMG/M |
3300006041|Ga0075023_100269661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
3300006041|Ga0075023_100472008 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300006173|Ga0070716_101265364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
3300006852|Ga0075433_10795275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 827 | Open in IMG/M |
3300006904|Ga0075424_102707704 | Not Available | 518 | Open in IMG/M |
3300009012|Ga0066710_104617756 | Not Available | 515 | Open in IMG/M |
3300009094|Ga0111539_12517558 | Not Available | 597 | Open in IMG/M |
3300009137|Ga0066709_103102458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 608 | Open in IMG/M |
3300009148|Ga0105243_10529418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1122 | Open in IMG/M |
3300009148|Ga0105243_11133892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 792 | Open in IMG/M |
3300009148|Ga0105243_12706646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
3300009174|Ga0105241_12361813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
3300009545|Ga0105237_11669262 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300010036|Ga0126305_11171621 | Not Available | 530 | Open in IMG/M |
3300010140|Ga0127456_1099747 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300010329|Ga0134111_10310585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 659 | Open in IMG/M |
3300010375|Ga0105239_12687608 | Not Available | 581 | Open in IMG/M |
3300010403|Ga0134123_10159003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1880 | Open in IMG/M |
3300010403|Ga0134123_12705989 | Not Available | 564 | Open in IMG/M |
3300012003|Ga0120163_1051291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 998 | Open in IMG/M |
3300012004|Ga0120134_1060324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 671 | Open in IMG/M |
3300012201|Ga0137365_10966034 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300012208|Ga0137376_10530346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 1021 | Open in IMG/M |
3300012212|Ga0150985_103228601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides islandensis | 1023 | Open in IMG/M |
3300012212|Ga0150985_114324125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1443 | Open in IMG/M |
3300012212|Ga0150985_115117629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 699 | Open in IMG/M |
3300012212|Ga0150985_118339051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 814 | Open in IMG/M |
3300012469|Ga0150984_115058875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1051 | Open in IMG/M |
3300012469|Ga0150984_117149213 | Not Available | 600 | Open in IMG/M |
3300012503|Ga0157313_1030879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → environmental samples → uncultured Chloroflexota bacterium | 607 | Open in IMG/M |
3300012893|Ga0157284_10026811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1169 | Open in IMG/M |
3300012896|Ga0157303_10074666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 762 | Open in IMG/M |
3300012913|Ga0157298_10194517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 646 | Open in IMG/M |
3300012915|Ga0157302_10521010 | Not Available | 518 | Open in IMG/M |
3300012951|Ga0164300_10644654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 632 | Open in IMG/M |
3300012955|Ga0164298_10908223 | Not Available | 641 | Open in IMG/M |
3300012960|Ga0164301_11919985 | Not Available | 501 | Open in IMG/M |
3300012986|Ga0164304_10647063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 796 | Open in IMG/M |
3300012986|Ga0164304_10712309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
3300012986|Ga0164304_11525354 | Not Available | 554 | Open in IMG/M |
3300012988|Ga0164306_10478773 | Not Available | 953 | Open in IMG/M |
3300012989|Ga0164305_11563883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 587 | Open in IMG/M |
3300013100|Ga0157373_10998881 | Not Available | 624 | Open in IMG/M |
3300013766|Ga0120181_1014220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2162 | Open in IMG/M |
3300014052|Ga0120109_1010758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2006 | Open in IMG/M |
3300015077|Ga0173483_10316292 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300015077|Ga0173483_10539702 | Not Available | 630 | Open in IMG/M |
3300015371|Ga0132258_11665881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1609 | Open in IMG/M |
3300015373|Ga0132257_100389409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1692 | Open in IMG/M |
3300016422|Ga0182039_10874652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 801 | Open in IMG/M |
3300017792|Ga0163161_10339156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1192 | Open in IMG/M |
3300020021|Ga0193726_1301535 | Not Available | 620 | Open in IMG/M |
3300021078|Ga0210381_10230805 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300023102|Ga0247754_1072302 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300023264|Ga0247772_1109973 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300025865|Ga0209226_10108015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1263 | Open in IMG/M |
3300025924|Ga0207694_11390354 | Not Available | 593 | Open in IMG/M |
3300025926|Ga0207659_10348579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 1228 | Open in IMG/M |
3300025927|Ga0207687_11760149 | Not Available | 531 | Open in IMG/M |
3300025937|Ga0207669_11510491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 573 | Open in IMG/M |
3300025938|Ga0207704_10789164 | Not Available | 792 | Open in IMG/M |
3300025939|Ga0207665_11590992 | Not Available | 518 | Open in IMG/M |
3300025945|Ga0207679_10332304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1319 | Open in IMG/M |
3300025945|Ga0207679_11864137 | Not Available | 549 | Open in IMG/M |
3300025972|Ga0207668_10279331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1369 | Open in IMG/M |
3300025986|Ga0207658_12076453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
3300026023|Ga0207677_10942138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 780 | Open in IMG/M |
3300026041|Ga0207639_12030413 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 536 | Open in IMG/M |
3300026075|Ga0207708_11039310 | Not Available | 713 | Open in IMG/M |
3300026095|Ga0207676_11583498 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300027680|Ga0207826_1055089 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300027843|Ga0209798_10578705 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300028592|Ga0247822_10527462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 938 | Open in IMG/M |
3300028793|Ga0307299_10264041 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300028802|Ga0307503_10767752 | Not Available | 547 | Open in IMG/M |
3300028803|Ga0307281_10047722 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
3300028828|Ga0307312_10661432 | Not Available | 692 | Open in IMG/M |
3300028828|Ga0307312_10695689 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300028828|Ga0307312_11024321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces violaceusniger group → Streptomyces violaceusniger | 546 | Open in IMG/M |
3300028875|Ga0307289_10474110 | Not Available | 514 | Open in IMG/M |
3300028881|Ga0307277_10295034 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300028881|Ga0307277_10406772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 609 | Open in IMG/M |
3300029987|Ga0311334_11138913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 653 | Open in IMG/M |
3300030002|Ga0311350_10798346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 846 | Open in IMG/M |
3300030019|Ga0311348_10683697 | Not Available | 765 | Open in IMG/M |
3300030294|Ga0311349_10261120 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
3300030511|Ga0268241_10105560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 657 | Open in IMG/M |
3300030943|Ga0311366_11033625 | Not Available | 710 | Open in IMG/M |
3300031170|Ga0307498_10440346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
3300031226|Ga0307497_10448203 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300031226|Ga0307497_10503577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 598 | Open in IMG/M |
3300031232|Ga0302323_100586465 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300031364|Ga0307445_10275411 | Not Available | 575 | Open in IMG/M |
3300031539|Ga0307380_10523100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus pulveris | 1038 | Open in IMG/M |
3300031770|Ga0318521_10458309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 764 | Open in IMG/M |
3300031820|Ga0307473_10646459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 736 | Open in IMG/M |
3300031918|Ga0311367_11393608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 690 | Open in IMG/M |
3300031918|Ga0311367_11842718 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300031997|Ga0315278_11314907 | Not Available | 704 | Open in IMG/M |
3300032018|Ga0315272_10165899 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300032089|Ga0318525_10065973 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
3300032164|Ga0315283_10381495 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
3300032173|Ga0315268_11281409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 743 | Open in IMG/M |
3300032173|Ga0315268_12576458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 522 | Open in IMG/M |
3300032256|Ga0315271_10020416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4521 | Open in IMG/M |
3300032256|Ga0315271_11149372 | Not Available | 671 | Open in IMG/M |
3300032275|Ga0315270_11182290 | Not Available | 509 | Open in IMG/M |
3300032276|Ga0316188_10161203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1121 | Open in IMG/M |
3300032401|Ga0315275_12342575 | Not Available | 556 | Open in IMG/M |
3300032421|Ga0310812_10495929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
3300033521|Ga0316616_104092547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 549 | Open in IMG/M |
3300033550|Ga0247829_10434063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1083 | Open in IMG/M |
3300034178|Ga0364934_0102195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1078 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.95% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.77% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 5.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.21% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.56% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.56% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.92% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.92% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.92% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.28% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.28% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.28% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.28% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.28% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.28% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.28% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.28% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.28% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.64% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.64% |
Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.64% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.64% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.64% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.64% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.64% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.64% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.64% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.64% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.64% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.64% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.64% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.64% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001871 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 | Environmental | Open in IMG/M |
3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004051 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 | Environmental | Open in IMG/M |
3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
3300023264 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6 | Environmental | Open in IMG/M |
3300025865 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031364 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-30 | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N56_06552960 | 2170459012 | Grass Soil | KVWTTVTIYDHGKVHWQKRYFSNYPAVDGVTVVGTKT |
FG2_05066980 | 2189573004 | Grass Soil | VWTTVSIYDHGKLHWRKRYFSNTRRSNGVTIVGTK |
JGI1027J12803_1065910792 | 3300000955 | Soil | VGYFYRNNTPVDGARVWVTVSIYDHGKLHWSKRYFSNYPPVNGVLVKGTGT* |
JGI10216J12902_1001942251 | 3300000956 | Soil | GAKVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTIVGTRGT* |
JGI10216J12902_1024541932 | 3300000956 | Soil | PADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTRT* |
JGI10216J12902_1048114012 | 3300000956 | Soil | TVTIYDHGKVHWKKRYFSNYPAVDGVTIIGTRGA* |
JGI10216J12902_1074321831 | 3300000956 | Soil | KVWVTVSIYDHGKLHWSKRYYSNYPAVNGVTVVGTKKT* |
JGI10216J12902_1080962561 | 3300000956 | Soil | RFRNNAPADGAKVWVTVTIYDHGKVHWTKRYYSNYPAVDGVTVIGTKT* |
JGI10216J12902_1107709093 | 3300000956 | Soil | WVTVSIYDHGKLHWSKRYYSNYPAVNGVTIVGTKKT* |
JGI24133J20442_10953942 | 3300001871 | Arctic Peat Soil | YSYRNNIPANGAKVWVTVTIYDHGKLHWSTRYYSNYPAVNGVLVVGTRT* |
JGI24130J36418_100194411 | 3300002549 | Arctic Peat Soil | TKPVGYSYRNNAPADGAKVWVTVSIYDHGKLHWTKRYYSNYPAVKGVLVVGTKT* |
C688J35102_1198882431 | 3300002568 | Soil | AAVNGAKVWTTVSIYDHGKLHWRKRYFSNYPAVDGVTIVGTRRT* |
C688J35102_1203065413 | 3300002568 | Soil | AGYRYRNNAPADGAKVWVTVSIYDHGKLHWSKRYYSRYPAVNGVLVVGTG* |
Ga0055433_101342041 | 3300004025 | Natural And Restored Wetlands | KPVGYRFFNNSAVDGAKVWTTVTIYDHGKVHWSKRYFSNYPAVDGVTIVGTRKT* |
Ga0055492_101883971 | 3300004051 | Natural And Restored Wetlands | GAKVWVTVTIYDHGKKHWSKRYYSNYPAVDGVLVVGTKPTT* |
Ga0055489_102630051 | 3300004145 | Natural And Restored Wetlands | KPVGYRYLNNAPADGAKVWTTVTIYDHGKLHWQKRYFSNYPAVDGVTIVGTKKTT* |
Ga0062589_1011649971 | 3300004156 | Soil | FFNNAPADGAKVWVTVSIYDHGKLHFRKRYFSNYPAVDGVTVIGAKGT* |
Ga0062589_1018840712 | 3300004156 | Soil | FRNNFPADGAKVWVTVTIYDHGKLHWTKRYYSNYPAVNGVLVVGTKT* |
Ga0062590_1026021781 | 3300004157 | Soil | GAKVWTTVTIYDHGKKHWSKRYFSNYPAVNGVRIIGTRT* |
Ga0062595_1011077872 | 3300004479 | Soil | NNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTKT* |
Ga0062591_1013219941 | 3300004643 | Soil | AVNGARVWTTVTIYDHGKVHWRKRFYSNYPAVDGVAVVGTRT* |
Ga0062591_1020612671 | 3300004643 | Soil | DGAKVWVTVSIYDHGKLHWSKRYFSNYPAVDGVTIVGTKRS* |
Ga0070683_1007955342 | 3300005329 | Corn Rhizosphere | TGYRFRNNAPADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG* |
Ga0070683_1021419291 | 3300005329 | Corn Rhizosphere | AVNGAKVWTTVSIYDRGKLHWRKRYFSNYPAVDGVTILGSKRT* |
Ga0068868_1006991921 | 3300005338 | Miscanthus Rhizosphere | ADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTKT* |
Ga0070668_1002209203 | 3300005347 | Switchgrass Rhizosphere | RFFNNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTRT* |
Ga0070675_1016747182 | 3300005354 | Miscanthus Rhizosphere | PADGAKVWVTVSIYDHGKLHWTKRYFSNYPAVDGVTIIGTKT* |
Ga0070674_1018800722 | 3300005356 | Miscanthus Rhizosphere | RFFNNAPADGAKVWTTVSIYDHGKLHWSKRYFSNYPAVDGVTVVGTG* |
Ga0070700_1016580791 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | GAKVWTTVSIYDHGKLHWSKRYFSDYPAVDGVTIVGTKGAS* |
Ga0066682_106495041 | 3300005450 | Soil | WYRNNSPADGAKVWVTLTIYDHGKLHWTKRYYSNYPAVNGVLVKGTKT* |
Ga0070662_1016256232 | 3300005457 | Corn Rhizosphere | APADGAKVWVTVSIYDHGKLHWTKRYFSNYPAVDGVTVIGTGS* |
Ga0070662_1017247572 | 3300005457 | Corn Rhizosphere | DGAKVWVTVSIFDHGKLHFTKRYFSNYPAVNGVLIKGTGT* |
Ga0070696_1001177863 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RFRNNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTKT* |
Ga0066700_102680104 | 3300005559 | Soil | APADGAKVWVTVTIYDHGKLHWTRHYYSNYPAVNGVLVVGTKT* |
Ga0070664_1009913461 | 3300005564 | Corn Rhizosphere | DGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG* |
Ga0068856_1010961962 | 3300005614 | Corn Rhizosphere | KPVGYAFRNNTPVDGAKVWVTVSIYDHGKLHWSRRYYSRYPAVNGVLVVGAKT* |
Ga0070702_1016645482 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GAKVWTTVSIYDHGKLHWSKRYYSNYPAVNGVLIVGARGT* |
Ga0068864_1002155893 | 3300005618 | Switchgrass Rhizosphere | FRNNAPADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG* |
Ga0066903_1008669851 | 3300005764 | Tropical Forest Soil | VWVTVSIYDHGKLHWSKRYYSRYPAVNGVTIVGTKTS* |
Ga0066903_1058461451 | 3300005764 | Tropical Forest Soil | WVTVSIYDHGKLHWSKRYYSRYPALDGVTIVGTRKSS* |
Ga0074472_105978421 | 3300005833 | Sediment (Intertidal) | YRNNEPADGAKVWVTVSIYDHGKLHWRKRYYSNYPAVNGVLVVGTRN* |
Ga0068851_109702152 | 3300005834 | Corn Rhizosphere | RFRNNAPADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG* |
Ga0068858_1019755262 | 3300005842 | Switchgrass Rhizosphere | ADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVKGVLIVGTKQS* |
Ga0075023_1002696611 | 3300006041 | Watersheds | VGYSFRNNAPADGAKVWVTVTIYDHGKLHWTKRYYSNYPAVNGVFVVGAKT* |
Ga0075023_1004720082 | 3300006041 | Watersheds | VGYSFRNNAPADGAKVWVTVSIYDHGTLHWTKRYYSNYPAVDGVLLVGTKT* |
Ga0070716_1012653641 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PADGAKVWVTVSIYDHGKLHWRKRYFSNYPAVNGVLVVGART* |
Ga0075433_107952753 | 3300006852 | Populus Rhizosphere | WVTVSIFDHGKLHFTKRYFSNYPAVNGVLIKGTGT* |
Ga0075424_1027077041 | 3300006904 | Populus Rhizosphere | RNNAPADGAKVWVTVSIFDHGKLHWSKRYYSNYPAVNGVLIRGTG* |
Ga0066710_1046177561 | 3300009012 | Grasslands Soil | DRTKPVGYSFRNNAPADGAKVWVTVTIYDHGKLHWTRHYYSNYPAVNGVLVVGTKT |
Ga0111539_125175581 | 3300009094 | Populus Rhizosphere | KPAGYRYRNNAPADGAKVWVTVTIYDHGKKLWSKRYYSNYPAVNGVLVVGTG* |
Ga0066709_1031024581 | 3300009137 | Grasslands Soil | NAPADGAKVCVTVTIYDHGKRHWTTRYFSNYPAVNGVLVVGTKK* |
Ga0105243_105294181 | 3300009148 | Miscanthus Rhizosphere | VWTTVSIYDHGKLHWSKRYYSNYPAVNGVLIVGARGT* |
Ga0105243_111338922 | 3300009148 | Miscanthus Rhizosphere | GAKVWTTVTIYDHGKLHWQKRYFSNYPAVDGVTVVGTGT* |
Ga0105243_127066462 | 3300009148 | Miscanthus Rhizosphere | DGAKVWVTVSIFDHGKLHFSKRYFSNYPAVNGVLIKGTGS* |
Ga0105241_123618132 | 3300009174 | Corn Rhizosphere | PADGAKVWVTVTIYDHGKLHWTKRYYSNYPAVNGVLVVGTKT* |
Ga0105237_116692623 | 3300009545 | Corn Rhizosphere | WVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG* |
Ga0126305_111716212 | 3300010036 | Serpentine Soil | VNGAKVWTTVTIYDHGKVHWKKRYFSNYPAVDGVTIVGTRGA* |
Ga0127456_10997472 | 3300010140 | Grasslands Soil | GYYYRNNAPADGAKVWVTVSIYDHGKLHWTKRYFSNYPAVNGVLIKGTKT* |
Ga0134111_103105851 | 3300010329 | Grasslands Soil | AKVWVTVTIYDHGKLHWTKRYYSNYPAVNGVLVKGTKT* |
Ga0105239_126876081 | 3300010375 | Corn Rhizosphere | YYYRNNFPVDGAKVWTTVSIYDHGKLHWRKRYFSNYPAVDGVQVVGTRR* |
Ga0134123_101590034 | 3300010403 | Terrestrial Soil | YRNNTPVDGAKVWVTVSIFDHGKLHFSKRYFSNYPAVNGVLIKGTGT* |
Ga0134123_127059891 | 3300010403 | Terrestrial Soil | VGYRFFNNAAVNGAKVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTVVGTKT* |
Ga0120163_10512912 | 3300012003 | Permafrost | PADGAKVWVTVSIFDHGKLHWSKRYFSNYPAVNGVTVVGTG* |
Ga0120134_10603242 | 3300012004 | Permafrost | RHNSPVDGAKVWVTVTIYDHGKLHWSTRYYSNYPAVNGVLVVGTRTI* |
Ga0137365_109660341 | 3300012201 | Vadose Zone Soil | RNNAPADGAKVWVTLSIYDHGKLHWTTRYYSNYPAVNGVLVKGTKT* |
Ga0137376_105303461 | 3300012208 | Vadose Zone Soil | KPVGYYFRNNYPVSGAKVWVTVTIYDHGTLHWTKRYFSNYPAVNGVRVVGTKT* |
Ga0150985_1032286011 | 3300012212 | Avena Fatua Rhizosphere | AKVWTTVTIYDHGKVHWTKRYFSNYPAVDGVTVVGTRKT* |
Ga0150985_1143241253 | 3300012212 | Avena Fatua Rhizosphere | YRNNAPADGAKVWVTVSIYDHGKLHWSKRYYSRYPAVNGVLVVGTG* |
Ga0150985_1151176292 | 3300012212 | Avena Fatua Rhizosphere | PVGYRYLNNAPADGAKVWTTVSIYDHGKLHWSKRYFSNYPAVDGVTIVGTKKS* |
Ga0150985_1183390513 | 3300012212 | Avena Fatua Rhizosphere | PVGYRYLNNAPADGAKVWTTVSIYDHGKLHWSKRYFSNYPAVDGVTIVGTRKS* |
Ga0150984_1150588751 | 3300012469 | Avena Fatua Rhizosphere | PAGYRYRNNAPADGAKVWVTVSIYDHGKLHWSKRYYSRYPAVNGVLVVGTG* |
Ga0150984_1171492132 | 3300012469 | Avena Fatua Rhizosphere | AAVNGAKVWTTVSIYDHGKLHWRKRYFSNYPAVDGVTIVGTKRT* |
Ga0157313_10308792 | 3300012503 | Arabidopsis Rhizosphere | VWTTVSIYDHGKLHWRKRYFSNYPAVDGVTIVGTRR* |
Ga0157284_100268111 | 3300012893 | Soil | KPVGYTFFNNAAVDGAKVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTIVGTRGA* |
Ga0157303_100746661 | 3300012896 | Soil | TTVTIYDHGKVHWRKRYFSNYPAVDGVTIVGTKTS* |
Ga0157298_101945171 | 3300012913 | Soil | AVDGAKVWTTVTIYDHGKVHWKKRYFSNYPAVDGVTIVGTKTS* |
Ga0157302_105210101 | 3300012915 | Soil | SKPVGYRFFNNAPADGAKVWVTVSIYDNGKLHLRKRYFSNYPAVDGVTVIGTGT* |
Ga0164300_106446542 | 3300012951 | Soil | KPVGYRFFNNAPADGAKVWVTVSIYDHGKLHWRKRYFSNYPAVNGVTVVGTG* |
Ga0164298_109082232 | 3300012955 | Soil | VGYRFFNNAAVNGAKVWTTVSIYDHGKLHWQKRYFSNYPAVDGVTIVGTKT* |
Ga0164301_119199851 | 3300012960 | Soil | PVGYRFRNNTPVDGARVWVTVSIYDHGKLHWKTRYYSNYPAVNGVLIRGTKT* |
Ga0164304_106470633 | 3300012986 | Soil | GYSFFNNAAVDGAKVWTTVTIYDHGKLHWRKRYFSNYPAVNGVTVVGTG* |
Ga0164304_107123091 | 3300012986 | Soil | VWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG* |
Ga0164304_115253541 | 3300012986 | Soil | KPVGYRFFNNAAVNGAKVWTTVSIYDHGKLHWQKRYFSNYPAVDGVTIVGTKT* |
Ga0164306_104787731 | 3300012988 | Soil | TKPVGYRFRNNAPVNGAKVWVTVSIYDHGKLHWTKRYYSNYPAVNGVLVVGARA* |
Ga0164305_115638832 | 3300012989 | Soil | FNNAPADGAKVWVTVSIYDHGKLHWRKRYFSNYPAVDGVTVIGTRKS* |
Ga0157373_109988811 | 3300013100 | Corn Rhizosphere | NAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVKGVLIVGTKQS* |
Ga0120181_10142201 | 3300013766 | Permafrost | KPVGYSFRNNSPVNGAKVWVTVSIYDHGKLHWTKRYFSNYPAVNGVLVVGTKT* |
Ga0120109_10107584 | 3300014052 | Permafrost | VGYRFRNNSPVDGAKVWVTVTIYDHGKLHWSTRYYSNYPAVNGVLVVGTRTT* |
Ga0173483_103162921 | 3300015077 | Soil | NAPADGAKVWTTVSIYDHGKLHWSKRYYSNYPAVNGVLIVGARGT* |
Ga0173483_105397021 | 3300015077 | Soil | NAPADGAKVWTTVSIYDHGKLHWSKRYFSNYPAVDGVTIVGTKRS* |
Ga0132258_116658811 | 3300015371 | Arabidopsis Rhizosphere | KPVGYRFRNNAPADGAKVWVTVSIYDHGKLHWTKRYYSNYPAVDGVTIVGTRS* |
Ga0132257_1003894093 | 3300015373 | Arabidopsis Rhizosphere | YRYRNNAPADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG* |
Ga0182039_108746522 | 3300016422 | Soil | YRFVNNSPADGAKVWVTVSIYDHGKLHWSKRYYSNYPPVNGVLVVGTG |
Ga0163161_103391563 | 3300017792 | Switchgrass Rhizosphere | ADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG |
Ga0193726_13015351 | 3300020021 | Soil | AKVWVTVSIYDHGKLHWTKRYFSNYPAVKGVLVVGTKSTT |
Ga0210381_102308051 | 3300021078 | Groundwater Sediment | NAAVNGAKVWTTVTIYDHGKVHWTKRYFSNYPAVDGVTVVGTKT |
Ga0247754_10723021 | 3300023102 | Soil | GYRYRNNAPADGAKVWTTVSIYDHSKLHWSKRYYSNYPAVNGVLIVGARGT |
Ga0247772_11099731 | 3300023264 | Plant Litter | AKVWTTVSIYDHGKLHWQKRYYSNYPAVDGVLIVGSKTS |
Ga0209226_101080153 | 3300025865 | Arctic Peat Soil | DGAKVWVTVSIYDHGKKHWSKRYFSNYPAVNGVLVVGTKT |
Ga0207694_113903541 | 3300025924 | Corn Rhizosphere | AKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG |
Ga0207659_103485792 | 3300025926 | Miscanthus Rhizosphere | DGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG |
Ga0207687_117601492 | 3300025927 | Miscanthus Rhizosphere | PVGYRYRNNAPADGAKVWTTVSIYDHGKLHWSKRYYSNYPAVKGVLIVGTKQS |
Ga0207669_115104912 | 3300025937 | Miscanthus Rhizosphere | DGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTRT |
Ga0207704_107891642 | 3300025938 | Miscanthus Rhizosphere | NAPADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG |
Ga0207665_115909921 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | PVDGAKVWVTVSIYDHGKLHWSRRYFSRYPAVNGVLVVGAKT |
Ga0207679_103323043 | 3300025945 | Corn Rhizosphere | RNNAPADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG |
Ga0207679_118641372 | 3300025945 | Corn Rhizosphere | TKPVGYTFFNNAAVDGAKVWTTVTIYDHGKVHWSKRYFSNYPAVDGVTIIGTKT |
Ga0207668_102793311 | 3300025972 | Switchgrass Rhizosphere | KPVGYRFFNNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTRT |
Ga0207658_120764532 | 3300025986 | Switchgrass Rhizosphere | FRNNAPADGAKVWVTVSIYDHGKLHWRKRYFSNYPAVNGVTVVGTG |
Ga0207677_109421381 | 3300026023 | Miscanthus Rhizosphere | DSSKPVGYRFFNNAPADGAKVWVTVSIYDHGKLHWRKRYFSNYPAVNGVTVVGTG |
Ga0207639_120304131 | 3300026041 | Corn Rhizosphere | NNAAVNGARVWTTVTIYDHGKLHWRKRYFSNYPAVDGVTIVGTRGT |
Ga0207708_110393102 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VRDRNKPVGYRFRNNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVV |
Ga0207676_115834981 | 3300026095 | Switchgrass Rhizosphere | GYTFFNNAAVNGARVWTTVTIYDHGKLHWRKRYFSNYPAVDGVTIVGTRGT |
Ga0207826_10550893 | 3300027680 | Tropical Forest Soil | RNNAPVNGAQVWVTVTIYDRGKLHWTKRYYSNYPAVNGVLVVGSG |
Ga0209798_105787052 | 3300027843 | Wetland Sediment | YVFRNNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVTIVGTKTS |
Ga0247822_105274623 | 3300028592 | Soil | APADGAKVWVTVSIYDHGKLHWRRRYFSNYPAVDGVTVVGTKRS |
Ga0307299_102640411 | 3300028793 | Soil | TKPVGYRFFNNAAVNGARVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTIVGTRKT |
Ga0307503_107677522 | 3300028802 | Soil | RNNSPVDGAKVWVTVSIYDHGKLHWSKRYFSNYPAVNGVLVVGTKT |
Ga0307281_100477224 | 3300028803 | Soil | RYRNNAPADGAKVWVTVSIYDHGKLHWTKRYYTNYPAVDGVLVVGTKT |
Ga0307312_106614322 | 3300028828 | Soil | PVGYRFRNNTPVNGAKVWVTVSIYDHGKLHWSNRYFSNYPAVNGVLVVGTKT |
Ga0307312_106956892 | 3300028828 | Soil | FFNNAAVNGAKVWTTVTIYDHGKVHWRKRYFSYYPAVDGVTVVGTKRT |
Ga0307312_110243211 | 3300028828 | Soil | VWVTVTIYDHGKLHWSTRYFSNYPAVNGVLVVGTKT |
Ga0307289_104741101 | 3300028875 | Soil | GYRFFNNAAVDGAKVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTIVGTRGA |
Ga0307277_102950342 | 3300028881 | Soil | VNGAKVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTIVGTRKT |
Ga0307277_104067721 | 3300028881 | Soil | VWVTVSIYDHGKLHWTKRYYTNYPAVNGVLIKGTG |
Ga0311334_111389132 | 3300029987 | Fen | AKVWVTVSIYDHGKLHWSKRYYSNYPPVNGVLIVGTKAAL |
Ga0311350_107983462 | 3300030002 | Fen | NAAVNGAKVWVTVSIYDHGKLHWSKRYYSNYPPVNGVLIVGTKAAL |
Ga0311348_106836971 | 3300030019 | Fen | AKVWVTVSIYDHGKLHWSKRYFSKYPAVDGVVVVGTKT |
Ga0311349_102611203 | 3300030294 | Fen | YSFRNNAAVNGAKVWVTVTIYDHGKLHWTKRYYSNYPAVNGVLVVGTKAAL |
Ga0268241_101055601 | 3300030511 | Soil | GYTFRNNAPADGAKVWVTVSIYDHGKLHWSKRYFSNYPAVNGVTIIGTKKTT |
Ga0311366_110336251 | 3300030943 | Fen | PADGAKVWVTVSIYDHGKLHWSKRYFSKYPAVDGVVVVGTKT |
Ga0307498_104403462 | 3300031170 | Soil | NIPVDGAKVWVTVSIYDHGKLHWSKRYFSNYPAVTGVLVVGART |
Ga0307497_104482031 | 3300031226 | Soil | PVGYRFFNNAAVNGAKVWTTVTIYDHGKLHWRKRYFSNYPAVDGVTIVGTRGT |
Ga0307497_105035772 | 3300031226 | Soil | QVWTTVSIYDHGKLHWRKRFYSNYPAVDGVTIVGTRKAT |
Ga0302323_1005864651 | 3300031232 | Fen | APVNGAKVWVTVTIYDHGKLHWRKRYYSNYPAVNGVLVVGTRAAT |
Ga0307445_102754111 | 3300031364 | Salt Marsh | NSPVNGAKVWVTVSIYDHGKLHWQKRYFSNYPAVNGVTIVGTKKT |
Ga0307380_105231001 | 3300031539 | Soil | VDGAKVGVTVTIYDHGKKHWSKRYFSNYPAVDGVLVRGTKKT |
Ga0318521_104583091 | 3300031770 | Soil | RFVNNAPADGAKVWVTVSIYDHGKLHWTKRYFSDYPAVNGVTVVGTG |
Ga0307473_106464591 | 3300031820 | Hardwood Forest Soil | AKVWVTVSIYDHGQLHWTKRYYSNYPAVNGVLVVGTRT |
Ga0311367_113936081 | 3300031918 | Fen | NNSPVDGAKVWVTVTIYDHGKLHWTKRYYSNYPAVNGVLVVGTKT |
Ga0311367_118427182 | 3300031918 | Fen | SPVNGAKVWVTVTIYDHGKHHWQKRFFSNYPAVDGVVIVGSKTS |
Ga0315278_113149071 | 3300031997 | Sediment | GAKVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTVVGTKT |
Ga0315272_101658991 | 3300032018 | Sediment | RNNSPVDGAKVWVTVSIYDHGTLHWRKRYYSKYPAVNGVLVVGTKT |
Ga0318525_100659733 | 3300032089 | Soil | PADGAKVWVTVSIYDHGKLHWTKRYFSDYPAVNGVTVVGTG |
Ga0315283_103814951 | 3300032164 | Sediment | AKVWVTVSIYDHGKLHWRKRYFSNYPAVDGVTVVGTKSAN |
Ga0315268_112814092 | 3300032173 | Sediment | AVNGAKVWVTVNIFDHGKLHWTKRYYSNYPAVNGVLVVGTKAAL |
Ga0315268_125764581 | 3300032173 | Sediment | VGYSYRNNVPADGAKVWVTVTIYDHGKLHWTKRYYSNYPAVNGVLVVGTKT |
Ga0315271_100204164 | 3300032256 | Sediment | NNAPADGAKVWVTVTIYDHGKRHWTKRYFSNYPAVNGVTVVGTKS |
Ga0315271_111493721 | 3300032256 | Sediment | RNNPPADGAKVWVTVTIYDHGKLHWSKRYFSNYPPVDGVTIVGTKP |
Ga0315270_111822901 | 3300032275 | Sediment | KPVGYTYRNNAAVNGAKVWVTVTIYDHGKKHWTKRFFSNYPAVDGVLIVGTKKT |
Ga0316188_101612032 | 3300032276 | Worm Burrow | PTKPVGYTYRNNAPADGAKVWVTVTIYDHGKRHWSKRYYSNYPAVDGVLVVGTKT |
Ga0315275_123425751 | 3300032401 | Sediment | RNNAPADGAKVWVTVTIYDHGKRHWTKRYYSNYPAVNGVLVVGTKT |
Ga0310812_104959292 | 3300032421 | Soil | NAPADGAKVWVTVTIYDHGKVHWTNRYFSNYPAVNGVLVVGTKT |
Ga0316616_1040925471 | 3300033521 | Soil | APADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTRT |
Ga0247829_104340633 | 3300033550 | Soil | ADGAKVWVTVSIYYHGKLHWRRRYFSNYPAVDGVTVVGTKRS |
Ga0364934_0102195_920_1078 | 3300034178 | Sediment | VGYRFFNNAAVNGAKVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTIVGTRKT |
⦗Top⦘ |