NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F043554

Metagenome / Metatranscriptome Family F043554

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043554
Family Type Metagenome / Metatranscriptome
Number of Sequences 156
Average Sequence Length 45 residues
Representative Sequence NNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTKT
Number of Associated Samples 126
Number of Associated Scaffolds 156

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.28 %
% of genes near scaffold ends (potentially truncated) 98.08 %
% of genes from short scaffolds (< 2000 bps) 96.79 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.949 % of family members)
Environment Ontology (ENVO) Unclassified
(30.769 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.872 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 26.03%    Coil/Unstructured: 73.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 156 Family Scaffolds
PF01638HxlR 12.82
PF00903Glyoxalase 4.49
PF09922DUF2154 3.85
PF08818DUF1801 3.21
PF01479S4 3.21
PF01810LysE 3.21
PF03724META 2.56
PF00892EamA 2.56
PF05988DUF899 1.92
PF08002DUF1697 1.92
PF00753Lactamase_B 1.92
PF02738MoCoBD_1 1.92
PF13419HAD_2 1.92
PF00296Bac_luciferase 1.28
PF08241Methyltransf_11 1.28
PF01872RibD_C 1.28
PF02016Peptidase_S66 1.28
PF03243MerB 1.28
PF16177ACAS_N 1.28
PF01814Hemerythrin 0.64
PF13365Trypsin_2 0.64
PF11695DUF3291 0.64
PF04014MazE_antitoxin 0.64
PF01432Peptidase_M3 0.64
PF06006DUF905 0.64
PF07883Cupin_2 0.64
PF00246Peptidase_M14 0.64
PF02687FtsX 0.64
PF13416SBP_bac_8 0.64
PF00144Beta-lactamase 0.64
PF04294VanW 0.64
PF00356LacI 0.64
PF12728HTH_17 0.64
PF01909NTP_transf_2 0.64
PF04434SWIM 0.64
PF00909Ammonium_transp 0.64
PF00127Copper-bind 0.64
PF12680SnoaL_2 0.64
PF01343Peptidase_S49 0.64
PF00201UDPGT 0.64
PF02604PhdYeFM_antitox 0.64
PF00756Esterase 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 156 Family Scaffolds
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 12.82
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 3.21
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 3.21
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 3.21
COG3187Heat shock protein HslJPosttranslational modification, protein turnover, chaperones [O] 2.56
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 1.92
COG3797Uncharacterized conserved protein, DUF1697 familyFunction unknown [S] 1.92
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 1.28
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.28
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 1.28
COG1819UDP:flavonoid glycosyltransferase YjiC, YdhE familyCarbohydrate transport and metabolism [G] 1.28
COG1619Muramoyltetrapeptide carboxypeptidase LdcA (peptidoglycan recycling)Cell wall/membrane/envelope biogenesis [M] 1.28
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.28
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.64
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.64
COG2367Beta-lactamase class ADefense mechanisms [V] 0.64
COG2720Vancomycin resistance protein YoaR (function unknown), contains peptidoglycan-binding and VanW domainsDefense mechanisms [V] 0.64
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.64
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.64
COG4279Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.64
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.64
COG4715Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.64
COG5431Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domainGeneral function prediction only [R] 0.64
COG0339Zn-dependent oligopeptidase, M3 familyPosttranslational modification, protein turnover, chaperones [O] 0.64
COG0004Ammonia channel protein AmtBInorganic ion transport and metabolism [P] 0.64


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.00 %
UnclassifiedrootN/A25.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459012|GOYVCMS02F2MQBAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium506Open in IMG/M
2189573004|GZGWRS402IOMAVAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi519Open in IMG/M
3300000955|JGI1027J12803_106591079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi599Open in IMG/M
3300000956|JGI10216J12902_100194225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia809Open in IMG/M
3300000956|JGI10216J12902_102454193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14780Open in IMG/M
3300000956|JGI10216J12902_104811401All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300000956|JGI10216J12902_107432183All Organisms → cellular organisms → Bacteria → Terrabacteria group2034Open in IMG/M
3300000956|JGI10216J12902_108096256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1689Open in IMG/M
3300000956|JGI10216J12902_110770909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1624Open in IMG/M
3300001871|JGI24133J20442_1095394Not Available512Open in IMG/M
3300002549|JGI24130J36418_10019441All Organisms → cellular organisms → Bacteria2093Open in IMG/M
3300002568|C688J35102_119888243Not Available804Open in IMG/M
3300002568|C688J35102_120306541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales980Open in IMG/M
3300004025|Ga0055433_10134204All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300004051|Ga0055492_10188397All Organisms → cellular organisms → Bacteria → Terrabacteria group506Open in IMG/M
3300004145|Ga0055489_10263005Not Available549Open in IMG/M
3300004156|Ga0062589_101164997All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300004156|Ga0062589_101884071All Organisms → cellular organisms → Bacteria → Terrabacteria group603Open in IMG/M
3300004157|Ga0062590_102602178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium538Open in IMG/M
3300004479|Ga0062595_101107787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14693Open in IMG/M
3300004643|Ga0062591_101321994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14710Open in IMG/M
3300004643|Ga0062591_102061267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium590Open in IMG/M
3300005329|Ga0070683_100795534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia906Open in IMG/M
3300005329|Ga0070683_102141929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium537Open in IMG/M
3300005338|Ga0068868_100699192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14907Open in IMG/M
3300005347|Ga0070668_100220920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141563Open in IMG/M
3300005354|Ga0070675_101674718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14587Open in IMG/M
3300005356|Ga0070674_101880072Not Available544Open in IMG/M
3300005441|Ga0070700_101658079All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005450|Ga0066682_10649504All Organisms → cellular organisms → Bacteria → Terrabacteria group655Open in IMG/M
3300005457|Ga0070662_101625623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14558Open in IMG/M
3300005457|Ga0070662_101724757All Organisms → cellular organisms → Bacteria → Terrabacteria group541Open in IMG/M
3300005546|Ga0070696_100117786All Organisms → cellular organisms → Bacteria1919Open in IMG/M
3300005559|Ga0066700_10268010Not Available1198Open in IMG/M
3300005564|Ga0070664_100991346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales789Open in IMG/M
3300005614|Ga0068856_101096196All Organisms → cellular organisms → Bacteria → Terrabacteria group814Open in IMG/M
3300005615|Ga0070702_101664548All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005618|Ga0068864_100215589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1769Open in IMG/M
3300005764|Ga0066903_100866985All Organisms → cellular organisms → Bacteria1628Open in IMG/M
3300005764|Ga0066903_105846145Not Available646Open in IMG/M
3300005833|Ga0074472_10597842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia810Open in IMG/M
3300005834|Ga0068851_10970215Not Available535Open in IMG/M
3300005842|Ga0068858_101975526Not Available576Open in IMG/M
3300006041|Ga0075023_100269661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium688Open in IMG/M
3300006041|Ga0075023_100472008All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300006173|Ga0070716_101265364All Organisms → cellular organisms → Bacteria → Terrabacteria group595Open in IMG/M
3300006852|Ga0075433_10795275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria827Open in IMG/M
3300006904|Ga0075424_102707704Not Available518Open in IMG/M
3300009012|Ga0066710_104617756Not Available515Open in IMG/M
3300009094|Ga0111539_12517558Not Available597Open in IMG/M
3300009137|Ga0066709_103102458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium608Open in IMG/M
3300009148|Ga0105243_10529418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1122Open in IMG/M
3300009148|Ga0105243_11133892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14792Open in IMG/M
3300009148|Ga0105243_12706646All Organisms → cellular organisms → Bacteria → Terrabacteria group536Open in IMG/M
3300009174|Ga0105241_12361813All Organisms → cellular organisms → Bacteria → Terrabacteria group530Open in IMG/M
3300009545|Ga0105237_11669262All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300010036|Ga0126305_11171621Not Available530Open in IMG/M
3300010140|Ga0127456_1099747All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300010329|Ga0134111_10310585All Organisms → cellular organisms → Bacteria → Terrabacteria group659Open in IMG/M
3300010375|Ga0105239_12687608Not Available581Open in IMG/M
3300010403|Ga0134123_10159003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1880Open in IMG/M
3300010403|Ga0134123_12705989Not Available564Open in IMG/M
3300012003|Ga0120163_1051291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium998Open in IMG/M
3300012004|Ga0120134_1060324All Organisms → cellular organisms → Bacteria → Terrabacteria group671Open in IMG/M
3300012201|Ga0137365_10966034All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300012208|Ga0137376_10530346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp.1021Open in IMG/M
3300012212|Ga0150985_103228601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides islandensis1023Open in IMG/M
3300012212|Ga0150985_114324125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1443Open in IMG/M
3300012212|Ga0150985_115117629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium699Open in IMG/M
3300012212|Ga0150985_118339051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria814Open in IMG/M
3300012469|Ga0150984_115058875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1051Open in IMG/M
3300012469|Ga0150984_117149213Not Available600Open in IMG/M
3300012503|Ga0157313_1030879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → environmental samples → uncultured Chloroflexota bacterium607Open in IMG/M
3300012893|Ga0157284_10026811All Organisms → cellular organisms → Bacteria → Terrabacteria group1169Open in IMG/M
3300012896|Ga0157303_10074666All Organisms → cellular organisms → Bacteria → Terrabacteria group762Open in IMG/M
3300012913|Ga0157298_10194517All Organisms → cellular organisms → Bacteria → Terrabacteria group646Open in IMG/M
3300012915|Ga0157302_10521010Not Available518Open in IMG/M
3300012951|Ga0164300_10644654All Organisms → cellular organisms → Bacteria → Terrabacteria group632Open in IMG/M
3300012955|Ga0164298_10908223Not Available641Open in IMG/M
3300012960|Ga0164301_11919985Not Available501Open in IMG/M
3300012986|Ga0164304_10647063All Organisms → cellular organisms → Bacteria → Terrabacteria group796Open in IMG/M
3300012986|Ga0164304_10712309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300012986|Ga0164304_11525354Not Available554Open in IMG/M
3300012988|Ga0164306_10478773Not Available953Open in IMG/M
3300012989|Ga0164305_11563883All Organisms → cellular organisms → Bacteria → Terrabacteria group587Open in IMG/M
3300013100|Ga0157373_10998881Not Available624Open in IMG/M
3300013766|Ga0120181_1014220All Organisms → cellular organisms → Bacteria → Terrabacteria group2162Open in IMG/M
3300014052|Ga0120109_1010758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2006Open in IMG/M
3300015077|Ga0173483_10316292All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300015077|Ga0173483_10539702Not Available630Open in IMG/M
3300015371|Ga0132258_11665881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1609Open in IMG/M
3300015373|Ga0132257_100389409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1692Open in IMG/M
3300016422|Ga0182039_10874652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi801Open in IMG/M
3300017792|Ga0163161_10339156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1192Open in IMG/M
3300020021|Ga0193726_1301535Not Available620Open in IMG/M
3300021078|Ga0210381_10230805All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300023102|Ga0247754_1072302All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300023264|Ga0247772_1109973All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300025865|Ga0209226_10108015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141263Open in IMG/M
3300025924|Ga0207694_11390354Not Available593Open in IMG/M
3300025926|Ga0207659_10348579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium1228Open in IMG/M
3300025927|Ga0207687_11760149Not Available531Open in IMG/M
3300025937|Ga0207669_11510491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14573Open in IMG/M
3300025938|Ga0207704_10789164Not Available792Open in IMG/M
3300025939|Ga0207665_11590992Not Available518Open in IMG/M
3300025945|Ga0207679_10332304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1319Open in IMG/M
3300025945|Ga0207679_11864137Not Available549Open in IMG/M
3300025972|Ga0207668_10279331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141369Open in IMG/M
3300025986|Ga0207658_12076453All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300026023|Ga0207677_10942138All Organisms → cellular organisms → Bacteria → Terrabacteria group780Open in IMG/M
3300026041|Ga0207639_12030413All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia536Open in IMG/M
3300026075|Ga0207708_11039310Not Available713Open in IMG/M
3300026095|Ga0207676_11583498All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300027680|Ga0207826_1055089All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300027843|Ga0209798_10578705All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300028592|Ga0247822_10527462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium938Open in IMG/M
3300028793|Ga0307299_10264041All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300028802|Ga0307503_10767752Not Available547Open in IMG/M
3300028803|Ga0307281_10047722All Organisms → cellular organisms → Bacteria1337Open in IMG/M
3300028828|Ga0307312_10661432Not Available692Open in IMG/M
3300028828|Ga0307312_10695689All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300028828|Ga0307312_11024321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces violaceusniger group → Streptomyces violaceusniger546Open in IMG/M
3300028875|Ga0307289_10474110Not Available514Open in IMG/M
3300028881|Ga0307277_10295034All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300028881|Ga0307277_10406772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia609Open in IMG/M
3300029987|Ga0311334_11138913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi653Open in IMG/M
3300030002|Ga0311350_10798346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi846Open in IMG/M
3300030019|Ga0311348_10683697Not Available765Open in IMG/M
3300030294|Ga0311349_10261120All Organisms → cellular organisms → Bacteria1633Open in IMG/M
3300030511|Ga0268241_10105560All Organisms → cellular organisms → Bacteria → Terrabacteria group657Open in IMG/M
3300030943|Ga0311366_11033625Not Available710Open in IMG/M
3300031170|Ga0307498_10440346All Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
3300031226|Ga0307497_10448203All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300031226|Ga0307497_10503577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium598Open in IMG/M
3300031232|Ga0302323_100586465All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300031364|Ga0307445_10275411Not Available575Open in IMG/M
3300031539|Ga0307380_10523100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus pulveris1038Open in IMG/M
3300031770|Ga0318521_10458309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium764Open in IMG/M
3300031820|Ga0307473_10646459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14736Open in IMG/M
3300031918|Ga0311367_11393608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia690Open in IMG/M
3300031918|Ga0311367_11842718All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300031997|Ga0315278_11314907Not Available704Open in IMG/M
3300032018|Ga0315272_10165899All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300032089|Ga0318525_10065973All Organisms → cellular organisms → Bacteria1814Open in IMG/M
3300032164|Ga0315283_10381495All Organisms → cellular organisms → Bacteria1532Open in IMG/M
3300032173|Ga0315268_11281409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi743Open in IMG/M
3300032173|Ga0315268_12576458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi522Open in IMG/M
3300032256|Ga0315271_10020416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi4521Open in IMG/M
3300032256|Ga0315271_11149372Not Available671Open in IMG/M
3300032275|Ga0315270_11182290Not Available509Open in IMG/M
3300032276|Ga0316188_10161203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales1121Open in IMG/M
3300032401|Ga0315275_12342575Not Available556Open in IMG/M
3300032421|Ga0310812_10495929All Organisms → cellular organisms → Bacteria → Terrabacteria group550Open in IMG/M
3300033521|Ga0316616_104092547All Organisms → cellular organisms → Bacteria → Terrabacteria group549Open in IMG/M
3300033550|Ga0247829_10434063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1083Open in IMG/M
3300034178|Ga0364934_0102195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1078Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.95%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.77%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen5.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.21%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.56%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.56%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.92%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.92%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.28%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.28%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.28%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.28%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.28%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.28%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.28%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.28%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.28%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.64%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.64%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.64%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.64%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.64%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.64%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.64%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.64%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.64%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.64%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459012Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grassEnvironmentalOpen in IMG/M
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001871Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311EnvironmentalOpen in IMG/M
3300002549Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004025Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004051Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004145Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010140Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012003Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25MEnvironmentalOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300023264Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6EnvironmentalOpen in IMG/M
3300025865Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031364Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-30EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032018Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middleEnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032276Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N56_065529602170459012Grass SoilKVWTTVTIYDHGKVHWQKRYFSNYPAVDGVTVVGTKT
FG2_050669802189573004Grass SoilVWTTVSIYDHGKLHWRKRYFSNTRRSNGVTIVGTK
JGI1027J12803_10659107923300000955SoilVGYFYRNNTPVDGARVWVTVSIYDHGKLHWSKRYFSNYPPVNGVLVKGTGT*
JGI10216J12902_10019422513300000956SoilGAKVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTIVGTRGT*
JGI10216J12902_10245419323300000956SoilPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTRT*
JGI10216J12902_10481140123300000956SoilTVTIYDHGKVHWKKRYFSNYPAVDGVTIIGTRGA*
JGI10216J12902_10743218313300000956SoilKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVTVVGTKKT*
JGI10216J12902_10809625613300000956SoilRFRNNAPADGAKVWVTVTIYDHGKVHWTKRYYSNYPAVDGVTVIGTKT*
JGI10216J12902_11077090933300000956SoilWVTVSIYDHGKLHWSKRYYSNYPAVNGVTIVGTKKT*
JGI24133J20442_109539423300001871Arctic Peat SoilYSYRNNIPANGAKVWVTVTIYDHGKLHWSTRYYSNYPAVNGVLVVGTRT*
JGI24130J36418_1001944113300002549Arctic Peat SoilTKPVGYSYRNNAPADGAKVWVTVSIYDHGKLHWTKRYYSNYPAVKGVLVVGTKT*
C688J35102_11988824313300002568SoilAAVNGAKVWTTVSIYDHGKLHWRKRYFSNYPAVDGVTIVGTRRT*
C688J35102_12030654133300002568SoilAGYRYRNNAPADGAKVWVTVSIYDHGKLHWSKRYYSRYPAVNGVLVVGTG*
Ga0055433_1013420413300004025Natural And Restored WetlandsKPVGYRFFNNSAVDGAKVWTTVTIYDHGKVHWSKRYFSNYPAVDGVTIVGTRKT*
Ga0055492_1018839713300004051Natural And Restored WetlandsGAKVWVTVTIYDHGKKHWSKRYYSNYPAVDGVLVVGTKPTT*
Ga0055489_1026300513300004145Natural And Restored WetlandsKPVGYRYLNNAPADGAKVWTTVTIYDHGKLHWQKRYFSNYPAVDGVTIVGTKKTT*
Ga0062589_10116499713300004156SoilFFNNAPADGAKVWVTVSIYDHGKLHFRKRYFSNYPAVDGVTVIGAKGT*
Ga0062589_10188407123300004156SoilFRNNFPADGAKVWVTVTIYDHGKLHWTKRYYSNYPAVNGVLVVGTKT*
Ga0062590_10260217813300004157SoilGAKVWTTVTIYDHGKKHWSKRYFSNYPAVNGVRIIGTRT*
Ga0062595_10110778723300004479SoilNNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTKT*
Ga0062591_10132199413300004643SoilAVNGARVWTTVTIYDHGKVHWRKRFYSNYPAVDGVAVVGTRT*
Ga0062591_10206126713300004643SoilDGAKVWVTVSIYDHGKLHWSKRYFSNYPAVDGVTIVGTKRS*
Ga0070683_10079553423300005329Corn RhizosphereTGYRFRNNAPADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG*
Ga0070683_10214192913300005329Corn RhizosphereAVNGAKVWTTVSIYDRGKLHWRKRYFSNYPAVDGVTILGSKRT*
Ga0068868_10069919213300005338Miscanthus RhizosphereADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTKT*
Ga0070668_10022092033300005347Switchgrass RhizosphereRFFNNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTRT*
Ga0070675_10167471823300005354Miscanthus RhizospherePADGAKVWVTVSIYDHGKLHWTKRYFSNYPAVDGVTIIGTKT*
Ga0070674_10188007223300005356Miscanthus RhizosphereRFFNNAPADGAKVWTTVSIYDHGKLHWSKRYFSNYPAVDGVTVVGTG*
Ga0070700_10165807913300005441Corn, Switchgrass And Miscanthus RhizosphereGAKVWTTVSIYDHGKLHWSKRYFSDYPAVDGVTIVGTKGAS*
Ga0066682_1064950413300005450SoilWYRNNSPADGAKVWVTLTIYDHGKLHWTKRYYSNYPAVNGVLVKGTKT*
Ga0070662_10162562323300005457Corn RhizosphereAPADGAKVWVTVSIYDHGKLHWTKRYFSNYPAVDGVTVIGTGS*
Ga0070662_10172475723300005457Corn RhizosphereDGAKVWVTVSIFDHGKLHFTKRYFSNYPAVNGVLIKGTGT*
Ga0070696_10011778633300005546Corn, Switchgrass And Miscanthus RhizosphereRFRNNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTKT*
Ga0066700_1026801043300005559SoilAPADGAKVWVTVTIYDHGKLHWTRHYYSNYPAVNGVLVVGTKT*
Ga0070664_10099134613300005564Corn RhizosphereDGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG*
Ga0068856_10109619623300005614Corn RhizosphereKPVGYAFRNNTPVDGAKVWVTVSIYDHGKLHWSRRYYSRYPAVNGVLVVGAKT*
Ga0070702_10166454823300005615Corn, Switchgrass And Miscanthus RhizosphereGAKVWTTVSIYDHGKLHWSKRYYSNYPAVNGVLIVGARGT*
Ga0068864_10021558933300005618Switchgrass RhizosphereFRNNAPADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG*
Ga0066903_10086698513300005764Tropical Forest SoilVWVTVSIYDHGKLHWSKRYYSRYPAVNGVTIVGTKTS*
Ga0066903_10584614513300005764Tropical Forest SoilWVTVSIYDHGKLHWSKRYYSRYPALDGVTIVGTRKSS*
Ga0074472_1059784213300005833Sediment (Intertidal)YRNNEPADGAKVWVTVSIYDHGKLHWRKRYYSNYPAVNGVLVVGTRN*
Ga0068851_1097021523300005834Corn RhizosphereRFRNNAPADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG*
Ga0068858_10197552623300005842Switchgrass RhizosphereADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVKGVLIVGTKQS*
Ga0075023_10026966113300006041WatershedsVGYSFRNNAPADGAKVWVTVTIYDHGKLHWTKRYYSNYPAVNGVFVVGAKT*
Ga0075023_10047200823300006041WatershedsVGYSFRNNAPADGAKVWVTVSIYDHGTLHWTKRYYSNYPAVDGVLLVGTKT*
Ga0070716_10126536413300006173Corn, Switchgrass And Miscanthus RhizospherePADGAKVWVTVSIYDHGKLHWRKRYFSNYPAVNGVLVVGART*
Ga0075433_1079527533300006852Populus RhizosphereWVTVSIFDHGKLHFTKRYFSNYPAVNGVLIKGTGT*
Ga0075424_10270770413300006904Populus RhizosphereRNNAPADGAKVWVTVSIFDHGKLHWSKRYYSNYPAVNGVLIRGTG*
Ga0066710_10461775613300009012Grasslands SoilDRTKPVGYSFRNNAPADGAKVWVTVTIYDHGKLHWTRHYYSNYPAVNGVLVVGTKT
Ga0111539_1251755813300009094Populus RhizosphereKPAGYRYRNNAPADGAKVWVTVTIYDHGKKLWSKRYYSNYPAVNGVLVVGTG*
Ga0066709_10310245813300009137Grasslands SoilNAPADGAKVCVTVTIYDHGKRHWTTRYFSNYPAVNGVLVVGTKK*
Ga0105243_1052941813300009148Miscanthus RhizosphereVWTTVSIYDHGKLHWSKRYYSNYPAVNGVLIVGARGT*
Ga0105243_1113389223300009148Miscanthus RhizosphereGAKVWTTVTIYDHGKLHWQKRYFSNYPAVDGVTVVGTGT*
Ga0105243_1270664623300009148Miscanthus RhizosphereDGAKVWVTVSIFDHGKLHFSKRYFSNYPAVNGVLIKGTGS*
Ga0105241_1236181323300009174Corn RhizospherePADGAKVWVTVTIYDHGKLHWTKRYYSNYPAVNGVLVVGTKT*
Ga0105237_1166926233300009545Corn RhizosphereWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG*
Ga0126305_1117162123300010036Serpentine SoilVNGAKVWTTVTIYDHGKVHWKKRYFSNYPAVDGVTIVGTRGA*
Ga0127456_109974723300010140Grasslands SoilGYYYRNNAPADGAKVWVTVSIYDHGKLHWTKRYFSNYPAVNGVLIKGTKT*
Ga0134111_1031058513300010329Grasslands SoilAKVWVTVTIYDHGKLHWTKRYYSNYPAVNGVLVKGTKT*
Ga0105239_1268760813300010375Corn RhizosphereYYYRNNFPVDGAKVWTTVSIYDHGKLHWRKRYFSNYPAVDGVQVVGTRR*
Ga0134123_1015900343300010403Terrestrial SoilYRNNTPVDGAKVWVTVSIFDHGKLHFSKRYFSNYPAVNGVLIKGTGT*
Ga0134123_1270598913300010403Terrestrial SoilVGYRFFNNAAVNGAKVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTVVGTKT*
Ga0120163_105129123300012003PermafrostPADGAKVWVTVSIFDHGKLHWSKRYFSNYPAVNGVTVVGTG*
Ga0120134_106032423300012004PermafrostRHNSPVDGAKVWVTVTIYDHGKLHWSTRYYSNYPAVNGVLVVGTRTI*
Ga0137365_1096603413300012201Vadose Zone SoilRNNAPADGAKVWVTLSIYDHGKLHWTTRYYSNYPAVNGVLVKGTKT*
Ga0137376_1053034613300012208Vadose Zone SoilKPVGYYFRNNYPVSGAKVWVTVTIYDHGTLHWTKRYFSNYPAVNGVRVVGTKT*
Ga0150985_10322860113300012212Avena Fatua RhizosphereAKVWTTVTIYDHGKVHWTKRYFSNYPAVDGVTVVGTRKT*
Ga0150985_11432412533300012212Avena Fatua RhizosphereYRNNAPADGAKVWVTVSIYDHGKLHWSKRYYSRYPAVNGVLVVGTG*
Ga0150985_11511762923300012212Avena Fatua RhizospherePVGYRYLNNAPADGAKVWTTVSIYDHGKLHWSKRYFSNYPAVDGVTIVGTKKS*
Ga0150985_11833905133300012212Avena Fatua RhizospherePVGYRYLNNAPADGAKVWTTVSIYDHGKLHWSKRYFSNYPAVDGVTIVGTRKS*
Ga0150984_11505887513300012469Avena Fatua RhizospherePAGYRYRNNAPADGAKVWVTVSIYDHGKLHWSKRYYSRYPAVNGVLVVGTG*
Ga0150984_11714921323300012469Avena Fatua RhizosphereAAVNGAKVWTTVSIYDHGKLHWRKRYFSNYPAVDGVTIVGTKRT*
Ga0157313_103087923300012503Arabidopsis RhizosphereVWTTVSIYDHGKLHWRKRYFSNYPAVDGVTIVGTRR*
Ga0157284_1002681113300012893SoilKPVGYTFFNNAAVDGAKVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTIVGTRGA*
Ga0157303_1007466613300012896SoilTTVTIYDHGKVHWRKRYFSNYPAVDGVTIVGTKTS*
Ga0157298_1019451713300012913SoilAVDGAKVWTTVTIYDHGKVHWKKRYFSNYPAVDGVTIVGTKTS*
Ga0157302_1052101013300012915SoilSKPVGYRFFNNAPADGAKVWVTVSIYDNGKLHLRKRYFSNYPAVDGVTVIGTGT*
Ga0164300_1064465423300012951SoilKPVGYRFFNNAPADGAKVWVTVSIYDHGKLHWRKRYFSNYPAVNGVTVVGTG*
Ga0164298_1090822323300012955SoilVGYRFFNNAAVNGAKVWTTVSIYDHGKLHWQKRYFSNYPAVDGVTIVGTKT*
Ga0164301_1191998513300012960SoilPVGYRFRNNTPVDGARVWVTVSIYDHGKLHWKTRYYSNYPAVNGVLIRGTKT*
Ga0164304_1064706333300012986SoilGYSFFNNAAVDGAKVWTTVTIYDHGKLHWRKRYFSNYPAVNGVTVVGTG*
Ga0164304_1071230913300012986SoilVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG*
Ga0164304_1152535413300012986SoilKPVGYRFFNNAAVNGAKVWTTVSIYDHGKLHWQKRYFSNYPAVDGVTIVGTKT*
Ga0164306_1047877313300012988SoilTKPVGYRFRNNAPVNGAKVWVTVSIYDHGKLHWTKRYYSNYPAVNGVLVVGARA*
Ga0164305_1156388323300012989SoilFNNAPADGAKVWVTVSIYDHGKLHWRKRYFSNYPAVDGVTVIGTRKS*
Ga0157373_1099888113300013100Corn RhizosphereNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVKGVLIVGTKQS*
Ga0120181_101422013300013766PermafrostKPVGYSFRNNSPVNGAKVWVTVSIYDHGKLHWTKRYFSNYPAVNGVLVVGTKT*
Ga0120109_101075843300014052PermafrostVGYRFRNNSPVDGAKVWVTVTIYDHGKLHWSTRYYSNYPAVNGVLVVGTRTT*
Ga0173483_1031629213300015077SoilNAPADGAKVWTTVSIYDHGKLHWSKRYYSNYPAVNGVLIVGARGT*
Ga0173483_1053970213300015077SoilNAPADGAKVWTTVSIYDHGKLHWSKRYFSNYPAVDGVTIVGTKRS*
Ga0132258_1166588113300015371Arabidopsis RhizosphereKPVGYRFRNNAPADGAKVWVTVSIYDHGKLHWTKRYYSNYPAVDGVTIVGTRS*
Ga0132257_10038940933300015373Arabidopsis RhizosphereYRYRNNAPADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG*
Ga0182039_1087465223300016422SoilYRFVNNSPADGAKVWVTVSIYDHGKLHWSKRYYSNYPPVNGVLVVGTG
Ga0163161_1033915633300017792Switchgrass RhizosphereADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG
Ga0193726_130153513300020021SoilAKVWVTVSIYDHGKLHWTKRYFSNYPAVKGVLVVGTKSTT
Ga0210381_1023080513300021078Groundwater SedimentNAAVNGAKVWTTVTIYDHGKVHWTKRYFSNYPAVDGVTVVGTKT
Ga0247754_107230213300023102SoilGYRYRNNAPADGAKVWTTVSIYDHSKLHWSKRYYSNYPAVNGVLIVGARGT
Ga0247772_110997313300023264Plant LitterAKVWTTVSIYDHGKLHWQKRYYSNYPAVDGVLIVGSKTS
Ga0209226_1010801533300025865Arctic Peat SoilDGAKVWVTVSIYDHGKKHWSKRYFSNYPAVNGVLVVGTKT
Ga0207694_1139035413300025924Corn RhizosphereAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG
Ga0207659_1034857923300025926Miscanthus RhizosphereDGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG
Ga0207687_1176014923300025927Miscanthus RhizospherePVGYRYRNNAPADGAKVWTTVSIYDHGKLHWSKRYYSNYPAVKGVLIVGTKQS
Ga0207669_1151049123300025937Miscanthus RhizosphereDGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTRT
Ga0207704_1078916423300025938Miscanthus RhizosphereNAPADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG
Ga0207665_1159099213300025939Corn, Switchgrass And Miscanthus RhizospherePVDGAKVWVTVSIYDHGKLHWSRRYFSRYPAVNGVLVVGAKT
Ga0207679_1033230433300025945Corn RhizosphereRNNAPADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTG
Ga0207679_1186413723300025945Corn RhizosphereTKPVGYTFFNNAAVDGAKVWTTVTIYDHGKVHWSKRYFSNYPAVDGVTIIGTKT
Ga0207668_1027933113300025972Switchgrass RhizosphereKPVGYRFFNNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVVGTRT
Ga0207658_1207645323300025986Switchgrass RhizosphereFRNNAPADGAKVWVTVSIYDHGKLHWRKRYFSNYPAVNGVTVVGTG
Ga0207677_1094213813300026023Miscanthus RhizosphereDSSKPVGYRFFNNAPADGAKVWVTVSIYDHGKLHWRKRYFSNYPAVNGVTVVGTG
Ga0207639_1203041313300026041Corn RhizosphereNNAAVNGARVWTTVTIYDHGKLHWRKRYFSNYPAVDGVTIVGTRGT
Ga0207708_1103931023300026075Corn, Switchgrass And Miscanthus RhizosphereVRDRNKPVGYRFRNNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVLVV
Ga0207676_1158349813300026095Switchgrass RhizosphereGYTFFNNAAVNGARVWTTVTIYDHGKLHWRKRYFSNYPAVDGVTIVGTRGT
Ga0207826_105508933300027680Tropical Forest SoilRNNAPVNGAQVWVTVTIYDRGKLHWTKRYYSNYPAVNGVLVVGSG
Ga0209798_1057870523300027843Wetland SedimentYVFRNNAPADGAKVWVTVSIYDHGKLHWSKRYYSNYPAVNGVTIVGTKTS
Ga0247822_1052746233300028592SoilAPADGAKVWVTVSIYDHGKLHWRRRYFSNYPAVDGVTVVGTKRS
Ga0307299_1026404113300028793SoilTKPVGYRFFNNAAVNGARVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTIVGTRKT
Ga0307503_1076775223300028802SoilRNNSPVDGAKVWVTVSIYDHGKLHWSKRYFSNYPAVNGVLVVGTKT
Ga0307281_1004772243300028803SoilRYRNNAPADGAKVWVTVSIYDHGKLHWTKRYYTNYPAVDGVLVVGTKT
Ga0307312_1066143223300028828SoilPVGYRFRNNTPVNGAKVWVTVSIYDHGKLHWSNRYFSNYPAVNGVLVVGTKT
Ga0307312_1069568923300028828SoilFFNNAAVNGAKVWTTVTIYDHGKVHWRKRYFSYYPAVDGVTVVGTKRT
Ga0307312_1102432113300028828SoilVWVTVTIYDHGKLHWSTRYFSNYPAVNGVLVVGTKT
Ga0307289_1047411013300028875SoilGYRFFNNAAVDGAKVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTIVGTRGA
Ga0307277_1029503423300028881SoilVNGAKVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTIVGTRKT
Ga0307277_1040677213300028881SoilVWVTVSIYDHGKLHWTKRYYTNYPAVNGVLIKGTG
Ga0311334_1113891323300029987FenAKVWVTVSIYDHGKLHWSKRYYSNYPPVNGVLIVGTKAAL
Ga0311350_1079834623300030002FenNAAVNGAKVWVTVSIYDHGKLHWSKRYYSNYPPVNGVLIVGTKAAL
Ga0311348_1068369713300030019FenAKVWVTVSIYDHGKLHWSKRYFSKYPAVDGVVVVGTKT
Ga0311349_1026112033300030294FenYSFRNNAAVNGAKVWVTVTIYDHGKLHWTKRYYSNYPAVNGVLVVGTKAAL
Ga0268241_1010556013300030511SoilGYTFRNNAPADGAKVWVTVSIYDHGKLHWSKRYFSNYPAVNGVTIIGTKKTT
Ga0311366_1103362513300030943FenPADGAKVWVTVSIYDHGKLHWSKRYFSKYPAVDGVVVVGTKT
Ga0307498_1044034623300031170SoilNIPVDGAKVWVTVSIYDHGKLHWSKRYFSNYPAVTGVLVVGART
Ga0307497_1044820313300031226SoilPVGYRFFNNAAVNGAKVWTTVTIYDHGKLHWRKRYFSNYPAVDGVTIVGTRGT
Ga0307497_1050357723300031226SoilQVWTTVSIYDHGKLHWRKRFYSNYPAVDGVTIVGTRKAT
Ga0302323_10058646513300031232FenAPVNGAKVWVTVTIYDHGKLHWRKRYYSNYPAVNGVLVVGTRAAT
Ga0307445_1027541113300031364Salt MarshNSPVNGAKVWVTVSIYDHGKLHWQKRYFSNYPAVNGVTIVGTKKT
Ga0307380_1052310013300031539SoilVDGAKVGVTVTIYDHGKKHWSKRYFSNYPAVDGVLVRGTKKT
Ga0318521_1045830913300031770SoilRFVNNAPADGAKVWVTVSIYDHGKLHWTKRYFSDYPAVNGVTVVGTG
Ga0307473_1064645913300031820Hardwood Forest SoilAKVWVTVSIYDHGQLHWTKRYYSNYPAVNGVLVVGTRT
Ga0311367_1139360813300031918FenNNSPVDGAKVWVTVTIYDHGKLHWTKRYYSNYPAVNGVLVVGTKT
Ga0311367_1184271823300031918FenSPVNGAKVWVTVTIYDHGKHHWQKRFFSNYPAVDGVVIVGSKTS
Ga0315278_1131490713300031997SedimentGAKVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTVVGTKT
Ga0315272_1016589913300032018SedimentRNNSPVDGAKVWVTVSIYDHGTLHWRKRYYSKYPAVNGVLVVGTKT
Ga0318525_1006597333300032089SoilPADGAKVWVTVSIYDHGKLHWTKRYFSDYPAVNGVTVVGTG
Ga0315283_1038149513300032164SedimentAKVWVTVSIYDHGKLHWRKRYFSNYPAVDGVTVVGTKSAN
Ga0315268_1128140923300032173SedimentAVNGAKVWVTVNIFDHGKLHWTKRYYSNYPAVNGVLVVGTKAAL
Ga0315268_1257645813300032173SedimentVGYSYRNNVPADGAKVWVTVTIYDHGKLHWTKRYYSNYPAVNGVLVVGTKT
Ga0315271_1002041643300032256SedimentNNAPADGAKVWVTVTIYDHGKRHWTKRYFSNYPAVNGVTVVGTKS
Ga0315271_1114937213300032256SedimentRNNPPADGAKVWVTVTIYDHGKLHWSKRYFSNYPPVDGVTIVGTKP
Ga0315270_1118229013300032275SedimentKPVGYTYRNNAAVNGAKVWVTVTIYDHGKKHWTKRFFSNYPAVDGVLIVGTKKT
Ga0316188_1016120323300032276Worm BurrowPTKPVGYTYRNNAPADGAKVWVTVTIYDHGKRHWSKRYYSNYPAVDGVLVVGTKT
Ga0315275_1234257513300032401SedimentRNNAPADGAKVWVTVTIYDHGKRHWTKRYYSNYPAVNGVLVVGTKT
Ga0310812_1049592923300032421SoilNAPADGAKVWVTVTIYDHGKVHWTNRYFSNYPAVNGVLVVGTKT
Ga0316616_10409254713300033521SoilAPADGAKVWVTVTIYDHGKKHWSKRYYSNYPAVNGVLVVGTRT
Ga0247829_1043406333300033550SoilADGAKVWVTVSIYYHGKLHWRRRYFSNYPAVDGVTVVGTKRS
Ga0364934_0102195_920_10783300034178SedimentVGYRFFNNAAVNGAKVWTTVTIYDHGKVHWRKRYFSNYPAVDGVTIVGTRKT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.