| Basic Information | |
|---|---|
| Family ID | F043536 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 156 |
| Average Sequence Length | 44 residues |
| Representative Sequence | YVIAILIGLALPVAAVALYFGLAVYLVVPFREAARVLARRHSSRQ |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 156 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.92 % |
| % of genes near scaffold ends (potentially truncated) | 81.41 % |
| % of genes from short scaffolds (< 2000 bps) | 81.41 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.308 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.718 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.410 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (39.103 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.90% β-sheet: 0.00% Coil/Unstructured: 41.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 156 Family Scaffolds |
|---|---|---|
| PF06736 | TMEM175 | 3.85 |
| PF03631 | Virul_fac_BrkB | 3.21 |
| PF01636 | APH | 2.56 |
| PF01061 | ABC2_membrane | 2.56 |
| PF07885 | Ion_trans_2 | 2.56 |
| PF00400 | WD40 | 2.56 |
| PF00196 | GerE | 1.92 |
| PF09851 | SHOCT | 1.92 |
| PF00005 | ABC_tran | 1.28 |
| PF13399 | LytR_C | 1.28 |
| PF10009 | DUF2252 | 1.28 |
| PF01609 | DDE_Tnp_1 | 1.28 |
| PF03729 | DUF308 | 1.28 |
| PF00892 | EamA | 1.28 |
| PF12802 | MarR_2 | 1.28 |
| PF02627 | CMD | 1.28 |
| PF05726 | Pirin_C | 0.64 |
| PF04525 | LOR | 0.64 |
| PF01904 | DUF72 | 0.64 |
| PF13424 | TPR_12 | 0.64 |
| PF13683 | rve_3 | 0.64 |
| PF02574 | S-methyl_trans | 0.64 |
| PF00781 | DAGK_cat | 0.64 |
| PF04326 | AlbA_2 | 0.64 |
| PF02026 | RyR | 0.64 |
| PF08240 | ADH_N | 0.64 |
| PF02861 | Clp_N | 0.64 |
| PF07690 | MFS_1 | 0.64 |
| PF07883 | Cupin_2 | 0.64 |
| PF12710 | HAD | 0.64 |
| PF01370 | Epimerase | 0.64 |
| PF03009 | GDPD | 0.64 |
| PF03050 | DDE_Tnp_IS66 | 0.64 |
| PF03401 | TctC | 0.64 |
| PF13191 | AAA_16 | 0.64 |
| PF00795 | CN_hydrolase | 0.64 |
| PF08264 | Anticodon_1 | 0.64 |
| PF12680 | SnoaL_2 | 0.64 |
| PF07784 | DUF1622 | 0.64 |
| PF00903 | Glyoxalase | 0.64 |
| PF13602 | ADH_zinc_N_2 | 0.64 |
| PF05988 | DUF899 | 0.64 |
| PF13396 | PLDc_N | 0.64 |
| PF01494 | FAD_binding_3 | 0.64 |
| PF10988 | DUF2807 | 0.64 |
| PF13360 | PQQ_2 | 0.64 |
| PF00271 | Helicase_C | 0.64 |
| PF01740 | STAS | 0.64 |
| PF06897 | DUF1269 | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
|---|---|---|---|
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 3.85 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 3.21 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.28 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.28 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 1.28 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.28 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.28 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.28 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.28 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.28 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.28 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.28 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.28 |
| COG4828 | Uncharacterized membrane protein | Function unknown [S] | 0.64 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.64 |
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.64 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.64 |
| COG4894 | Putative phospholipid scramblase YxjI, Tubby2 superfamily | Lipid transport and metabolism [I] | 0.64 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.64 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.64 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.64 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.64 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.64 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.64 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.64 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.64 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.64 |
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.64 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.95 % |
| Unclassified | root | N/A | 32.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig00174 | All Organisms → cellular organisms → Bacteria | 5099 | Open in IMG/M |
| 3300004463|Ga0063356_101118492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1137 | Open in IMG/M |
| 3300005445|Ga0070708_100213140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1810 | Open in IMG/M |
| 3300005455|Ga0070663_101688684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300005557|Ga0066704_10447094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 854 | Open in IMG/M |
| 3300005764|Ga0066903_101193077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1412 | Open in IMG/M |
| 3300005994|Ga0066789_10166708 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300006059|Ga0075017_101114390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 617 | Open in IMG/M |
| 3300006059|Ga0075017_101178216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 600 | Open in IMG/M |
| 3300006086|Ga0075019_10785608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
| 3300006174|Ga0075014_100591229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300006576|Ga0074047_12018251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1052 | Open in IMG/M |
| 3300006642|Ga0075521_10168729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1031 | Open in IMG/M |
| 3300009700|Ga0116217_10663521 | Not Available | 647 | Open in IMG/M |
| 3300010048|Ga0126373_13250667 | Not Available | 506 | Open in IMG/M |
| 3300010341|Ga0074045_10237600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1208 | Open in IMG/M |
| 3300010361|Ga0126378_13127079 | Not Available | 527 | Open in IMG/M |
| 3300010366|Ga0126379_12890688 | Not Available | 575 | Open in IMG/M |
| 3300010379|Ga0136449_100122764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5211 | Open in IMG/M |
| 3300010379|Ga0136449_100956262 | Not Available | 1386 | Open in IMG/M |
| 3300010379|Ga0136449_101244215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1167 | Open in IMG/M |
| 3300010379|Ga0136449_103636428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
| 3300012199|Ga0137383_10006008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7871 | Open in IMG/M |
| 3300012200|Ga0137382_11057342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter fluminis | 581 | Open in IMG/M |
| 3300012209|Ga0137379_10090762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2939 | Open in IMG/M |
| 3300012211|Ga0137377_10513764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1136 | Open in IMG/M |
| 3300012349|Ga0137387_11239342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300012955|Ga0164298_10788331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales | 678 | Open in IMG/M |
| 3300012971|Ga0126369_12961001 | Not Available | 556 | Open in IMG/M |
| 3300014164|Ga0181532_10102707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1778 | Open in IMG/M |
| 3300015374|Ga0132255_100418254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1955 | Open in IMG/M |
| 3300015374|Ga0132255_100639699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus obscurus → Geodermatophilus obscurus DSM 43160 | 1576 | Open in IMG/M |
| 3300015374|Ga0132255_102366976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leifsonia → unclassified Leifsonia → Leifsonia sp. AG29 | 811 | Open in IMG/M |
| 3300016270|Ga0182036_10189120 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aerophobetes → Candidatus Aerophobus | 1500 | Open in IMG/M |
| 3300016319|Ga0182033_10830702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 815 | Open in IMG/M |
| 3300016341|Ga0182035_11422382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 623 | Open in IMG/M |
| 3300016387|Ga0182040_11304277 | Not Available | 613 | Open in IMG/M |
| 3300016422|Ga0182039_10880888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 798 | Open in IMG/M |
| 3300016445|Ga0182038_11081271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 712 | Open in IMG/M |
| 3300016750|Ga0181505_10620085 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300017821|Ga0187812_1100589 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300017822|Ga0187802_10143335 | Not Available | 911 | Open in IMG/M |
| 3300017926|Ga0187807_1018892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2122 | Open in IMG/M |
| 3300017928|Ga0187806_1009796 | Not Available | 2671 | Open in IMG/M |
| 3300017928|Ga0187806_1201115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 675 | Open in IMG/M |
| 3300017933|Ga0187801_10165985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 865 | Open in IMG/M |
| 3300017942|Ga0187808_10616134 | Not Available | 504 | Open in IMG/M |
| 3300017943|Ga0187819_10073200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2040 | Open in IMG/M |
| 3300017994|Ga0187822_10081578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 960 | Open in IMG/M |
| 3300018006|Ga0187804_10467201 | Not Available | 564 | Open in IMG/M |
| 3300018006|Ga0187804_10543744 | Not Available | 524 | Open in IMG/M |
| 3300018007|Ga0187805_10043202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2021 | Open in IMG/M |
| 3300018007|Ga0187805_10316721 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300018017|Ga0187872_10244849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 805 | Open in IMG/M |
| 3300018060|Ga0187765_10560387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 732 | Open in IMG/M |
| 3300020580|Ga0210403_11417702 | Not Available | 526 | Open in IMG/M |
| 3300021088|Ga0210404_10401656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
| 3300021171|Ga0210405_11240347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
| 3300021171|Ga0210405_11291818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 536 | Open in IMG/M |
| 3300021178|Ga0210408_10201575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1582 | Open in IMG/M |
| 3300021560|Ga0126371_12501534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 625 | Open in IMG/M |
| 3300021560|Ga0126371_13787483 | Not Available | 510 | Open in IMG/M |
| 3300022718|Ga0242675_1033782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 790 | Open in IMG/M |
| 3300025901|Ga0207688_10004381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7687 | Open in IMG/M |
| 3300026023|Ga0207677_10514028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1038 | Open in IMG/M |
| 3300026998|Ga0208369_1000210 | Not Available | 3071 | Open in IMG/M |
| 3300027310|Ga0207983_1024059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 746 | Open in IMG/M |
| 3300027812|Ga0209656_10000042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 88859 | Open in IMG/M |
| 3300027812|Ga0209656_10057644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2164 | Open in IMG/M |
| 3300027824|Ga0209040_10401405 | Not Available | 636 | Open in IMG/M |
| 3300027894|Ga0209068_10187370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1134 | Open in IMG/M |
| 3300027911|Ga0209698_10768110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300028562|Ga0302151_10208829 | Not Available | 660 | Open in IMG/M |
| 3300028768|Ga0307280_10403356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 510 | Open in IMG/M |
| 3300028771|Ga0307320_10066714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1341 | Open in IMG/M |
| 3300028784|Ga0307282_10215954 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinaceae → Methanosarcina → Methanosarcina barkeri | 918 | Open in IMG/M |
| 3300028791|Ga0307290_10192629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 747 | Open in IMG/M |
| 3300028906|Ga0308309_11398349 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300029923|Ga0311347_10217511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1173 | Open in IMG/M |
| 3300029956|Ga0302150_10362661 | Not Available | 537 | Open in IMG/M |
| 3300029990|Ga0311336_10007236 | All Organisms → cellular organisms → Bacteria | 8347 | Open in IMG/M |
| 3300031028|Ga0302180_10066482 | Not Available | 2132 | Open in IMG/M |
| 3300031231|Ga0170824_114013053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
| 3300031544|Ga0318534_10152983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1331 | Open in IMG/M |
| 3300031545|Ga0318541_10551186 | Not Available | 645 | Open in IMG/M |
| 3300031572|Ga0318515_10049733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2106 | Open in IMG/M |
| 3300031573|Ga0310915_10080353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2166 | Open in IMG/M |
| 3300031573|Ga0310915_11150591 | Not Available | 538 | Open in IMG/M |
| 3300031668|Ga0318542_10161780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1116 | Open in IMG/M |
| 3300031708|Ga0310686_112618026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2468 | Open in IMG/M |
| 3300031708|Ga0310686_114689628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300031719|Ga0306917_11251536 | Not Available | 575 | Open in IMG/M |
| 3300031724|Ga0318500_10665913 | Not Available | 529 | Open in IMG/M |
| 3300031748|Ga0318492_10800201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 507 | Open in IMG/M |
| 3300031769|Ga0318526_10162707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 909 | Open in IMG/M |
| 3300031769|Ga0318526_10326632 | Not Available | 627 | Open in IMG/M |
| 3300031795|Ga0318557_10141650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1084 | Open in IMG/M |
| 3300031797|Ga0318550_10154762 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300031799|Ga0318565_10109696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus ruber | 1327 | Open in IMG/M |
| 3300031832|Ga0318499_10134805 | Not Available | 962 | Open in IMG/M |
| 3300031879|Ga0306919_11282537 | Not Available | 555 | Open in IMG/M |
| 3300031890|Ga0306925_10084120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3369 | Open in IMG/M |
| 3300031890|Ga0306925_10193181 | Not Available | 2194 | Open in IMG/M |
| 3300031890|Ga0306925_10363381 | Not Available | 1554 | Open in IMG/M |
| 3300031893|Ga0318536_10539220 | Not Available | 585 | Open in IMG/M |
| 3300031894|Ga0318522_10280462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 632 | Open in IMG/M |
| 3300031897|Ga0318520_10575544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 699 | Open in IMG/M |
| 3300031912|Ga0306921_11950372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 627 | Open in IMG/M |
| 3300031912|Ga0306921_12398980 | Not Available | 550 | Open in IMG/M |
| 3300031959|Ga0318530_10077558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1295 | Open in IMG/M |
| 3300032008|Ga0318562_10625178 | Not Available | 621 | Open in IMG/M |
| 3300032035|Ga0310911_10805557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300032041|Ga0318549_10495920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 549 | Open in IMG/M |
| 3300032042|Ga0318545_10114319 | Not Available | 950 | Open in IMG/M |
| 3300032043|Ga0318556_10245480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 934 | Open in IMG/M |
| 3300032044|Ga0318558_10357403 | Not Available | 725 | Open in IMG/M |
| 3300032044|Ga0318558_10675071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 516 | Open in IMG/M |
| 3300032054|Ga0318570_10404203 | Not Available | 623 | Open in IMG/M |
| 3300032065|Ga0318513_10215982 | Not Available | 926 | Open in IMG/M |
| 3300032068|Ga0318553_10116635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1370 | Open in IMG/M |
| 3300032068|Ga0318553_10524268 | Not Available | 621 | Open in IMG/M |
| 3300032076|Ga0306924_10262584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1983 | Open in IMG/M |
| 3300032076|Ga0306924_10616318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1226 | Open in IMG/M |
| 3300032091|Ga0318577_10054149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1808 | Open in IMG/M |
| 3300032091|Ga0318577_10522361 | Not Available | 565 | Open in IMG/M |
| 3300032160|Ga0311301_11287941 | Not Available | 925 | Open in IMG/M |
| 3300032160|Ga0311301_12632636 | Not Available | 557 | Open in IMG/M |
| 3300032261|Ga0306920_101265577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1063 | Open in IMG/M |
| 3300032261|Ga0306920_103366600 | Not Available | 594 | Open in IMG/M |
| 3300032261|Ga0306920_104374273 | Not Available | 507 | Open in IMG/M |
| 3300032770|Ga0335085_10210817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2370 | Open in IMG/M |
| 3300032770|Ga0335085_11283036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii | 774 | Open in IMG/M |
| 3300032770|Ga0335085_11728182 | Not Available | 643 | Open in IMG/M |
| 3300032782|Ga0335082_10180508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2020 | Open in IMG/M |
| 3300032783|Ga0335079_10001063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 31219 | Open in IMG/M |
| 3300032783|Ga0335079_10032861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5956 | Open in IMG/M |
| 3300032783|Ga0335079_11339499 | Not Available | 713 | Open in IMG/M |
| 3300032783|Ga0335079_11621902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300032805|Ga0335078_10488677 | Not Available | 1585 | Open in IMG/M |
| 3300032805|Ga0335078_11653918 | Not Available | 705 | Open in IMG/M |
| 3300032805|Ga0335078_12242980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
| 3300032892|Ga0335081_10073224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5224 | Open in IMG/M |
| 3300032892|Ga0335081_10191428 | Not Available | 2846 | Open in IMG/M |
| 3300032893|Ga0335069_12100148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 593 | Open in IMG/M |
| 3300032897|Ga0335071_12049280 | Not Available | 515 | Open in IMG/M |
| 3300032898|Ga0335072_10140877 | All Organisms → cellular organisms → Bacteria | 2979 | Open in IMG/M |
| 3300032898|Ga0335072_10412513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus | 1443 | Open in IMG/M |
| 3300032954|Ga0335083_10750401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 787 | Open in IMG/M |
| 3300032954|Ga0335083_11464886 | Not Available | 519 | Open in IMG/M |
| 3300032955|Ga0335076_10069549 | All Organisms → cellular organisms → Bacteria | 3467 | Open in IMG/M |
| 3300032955|Ga0335076_10736245 | Not Available | 867 | Open in IMG/M |
| 3300033134|Ga0335073_10025752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8130 | Open in IMG/M |
| 3300033134|Ga0335073_11050379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 836 | Open in IMG/M |
| 3300033158|Ga0335077_10042556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5580 | Open in IMG/M |
| 3300033158|Ga0335077_10952362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 860 | Open in IMG/M |
| 3300033158|Ga0335077_11936015 | Not Available | 549 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 16.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.49% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.49% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.21% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.28% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.28% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.28% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.64% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.64% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.64% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.64% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.64% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0174.00000050 | 2166559005 | Simulated | VIAIIIGLLLPGVAVALYFAIAIYLVVPFREVARLLFRRS |
| Ga0063356_1011184922 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VIAIPIGLAVPILAVALYFGLAVYLVVPFREAARVIVGHHSTRR* |
| Ga0070708_1002131402 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VVIGYVIAILIGLVLPEVAVALYCGIAVYLIVPFRQVARLLFRRS* |
| Ga0070663_1016886841 | 3300005455 | Corn Rhizosphere | IGYVIAIPIGLAVPILAVALYFGLAVYLVVPFREAARVIVGHHSTRR* |
| Ga0066704_104470943 | 3300005557 | Soil | LPVVIGYVIAILIGLALPAAAVALYFGLAVYLMVPFREAARVLRRRHSSRQ* |
| Ga0066903_1011930771 | 3300005764 | Tropical Forest Soil | PVVTGYVIAILAGLLLPGVAVAFYFGIAVYLVVPFREVARLLFPLS* |
| Ga0066789_101667081 | 3300005994 | Soil | YVIAIIIGLLFPGVAVALYFGIAIYLVVPFREVARLLVRRS* |
| Ga0075017_1011143902 | 3300006059 | Watersheds | RKFLPVVIAYVIAILLGLALPVAAMALYSGITVYLVVPFREAAQVLARRHSSRK* |
| Ga0075017_1011782163 | 3300006059 | Watersheds | LPVVTGYVIAIIIGLFLPKVAAALYAGLAVYLVVPFREAARVLIRRHT* |
| Ga0075019_107856082 | 3300006086 | Watersheds | VIGYVIAILIGLALPVVAVALYFGIAVYLVVPFREAARVLARRHSTRQ* |
| Ga0075014_1005912292 | 3300006174 | Watersheds | YVAAILIGLALPTLAVAFYFGIAIYLVVPLREIRHLLFGRA* |
| Ga0074047_120182512 | 3300006576 | Soil | VIAIVIGLAVPVAAMGLYFGIAVYPIVPFREVARLWRP* |
| Ga0075521_101687291 | 3300006642 | Arctic Peat Soil | ALIAYVIAILLGLVVPDAAVALYFGIAVYLVVPFRDIARLARRS* |
| Ga0116217_106635211 | 3300009700 | Peatlands Soil | ILVGLALPKVAVALYFGIAVYLVVPFGEVRRLLFRRS* |
| Ga0126373_132506672 | 3300010048 | Tropical Forest Soil | GYVLAIIIGLLWPTVAVAVYSAIAVYLVVPFREVARLLFRRT* |
| Ga0074045_102376001 | 3300010341 | Bog Forest Soil | VIAIGLVAPRAAVAFYFALAVYLIMPFGEVARLLFRRS* |
| Ga0126378_131270791 | 3300010361 | Tropical Forest Soil | KFLPVVIGYVIAIITGLLLPVVAAALYAGLAVYLVVPFREATRVLIRRHSSRQ* |
| Ga0126379_128906881 | 3300010366 | Tropical Forest Soil | KFLPVVIGYVIAIIIGLLLPVVAAALYAGLGVYLVVPFREATRVLIRRHSSRQ* |
| Ga0136449_1001227646 | 3300010379 | Peatlands Soil | MIAILIGLALPIAAVALYFGLAVYLVVPFREVARLLSRHS* |
| Ga0136449_1009562622 | 3300010379 | Peatlands Soil | VIAIGLVAPRAAVAFYFALAVYLIVPFGEVARLLFRRS* |
| Ga0136449_1012442153 | 3300010379 | Peatlands Soil | IAILIGLFVPGAAVALYVSITVYLIVPFRDVARLLFRRS* |
| Ga0136449_1036364283 | 3300010379 | Peatlands Soil | GLLLPGAAVALYFAIAIYLVVPFREVARLLFRRS* |
| Ga0137383_100060085 | 3300012199 | Vadose Zone Soil | LPIVIRYVIAVLIGLALPQVAVALYFGIAVYLIVPFREVGRLLYRRS* |
| Ga0137382_110573421 | 3300012200 | Vadose Zone Soil | AIIGYVIAILVGLVFPGLAVAAYFGIAVYLVVPFREITRMLFRRP* |
| Ga0137379_100907623 | 3300012209 | Vadose Zone Soil | VIGYVIAILIGLALPQVAVALYFGIAVYLIVPFREVGRLLYRRS* |
| Ga0137377_105137642 | 3300012211 | Vadose Zone Soil | LPIVIGYVIAILIGLALPQVAVALYFGIAVYLIVPFREVGRLLYRRS* |
| Ga0137387_112393422 | 3300012349 | Vadose Zone Soil | FPAAAVALYFGLAVYLVVPFREAARVLARRYGSRQ* |
| Ga0164298_107883311 | 3300012955 | Soil | IPIGLAVPILAVALYFGLAVYLVVPFREAARVIVGHHSTRR* |
| Ga0126369_129610011 | 3300012971 | Tropical Forest Soil | KFLPAVIGYVIAIIIGLLLPVLAAALYAGLALYLVVPFREATRVLIRRHSSRQ* |
| Ga0181532_101027073 | 3300014164 | Bog | YVIAILIGLALPGAAVALYFGITVYLIVPFREVVRLLSRRP* |
| Ga0132255_1004182541 | 3300015374 | Arabidopsis Rhizosphere | VIAILIGLALPVAAVALYFGLAVYLVVPFREAARVLRRRHGSRQ* |
| Ga0132255_1006396991 | 3300015374 | Arabidopsis Rhizosphere | IIIGLLLPGVAVALYFAIAIYLVVPFREVAGLLFRRS* |
| Ga0132255_1023669762 | 3300015374 | Arabidopsis Rhizosphere | VTATLIGLVLPVLAVALYFGIAVYLVVPFREVARLLASRRRGSRH* |
| Ga0182036_101891203 | 3300016270 | Soil | LLLPVLAAALYAGLALYLVVPFREATRVLIRRHSSRQ |
| Ga0182033_108307022 | 3300016319 | Soil | YVIAIIIGLLLPVAAAALYAGLAVYLVVPFREAARVLIRRQSSHHEPRAGSDG |
| Ga0182035_114223821 | 3300016341 | Soil | EQRKLLPVVIGYVVAILIGLLLPAVAVAFYFGIAVYLVVPFREVARLLFRLS |
| Ga0182040_113042772 | 3300016387 | Soil | LLPVVAAALYAGLAVYLVVPFREAARVLMRRHSSRHEPRPQL |
| Ga0182039_108808881 | 3300016422 | Soil | IGYVIAIIIGLLLPVVAAALYAGLAVYLVVPFREATRVLIRRHSSRQ |
| Ga0182038_110812712 | 3300016445 | Soil | GLLLPVVAAAIYAGLAVYLVVPFREATRVLIRRHSHRQ |
| Ga0181505_106200851 | 3300016750 | Peatland | KLLPVVIGYVIAILIGLALPGAAVALYFGITVYLIVPFREVVRLLSRRP |
| Ga0187812_11005891 | 3300017821 | Freshwater Sediment | ADQRKFLPVVTGYVIAILIGLLAPVLAVVLYFGIAVYLVVPFREAARVLIRRRGARR |
| Ga0187802_101433352 | 3300017822 | Freshwater Sediment | YVIAILIGLVLPEVAVVLYCGIAVYLIVPFRHVARLLFRRS |
| Ga0187807_10188921 | 3300017926 | Freshwater Sediment | LPAVIGYVIAILIGLLLPVAAVALYFGLAVYLVVPFREAARVLRRRHSPRQ |
| Ga0187806_10097963 | 3300017928 | Freshwater Sediment | QRKFLPGVIGYVIANLIGLALPVAAVALYFGIAVYLVVPFREAARVLRRRHSPRQ |
| Ga0187806_12011151 | 3300017928 | Freshwater Sediment | LLPVVIGYVIAILIGLALPAAAVALYFGLAVYLVVPFRETARVLRQRHSSRQ |
| Ga0187801_101659854 | 3300017933 | Freshwater Sediment | YVIAILIGLALPEVAVALYFGIAIYLVVPFRETARVLRRRHSSRR |
| Ga0187808_106161342 | 3300017942 | Freshwater Sediment | LLLPVAAVALYFGLAVYLVVPFREAARVLIRRHSSRQ |
| Ga0187819_100732004 | 3300017943 | Freshwater Sediment | GLAAPIAAVALYSGIALYLVVPLREAARVLRKRHSSSQ |
| Ga0187822_100815782 | 3300017994 | Freshwater Sediment | LVLPVAAVALYFGLAVYLVVPFREAARVLIRRHSSRQ |
| Ga0187804_104672011 | 3300018006 | Freshwater Sediment | IGLLLPAAAVALYFGLAVYLVVPFREAARVLIRRHSSRQ |
| Ga0187804_105437442 | 3300018006 | Freshwater Sediment | IAILTGLLLPVAAVALYFGLAVYLVVPFREAARVLIRRHSSRH |
| Ga0187805_100432026 | 3300018007 | Freshwater Sediment | GTQLKILPSVILYVIAILIGLALPEVAVALYFGIAIYLVVPFRETARVLRRRHSSRR |
| Ga0187805_103167211 | 3300018007 | Freshwater Sediment | LIGLALPALAVALYFGIAVYLVVPFRDAARVLIRRHSSRR |
| Ga0187872_102448491 | 3300018017 | Peatland | GYVIAIVIGLAVPVAAVVFYFGIAVYAIVPFRKVAGLLFGRS |
| Ga0187765_105603872 | 3300018060 | Tropical Peatland | IIIGLFVPVVAAALYAGLAVYLVIPFREAARVLILRHSS |
| Ga0210403_114177021 | 3300020580 | Soil | LPVAAASLYFGLAVYLVVPFREVARVLARRHSSGQ |
| Ga0210404_104016562 | 3300021088 | Soil | LIGLLVPRAAVTLYFFLAVYLIVPFGEMARLLFRRP |
| Ga0210405_112403472 | 3300021171 | Soil | LLPAVIGYVIAILIGLLVPRAAVTLYFFLAVYLIVPFGEMARLLFRRP |
| Ga0210405_112918181 | 3300021171 | Soil | VIAILIGLLVPRAAVTLYFFLAVYLIVPFGEMARLLFRR |
| Ga0210408_102015753 | 3300021178 | Soil | VIAILIGLLVPRAAVTLYFFLAVYLIVPFGEMARLLFRRS |
| Ga0126371_125015341 | 3300021560 | Tropical Forest Soil | MIAILIGLLLPVVAVAIYFGIAVYLVVPFREVARLLFRLS |
| Ga0126371_137874831 | 3300021560 | Tropical Forest Soil | IGLLLPVAAAALYAGLAVYLVLPFREATRVLIRRRSPRQ |
| Ga0242675_10337822 | 3300022718 | Soil | VIGYVIVILIGLLVPRAAVTLYFFIAVYLIVPFGEMARLLFRRP |
| Ga0207688_100043814 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VIAIPIGLAVPILAVALYFGLAVYLVVPFREAARVIVGHHSTRR |
| Ga0207677_105140282 | 3300026023 | Miscanthus Rhizosphere | TIGYVIAIPIGLAVPILAVALYFGLAVYLVVPFREAARVIVGHHSTRR |
| Ga0208369_10002101 | 3300026998 | Forest Soil | SAQRRLLPAVIGYVIAILIGLLVPRAAVTLYFFLAVYLIVPFGEMARLLFRRP |
| Ga0207983_10240591 | 3300027310 | Soil | IGYVIAILIGLALSAAAMALYAGITVYLVMPFREAARVLRRRHSSRQ |
| Ga0209656_100000429 | 3300027812 | Bog Forest Soil | VIAIGLVAPRAAVAFYFALAVYLIMPFGEVARLLFRRS |
| Ga0209656_100576442 | 3300027812 | Bog Forest Soil | VIATQIGLVVPEAAVALYFGIALYLIVPFRQLARLLFRRP |
| Ga0209040_104014051 | 3300027824 | Bog Forest Soil | IVYVIAILIGLLLPVAAVALYAGIAVYLVVPFREAGRVLRRRHTRP |
| Ga0209068_101873703 | 3300027894 | Watersheds | IGIALVLPVVAIAFYFGIAIYLVTPFREVARAFRRQPVD |
| Ga0209698_107681101 | 3300027911 | Watersheds | LIGLVLPEAAVVLYCGIAVYLIVPFREVARLLPRRS |
| Ga0302151_102088291 | 3300028562 | Bog | AIVIGLAVPVAAVVFYFGIAVYAIVPFRKVAGLLFGRS |
| Ga0307280_104033562 | 3300028768 | Soil | VIAILIGLVVPQVAVALFFGIAVYQVVPFREVARLFRRS |
| Ga0307320_100667142 | 3300028771 | Soil | VIAILIGLALPVLALAVYLGLAVYLVVPFRDRRAPTPD |
| Ga0307282_102159542 | 3300028784 | Soil | VIAILIGLVVPQVAVALFFGIAVYQVVPFREFARLFRRS |
| Ga0307290_101926292 | 3300028791 | Soil | VIAILIGLALPVLALAVYLGLAVYLVVPFREIAGLL |
| Ga0308309_113983491 | 3300028906 | Soil | IGYVIAIGIGLLAPRAAVALYFCLAVFLIVPFGEMGRLLFRGR |
| Ga0311347_102175114 | 3300029923 | Fen | VVAILVGLALPGLAVVFYFGIAVYLVVPFREVARLLF |
| Ga0302150_103626611 | 3300029956 | Bog | IVIGLAVPVAAVVFYFGIAVYAIVPFRKVAGLLFGRS |
| Ga0311336_100072369 | 3300029990 | Fen | VVAILVGLALPGLAVVFYFGIAVYLVVPFREVARLLFRRS |
| Ga0302180_100664821 | 3300031028 | Palsa | VIGLAVPVAAVVFYFGIAVYAIVPFRKVAGLLFGRS |
| Ga0170824_1140130531 | 3300031231 | Forest Soil | PVVFGYVIAILIGLVVPQVAVALFFGIAVYQVVPFQEVARLFRRS |
| Ga0318534_101529831 | 3300031544 | Soil | VIAIIIGLLLPVVAAAIYAGLAVYLVVPFREATRVLIRRHSHRQ |
| Ga0318541_105511861 | 3300031545 | Soil | KFLPVVIGYVIAIIIGLLLPVVAAALYAGLAVYLVVPFREATRVLIRRHSSRQ |
| Ga0318515_100497332 | 3300031572 | Soil | RKFLPAVIGYVIAIIIGLLLPVVAAALYAGLAVYLVVPFREAARVLMRRHSSRHEPRPQL |
| Ga0310915_100803532 | 3300031573 | Soil | VIAILIGLLLPVVAAALYAGLAVYLVVPFREAARVLMRRHSSRHEPRPQL |
| Ga0310915_111505911 | 3300031573 | Soil | LLLPVVAAALYAGLAVYLVVPFREATRVLIRRHSSRP |
| Ga0318542_101617802 | 3300031668 | Soil | IIIGLLLPVVAAALYAGLAVYLVVPFREATRVLIRRHSPRQ |
| Ga0310686_1126180266 | 3300031708 | Soil | VVIGYVIAILIGLVLPEAAVALYFGIAVDLIVPFRHVARLLFRRP |
| Ga0310686_1146896281 | 3300031708 | Soil | VIAILIRLLVPRAAVTLYFFLAVYLIVPFGEMARLLLRRS |
| Ga0306917_112515361 | 3300031719 | Soil | PVVAAALYAGLAVYLVVPFREATTVLIRRHSSRQLNG |
| Ga0318500_106659131 | 3300031724 | Soil | GLLLPVAAAALYAGLAVYLVVPFREATRVLIRRHSSRQ |
| Ga0318492_108002012 | 3300031748 | Soil | GYVIAIIIGLLLPVVAAALYAGLAVYLVVPFREATRVLIRRHSHRQ |
| Ga0318526_101627071 | 3300031769 | Soil | LPVVAAALYAGLAVYLVVPFREATTVLIRRHSSRQLNG |
| Ga0318526_103266321 | 3300031769 | Soil | YVVAIIIGLLLPVLAAALYAGLAVYLVVPFREATRVLIRRHSSRQ |
| Ga0318557_101416502 | 3300031795 | Soil | LPVVVGYVVAIIIGLLLPVLAAALYAGLAVYLVVPFREATRVLIRRHSSRQ |
| Ga0318550_101547621 | 3300031797 | Soil | VIAIIIGLLLPVAAAALYAGLAVYLVVPFREATRVLIRRHSSRQ |
| Ga0318565_101096961 | 3300031799 | Soil | IAIIIGLLEPVAAAALYAGLAVYLVVPFREATRVLIRRHSSRQ |
| Ga0318499_101348051 | 3300031832 | Soil | TTERKFLPAVAGYVIAIIIGLLLPAAAAALYACLAVYLVVPFREAARVLIRRHRSRQ |
| Ga0306919_112825371 | 3300031879 | Soil | GYVIAIIIGLLLPVAAAALYAGLAVYLVVPFREAARVLIRRHSSHHEPRAGSDG |
| Ga0306925_100841201 | 3300031890 | Soil | LLPVAAATLYAGLAVYLVVPFREATRVLIRRHSSRQ |
| Ga0306925_101931812 | 3300031890 | Soil | KFLPAVAGYVIAIIIGLLLPVAAAALYAGLAVYLVVPFREAARVLIRRHRSRQ |
| Ga0306925_103633812 | 3300031890 | Soil | VIIGYVIAIIIGLLLPVAAAALYAGLAVYLVVPFREATRVLIRRHGPRQ |
| Ga0318536_105392202 | 3300031893 | Soil | IGYVIAIIIGLLLPVVAAALYAGLAVYLVVPFREATRVLIRRHSSRP |
| Ga0318522_102804622 | 3300031894 | Soil | PAVIGYVIAIIIGLLLPVVAAALYAGLAVYLVVPFREATRVLIRRHSHRQ |
| Ga0318520_105755441 | 3300031897 | Soil | KFLPVVIGYVIAIIIGLLLPVVAAALYAGLAVYLVVPFREATRVLIRRHSHRQ |
| Ga0306921_119503721 | 3300031912 | Soil | FLPVVIGYVIAIIIGLLLPVVAAALYAGLAVYLVVPFREATSVLIRRHSSRQ |
| Ga0306921_123989801 | 3300031912 | Soil | YVIAIIIGLLLPVAAAALYAGLAVYLVVPFREAARVLIRRHSSHHEPRAGSDG |
| Ga0318530_100775582 | 3300031959 | Soil | VIGYVIAILIGLLLPVVAAALYAGLAVYLVVPFREAARVLMRRHSSRHEPRPQL |
| Ga0318562_106251781 | 3300032008 | Soil | AILIGLLLPGVAVALYFGIAVYLVVPFREVARLLFRPS |
| Ga0310911_108055571 | 3300032035 | Soil | IAIIIGLLLPVVAAALYAGLAVYLVVPFREATRVLIRRHSPR |
| Ga0318549_104959201 | 3300032041 | Soil | YVIAIIIGLLLPVVAAAIYAGLAVYLVVPFREATRVLIRRHSHRQ |
| Ga0318545_101143191 | 3300032042 | Soil | YVVAILIGLLLPAVAVAFYFGIVVYLVVPFREVARLLFRLS |
| Ga0318556_102454801 | 3300032043 | Soil | YVIAIIIGLLLPVAAAALYAGLAVYLVVPFREATRVLIRRHSSRQ |
| Ga0318558_103574032 | 3300032044 | Soil | QRKFLPVVIGYVIAIIIGLLLPVVAAALYAGLAVYLVVPFREATRVLIRRHSSRQ |
| Ga0318558_106750711 | 3300032044 | Soil | VAIGYVTAILIGLLVPLAAVALYFGIAVYLIVPFRQVARLLFRRP |
| Ga0318570_104042032 | 3300032054 | Soil | IILGLLLPVAAAALYAGLAVYLVVPFREAARVLIRRHSSHHEPRASSDG |
| Ga0318513_102159822 | 3300032065 | Soil | RKFLPVVTGYVIAIIIGLLLPVAAAALYAGLAVYLVVPFREAARVLIRRHGSHHEPRASSDG |
| Ga0318553_101166352 | 3300032068 | Soil | VVIGYVAAILIGLLWPGVAVAFYFGIAVYLVVPFRQVARLLFRPSHRA |
| Ga0318553_105242682 | 3300032068 | Soil | FLPVVTGYVIAIIIGLLLPVAAAALYAALAVYLVVPFRAAARVLIRRHSSSQ |
| Ga0306924_102625843 | 3300032076 | Soil | VIAIIIGLLLPVVAAALYAGLAVYLVVPFREATRVLIRRHTPRQ |
| Ga0306924_106163182 | 3300032076 | Soil | PAVIGYVIAIIIGLLLPVVAAALYAGLAVYLVVPFREATRVLIRRHSPR |
| Ga0318577_100541492 | 3300032091 | Soil | RKFLPVVIGYVIAIILGLLLPVAAAALYAGLAVYLVVPFREAARVLIRRHSSHHEPRASSDG |
| Ga0318577_105223611 | 3300032091 | Soil | LPVVIGYVTAILIGLLLPGVAVALYFGIAVYLVVPFREVARLLFRPS |
| Ga0311301_112879411 | 3300032160 | Peatlands Soil | ILIGLAVPGAAVALYFGITVYLIVPFREVARLLSRRP |
| Ga0311301_126326361 | 3300032160 | Peatlands Soil | VIAILIGLVVPQVAVALFFGIAVYLVVPFREVARLFRRS |
| Ga0306920_1012655771 | 3300032261 | Soil | YVIAIIIGLLLPVAAAALYAALAVYLVVPFRAAARVLIRRHSSSQ |
| Ga0306920_1033666001 | 3300032261 | Soil | GYVIAIIIGLLLPVVAAALYAGLAVYLVVPFREATRVLIRRHSSRQ |
| Ga0306920_1043742731 | 3300032261 | Soil | VAAILIGLLWPEVAVAFYFGIAVYLVVPFREVARLVFRPS |
| Ga0335085_102108174 | 3300032770 | Soil | VYVIAILVGLAMPVLAVALYSGIAVYLVVPFREAARVLIRRHGTRQ |
| Ga0335085_112830363 | 3300032770 | Soil | LIGLLLPTAAVALYFGLAVYLVVPFREAARVLRRRHSLRQ |
| Ga0335085_117281822 | 3300032770 | Soil | LPAVIGYVIAILIGLILPVAAVALYFGLAVYLVVPFREAARVLIRRHSSRQ |
| Ga0335082_101805081 | 3300032782 | Soil | ILIGLLLPVAAVALYFGLAVYLVVPFREAARVLRRRHSSRQ |
| Ga0335079_1000106323 | 3300032783 | Soil | VIVILVGLGLPAGAVALYFGIAVYLIVPFRDVARLLSRRS |
| Ga0335079_100328619 | 3300032783 | Soil | AILIGLLLPVAAVALYFGLAVYLVVPFREAARVLARRHSSGQ |
| Ga0335079_113394993 | 3300032783 | Soil | IGLAFPVLAVALYFGITVYLVVPFREAARVLIRRRSSRQ |
| Ga0335079_116219021 | 3300032783 | Soil | YVTAILTGLVVPQVAVALFFGIAVYQVVPFREVARLFRRS |
| Ga0335078_104886771 | 3300032805 | Soil | YVIAILIGLALPVAAVALYFGLAVYLVVPFREAARVLARRHSPRQ |
| Ga0335078_116539182 | 3300032805 | Soil | VIGYVIAILTGLLLPVAAVALYFGLAVYLVVPFREAARVLIRRHSSRQ |
| Ga0335078_122429801 | 3300032805 | Soil | IGLLLPVAAVALYFGIAVYLVVPFREAARVLRRRHSSRQ |
| Ga0335081_100732241 | 3300032892 | Soil | VIGYVIAILIGLFLPVAAVALYFGLAVYLVVPFREAARVLIRRHSSRQ |
| Ga0335081_101914282 | 3300032892 | Soil | YVIAILIGLALPVAAVALYFGLAVYLVVPFREAARVLARRHSSRQ |
| Ga0335069_121001482 | 3300032893 | Soil | QRKFLPAVIGYVIAILTGLLLPAAAVALYFGLAVYLVVPFREAARVLIRRHSSRH |
| Ga0335071_120492802 | 3300032897 | Soil | LPAVIGYVIAILIGLLLPVAAAALYAGLAVYLVVPFREAARVLIRRHSSRHEPAPSSDG |
| Ga0335072_101408771 | 3300032898 | Soil | GLLLPVAAAALYAGLAVYLVVPFREAARVLIRRHSSRQ |
| Ga0335072_104125131 | 3300032898 | Soil | VIGYVIAILIGLALPVAAVAIYFGIAVYVVVPFRETAQVLRRRHRTR |
| Ga0335083_107504011 | 3300032954 | Soil | VIAILAGLLLPVAAVALYFGLAVYLVVPFREAARVLIRRHGSRN |
| Ga0335083_114648861 | 3300032954 | Soil | IGLILPVAAVALYFGLAVYLVVPFREAARVLIRRHRSPQ |
| Ga0335076_100695495 | 3300032955 | Soil | MLIAIIIGLFLPVVAAALYAGLAVYLVIPFREAARVLILRHSS |
| Ga0335076_107362452 | 3300032955 | Soil | IGLFLPVAAVALYFGLAVYLVVPFREAARVLIRRHSSRQ |
| Ga0335073_100257522 | 3300033134 | Soil | VVIGYVIAILIGLVLPEVAVALYFGIAVYAIVPFRDVAQVLFGRS |
| Ga0335073_110503792 | 3300033134 | Soil | KFLPAVIGYVIAILTGLLLPVAAVALYFGLAVYLVVPFREAARALVRRHSSRQ |
| Ga0335077_100425561 | 3300033158 | Soil | LIGLLLPVAAVALYFGLAVYLVVPFREAARVLARRHSSGQ |
| Ga0335077_109523622 | 3300033158 | Soil | VIAILTGLVLPVAAVALYFGLAVYLVVPFREAARVLIRRHGSRQ |
| Ga0335077_119360151 | 3300033158 | Soil | FLPAVIGYVIAILIGLLLPVAAVALYFGLAVYLVVPFREAARVLIRRHSSRQ |
| ⦗Top⦘ |